>pfam03059 NAS Nicotianamine synthase protein. Nicotianamine synthase EC:2.5.1.43 catalyses the trimerisation of S-adenosylmethionine to yield one molecule of nicotianamine. Nicotianamine has an important role in plant iron uptake mechanisms. Plants adopt two strategies (termed I and II) of iron acquisition. Strategy I is adopted by all higher plants except graminaceous plants, which adopt strategy II. In strategy I plants, the role of nicotianamine is not fully determined: possible roles include the formation of more stable complexes with ferrous than with ferric ion, which might serve as a sensor of the physiological status of iron within a plant, or which might be involved in the transport of iron. In strategy II (graminaceous) plants, nicotianamine is the key intermediate (and nicotianamine synthase the key enzyme) in the synthesis of the mugineic family (the only known family in plants) of phytosiderophores. Phytosiderophores are iron chelators whose secretion by the roots is great

Probab=96.35 E-value=0.047 Score=31.33 Aligned_cols=96 Identities=4% Similarity=0.035 Sum_probs=73.2 Q ss_pred CCCCCCEEEECCCCCHHHHHHHH--HCCCCEEEEECCHHHHHHHHHH-------------CCCCCHHHHCCCCCCCCHHH Q ss_conf 68987099985998589999986--2697089972001135775311-------------00120011014333522266 Q gi|254780322|r 44 NQTFENALELHGITGIVGYTCME--TKKIHRMIRAEISTEFSTLKRE-------------VISCPLEEIPSISQSVDLIL 108 (273) Q Consensus 44 ~~~~~~vLdlGcGtG~~~~~l~~--~~~~~~v~~~D~s~~~~~~~~~-------------~~~~d~e~l~~~~~sfDli~ 108 (273) T Consensus 119 ~~~p~~vAFIGSGPLPLTsivLa~~h~~~~~~~niD~d~~A~~~A~~lv~~~g~ls~~m~f~t~d~~~~~~~l~~~DvV~ 198 (277) T pfam03059 119 TGVPSRIAFIGSGPLPLTSIVLASYHLPDTSFDNYDIDGLANDRASKLVSSDPDLSSRMSFHTADVLDVTTELKAYDVVF 198 (277) T ss_pred CCCCCEEEEECCCCCCHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHHHHCCCHHCCEEEEECCCCCCCCCCCCCCEEE T ss_conf 89974489963788613899998850887314331278899999999998655300472899526444444445476898 Q ss_pred HHHHHHCC-CCHHHHHHHHHHHHCCCCEEEEE Q ss_conf 66674222-34699999999981878708984 Q gi|254780322|r 109 SPLNLHII-NDTLEMFSKINHMLKPGGMFLAA 139 (273) Q Consensus 109 s~~~l~w~-~d~~~~l~~~~r~LkpgG~~~~s 139 (273) T Consensus 199 lAALVGm~~e~K~~I~~hL~k~m~~Ga~l~~R 230 (277) T pfam03059 199 LAALVGMDKEEKAKVIDHLGKHMAPGALLVLR 230 (277) T ss_pred EHHHCCCCHHHHHHHHHHHHHHCCCCCEEEEE T ss_conf 72113543335999999999745899679996

HHsearch alignment for GI: 254780322 and conserved domain: pfam03059