HHsearch alignment for GI: 254780322 and conserved domain: PRK09880

>PRK09880 L-idonate 5-dehydrogenase; Provisional.
Probab=96.98  E-value=0.0063  Score=36.38  Aligned_cols=90  Identities=8%  Similarity=0.002  Sum_probs=60.4

Q ss_pred             CCCCEEEECCCCCH-HHHHHHHHCCCCEEEEECCHHHHHHHHHHC-----CC---CCHHHHCCCCCCCCHHHHHHHHHCC
Q ss_conf             98709998599858-999998626970899720011357753110-----01---2001101433352226666674222
Q gi|254780322|r   46 TFENALELHGITGI-VGYTCMETKKIHRMIRAEISTEFSTLKREV-----IS---CPLEEIPSISQSVDLILSPLNLHII  116 (273)
Q Consensus        46 ~~~~vLdlGcGtG~-~~~~l~~~~~~~~v~~~D~s~~~~~~~~~~-----~~---~d~e~l~~~~~sfDli~s~~~l~w~  116 (273)
T Consensus       169 ~g~~VlV~G~G~iGl~~~~~ak~~Ga~~Vi~~d~~~~rl~~a~~~Ga~~~i~~~~~~~~~~~~~~g~~Dvvie~~G----  244 (343)
T PRK09880        169 QGKRVFISGVGPIGCLIVSAVKTLGAAEIVCADLSPRSLSLARQMGADVLVNPQNDDMDHWKAEKGYFDVSFEVSG----  244 (343)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCEEECCCCCCHHHHHHHCCCCCEEEEECC----
T ss_conf             6988999847767999999999869987999979789999999729979987987439999963699778999219----


Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             3469999999998187870898406
Q gi|254780322|r  117 NDTLEMFSKINHMLKPGGMFLAAIP  141 (273)
Q Consensus       117 ~d~~~~l~~~~r~LkpgG~~~~s~~  141 (273)
T Consensus       245 --~~~~~~~al~~~r~gG~iv~vG~  267 (343)
T PRK09880        245 --HPSSVNTCLEVTRAKGVMVQVGM  267 (343)
T ss_pred             --CHHHHHHHHHHCCCCEEEEEEEC
T ss_conf             --99999999973779839999972