HHsearch alignment for GI: 254780322 and conserved domain: pfam02390

>pfam02390 Methyltransf_4 Putative methyltransferase. This is a family of putative methyltransferases. The aligned region contains the GXGXG S-AdoMet binding site suggesting a putative methyltransferase activity.
Probab=98.70  E-value=6.4e-08  Score=65.51  Aligned_cols=99  Identities=16%  Similarity=0.088  Sum_probs=74.0

Q ss_pred             CCCCCCEEEECCCCCHHHHHHHHHCCCCEEEEECCHHHHHHHHH------------HCCCCCHHH-HC--CCCCCCCHHH
Q ss_conf             68987099985998589999986269708997200113577531------------100120011-01--4333522266
Q gi|254780322|r   44 NQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTEFSTLKR------------EVISCPLEE-IP--SISQSVDLIL  108 (273)
Q Consensus        44 ~~~~~~vLdlGcGtG~~~~~l~~~~~~~~v~~~D~s~~~~~~~~------------~~~~~d~e~-l~--~~~~sfDli~  108 (273)
T Consensus        18 ~~~~pi~lEIG~G~G~~l~~~A~~~p~~n~iGiEi~~~~v~~~~~k~~~~~~l~Ni~~~~~da~~~l~~~~~~~~l~~i~   97 (199)
T pfam02390        18 GNEQPLFLEIGCGMGDFLVAMAKKNPDKLFIGIEIRVPGVDKALKKIIALRGLQNLRILCGDAMKLLPNLFPDGSLQKIF   97 (199)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEEECHHHHHHHHHHHHHHCCCCCEEEECCCHHHHHHHHCCCCCEEEEE
T ss_conf             99994499973688899999999789987899995059999999999984577737876047999999757988642799


Q ss_pred             HHHHHHCCCCH--------HHHHHHHHHHHCCCCEEEEEECC
Q ss_conf             66674222346--------99999999981878708984068
Q gi|254780322|r  109 SPLNLHIINDT--------LEMFSKINHMLKPGGMFLAAIPG  142 (273)
Q Consensus       109 s~~~l~w~~d~--------~~~l~~~~r~LkpgG~~~~s~~~  142 (273)
T Consensus        98 i~FPDPWpKkrH~KRRli~~~fl~~~~~~Lk~gG~l~~~TD~  139 (199)
T pfam02390        98 INFPDPWPKKRHHKRRLLQPEFLKEYARVLKPGGVLHLATDV  139 (199)
T ss_pred             EECCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEECC
T ss_conf             967999876442440007999999999963889899998289