HHsearch alignment for GI: 254780322 and conserved domain: pfam01739

>pfam01739 CheR CheR methyltransferase, SAM binding domain. CheR proteins are part of the chemotaxis signaling mechanism in bacteria. CheR methylates the chemotaxis receptor at specific glutamate residues. CheR is an S-adenosylmethionine- dependent methyltransferase - the C-terminal domain (this one) binds SAM.
Probab=98.54  E-value=5.2e-07  Score=60.23  Aligned_cols=116  Identities=16%  Similarity=0.219  Sum_probs=76.6

Q ss_pred             HHHHHHHHHHHHHHCC-CCCCCEEEECCCCCHHHHHHH----HHC-----CCCEEEEECCHHHHHHHHHH----------
Q ss_conf             9999999997898636-898709998599858999998----626-----97089972001135775311----------
Q gi|254780322|r   29 LDRVAKEIAFRLNMIN-QTFENALELHGITGIVGYTCM----ETK-----KIHRMIRAEISTEFSTLKRE----------   88 (273)
Q Consensus        29 ~~~~a~~l~~~l~~~~-~~~~~vLdlGcGtG~~~~~l~----~~~-----~~~~v~~~D~s~~~~~~~~~----------   88 (273)
T Consensus        12 f~~l~~~ilp~l~~~~~~~~lrIWsagCStGEE~YSlAi~l~e~~~~~~~~~~~I~atDI~~~~l~~Ar~G~Y~~~~~~~   91 (194)
T pfam01739        12 FEELEKKVLPELAQARNSRRVRIWSAGCSSGEEPYSLAMLLAETLPNALPWDFKILATDIDLSALEKARAGVYPERELEG   91 (194)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHCCCCHHHHHC
T ss_conf             99999998799985288995599973688995189999999997432578744999973988999999878988999845


Q ss_pred             -----------------------------CCCCCHHHHCCCCCCCCHHHHHHHHHCCCCH--HHHHHHHHHHHCCCCEEE
Q ss_conf             -----------------------------0012001101433352226666674222346--999999999818787089
Q gi|254780322|r   89 -----------------------------VISCPLEEIPSISQSVDLILSPLNLHIINDT--LEMFSKINHMLKPGGMFL  137 (273)
Q Consensus        89 -----------------------------~~~~d~e~l~~~~~sfDli~s~~~l~w~~d~--~~~l~~~~r~LkpgG~~~  137 (273)
T Consensus        92 ~p~~~~~ryF~~~~~~~~~i~~~lr~~V~F~~~NL~~~~~~-~~~DlIfCRNVlIYF~~~~~~~vl~~l~~~L~~gG~L~  170 (194)
T pfam01739        92 LPPELLRRYFTKGAGGGYRVKPEIKEMVLFEYHNLLDYPPL-GDFDVIFCRNVLIYFDEETQRKILNRFASALKPGGYLF  170 (194)
T ss_pred             CCHHHHHHHCCCCCCCCEEECHHHHCCCEEEECCCCCCCCC-CCEEEEEECCEEEECCHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99999996286078994876889971166854665568876-75039998021013799999999999999848994999


Q ss_pred             EEECCCCCCH
Q ss_conf             8406867633
Q gi|254780322|r  138 AAIPGIGTLH  147 (273)
Q Consensus       138 ~s~~~~~~~~  147 (273)
T Consensus       171 lG--~~Esl~  178 (194)
T pfam01739       171 LG--HSESLP  178 (194)
T ss_pred             EE--CCCCCC
T ss_conf             80--756688