HHsearch alignment for GI: 254780322 and conserved domain: PRK11805

>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional.
Probab=99.19  E-value=9.7e-11  Score=81.99  Aligned_cols=116  Identities=14%  Similarity=0.141  Sum_probs=82.0

Q ss_pred             HHHH-HHHHHHHHHHHHC-C-CCCCCEEEECCCCCHHHHHHHHHCCCCEEEEECCHHHHHHHHHHC------------CC
Q ss_conf             8999-9999999789863-6-898709998599858999998626970899720011357753110------------01
Q gi|254780322|r   27 FLLD-RVAKEIAFRLNMI-N-QTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKREV------------IS   91 (273)
Q Consensus        27 ~l~~-~~a~~l~~~l~~~-~-~~~~~vLdlGcGtG~~~~~l~~~~~~~~v~~~D~s~~~~~~~~~~------------~~   91 (273)
T Consensus       111 LIPRpp~~ELi~~~l~~~~~~~~~~rilDlGtGSG~Iaisla~~~p~~~v~a~Dis~~AL~vA~~N~~~~~l~~rv~~~~  190 (307)
T PRK11805        111 LVPRSPIAELIEDGFAPWLEDEQPTRILDLCTGSGCIAIACAYAFPDAEVDAVDISPDALAVAEINIERHGLEDRVTLIQ  190 (307)
T ss_pred             ECCCCCCHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             15899849999999999733578872777427827999999987899889998589999999999999838877389980


Q ss_pred             CCHHHHCCCCCCCCHHHHHHHH------HCCC-----CH--------------HHHHHHHHHHHCCCCEEEEEECCC
Q ss_conf             2001101433352226666674------2223-----46--------------999999999818787089840686
Q gi|254780322|r   92 CPLEEIPSISQSVDLILSPLNL------HIIN-----DT--------------LEMFSKINHMLKPGGMFLAAIPGI  143 (273)
Q Consensus        92 ~d~e~l~~~~~sfDli~s~~~l------~w~~-----d~--------------~~~l~~~~r~LkpgG~~~~s~~~~  143 (273)
T Consensus       191 ~D~~~-~l~~~~fDlIvSNPPYI~~~~~~~L~~ev~~EP~~AL~gG~DGLd~~r~i~~~A~~~L~pgG~L~~EiG~~  266 (307)
T PRK11805        191 SDLFA-ALPGRRYDLIVSNPPYVDAEDMADLPAEYRHEPELALAAGDDGLDLVRRILAEAADYLTEDGVLVCEVGNS  266 (307)
T ss_pred             CCHHH-CCCCCCCCEEEECCCCCCHHHHHHCCHHHCCCCHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             40221-26887507799679978856563397753158788876892488999999998897447696899997978