BLAST/PSIBLAST alignment of GI: 254780322 and GI: 190893599 at iteration 1
>gi|190893599|ref|YP_001980141.1| methyltransferase [Rhizobium etli CIAT 652] Length = 294
>gi|190698878|gb|ACE92963.1| putative methyltransferase protein [Rhizobium etli CIAT 652] Length = 294
 Score =  262 bits (670), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 134/264 (50%), Positives = 172/264 (65%)

Query: 1   MNILFDMQLINRNRLRSFRQKDFSVYFLLDRVAKEIAFRLNMINQTFENALELHGITGIV 60
           M ++FD  LI  +R R+    D    FLLD  A+E+A RL ++ + FE A+ELHG TG  
Sbjct: 1   MEMIFDRALIAAHRHRALVNNDPKAAFLLDIAAEEMAERLAVVERRFETAVELHGTTGAA 60

Query: 61  GYTCMETKKIHRMIRAEISTEFSTLKREVISCPLEEIPSISQSVDLILSPLNLHIINDTL 120
               M T KI  MIR E    ++      I  PLE++P   QS +LIL+PL+LH+ NDT 
Sbjct: 61  ARAAMATGKIGTMIRVESEKAYAASSESFIEAPLEDVPLDPQSANLILAPLSLHLTNDTP 120

Query: 121 EMFSKINHMLKPGGMFLAAIPGIGTLHELRKALLKAETELTGGASPRVIPFMDIKSAGTL 180
            +F +I   LKP G+FLAAIPG GTL ELR ALL AE E+TGGASPRVIPF D++  G+L
Sbjct: 121 GVFIQIRRALKPDGLFLAAIPGAGTLQELRDALLTAEVEMTGGASPRVIPFADVRDVGSL 180

Query: 181 MEKSGFISPIIDQDTYTVYYKSMLHLMHDLRGMGMSNPLIRRSKTPPYKSLFKRASTIYT 240
           M+++GF  P+ID +TYTV Y S+  LM DLR MGMSNPL  R + P  ++ F RA+ IY 
Sbjct: 181 MQRAGFTLPVIDAETYTVRYDSLFPLMRDLRAMGMSNPLAARGRMPLTRAFFLRAAEIYA 240

Query: 241 EENSDLTGNVTASFSIIYVMGWKS 264
           E  SD  G + A+FSIIYV GW +
Sbjct: 241 ERYSDPDGRIRATFSIIYVSGWAA 264