BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780324|ref|YP_003064737.1| hypothetical protein CLIBASIA_01045 [Candidatus Liberibacter asiaticus str. psy62] (61 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780324|ref|YP_003064737.1| hypothetical protein CLIBASIA_01045 [Candidatus Liberibacter asiaticus str. psy62] gi|254040001|gb|ACT56797.1| hypothetical protein CLIBASIA_01045 [Candidatus Liberibacter asiaticus str. psy62] Length = 61 Score = 114 bits (286), Expect = 3e-24, Method: Composition-based stats. Identities = 61/61 (100%), Positives = 61/61 (100%) Query: 1 MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYR 60 MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYR Sbjct: 1 MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYR 60 Query: 61 R 61 R Sbjct: 61 R 61 >gi|315122251|ref|YP_004062740.1| hypothetical protein CKC_02515 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495653|gb|ADR52252.1| hypothetical protein CKC_02515 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 66 Score = 73.1 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 1/61 (1%) Query: 1 MGNSVNSTILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKHDLYHDYR 60 +G+SVNS K + S +KWRD N+WLLFG+V+VYFSISFSSR+VDYVD+ H Y+DY+ Sbjct: 2 IGDSVNSIDFKEKSSSDGVKWRDGNIWLLFGIVVVYFSISFSSRVVDYVDENH-FYYDYK 60 Query: 61 R 61 R Sbjct: 61 R 61 >gi|327311383|ref|YP_004338280.1| binding-protein-dependent transport systems inner membrane component [Thermoproteus uzoniensis 768-20] gi|326947862|gb|AEA12968.1| binding-protein-dependent transport systems inner membrane component [Thermoproteus uzoniensis 768-20] Length = 543 Score = 34.2 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Query: 9 ILKAEGSIVNIKWRDANVWLLFGVVMVYFSISFSSRIVDYVDQKH 53 I AEG+I W L+FGVV+V F+I F+ R++D +K+ Sbjct: 494 ISTAEGNIALAAWAS----LIFGVVVVLFAIFFTRRLMDLAQKKY 534 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.325 0.138 0.426 Lambda K H 0.267 0.0447 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 798,096,260 Number of Sequences: 14124377 Number of extensions: 30799167 Number of successful extensions: 101261 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 101259 Number of HSP's gapped (non-prelim): 5 length of query: 61 length of database: 4,842,793,630 effective HSP length: 33 effective length of query: 28 effective length of database: 4,376,689,189 effective search space: 122547297292 effective search space used: 122547297292 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 76 (33.8 bits)