HHsearch alignment for GI: 254780322 and conserved domain: pfam01189

>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family.
Probab=97.68  E-value=8.6e-05  Score=47.28  Aligned_cols=116  Identities=16%  Similarity=0.134  Sum_probs=76.4

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHC-CCCEEEEECCHHHHHHHHHH-----------CCC
Q ss_conf             206899999999997898636898709998599858999998626-97089972001135775311-----------001
Q gi|254780322|r   24 SVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIVGYTCMETK-KIHRMIRAEISTEFSTLKRE-----------VIS   91 (273)
Q Consensus        24 ~~~~l~~~~a~~l~~~l~~~~~~~~~vLdlGcGtG~~~~~l~~~~-~~~~v~~~D~s~~~~~~~~~-----------~~~   91 (273)
T Consensus        64 G~~~vQD~aS~l~~~~L~--p~~g~~VLD~CAaPGgKt~~la~l~~~~g~i~A~D~~~~Rl~~l~~~~~r~g~~~~~~~~  141 (277)
T pfam01189        64 GAVTVQDASSQLDAIALN--PQEDEFILDMCAAPGGKTTHIAELMKNEGTVVAVDRNKQRLKRVYANIQRLGVFNIIVQE  141 (277)
T ss_pred             CEEEEECHHHHHHHHHHC--CCCCCEEEEECCCCCCHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             179998806778999718--899998988367888169999987589877998379789999999999975997479996


Q ss_pred             CCHHHH--CCCCCCCCHHHHHHH------------HHCCCCH----------HHHHHHHHHHHCCCCEEEEEEC
Q ss_conf             200110--143335222666667------------4222346----------9999999998187870898406
Q gi|254780322|r   92 CPLEEI--PSISQSVDLILSPLN------------LHIINDT----------LEMFSKINHMLKPGGMFLAAIP  141 (273)
Q Consensus        92 ~d~e~l--~~~~~sfDli~s~~~------------l~w~~d~----------~~~l~~~~r~LkpgG~~~~s~~  141 (273)
T Consensus       142 ~d~~~~~~~~~~~~fD~vLvDaPCSg~G~~rr~p~~~~~~~~~~~~~l~~~Q~~iL~~a~~~lk~gG~lvYsTC  215 (277)
T pfam01189       142 GDARQIDQKLLGGEFDRILLDAPCSGTGVIRRDPDIKWLRREADIAQLAELQKELLKAAWDLVKPGGVLVYSTC  215 (277)
T ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCEECCCCCHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             64445574346666657997289889863455853121199999999999999999999997176998999949