>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+ for their activity. Members of this family are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which forms a structural motif that functions as a metal binding and catalytic site. Substrates of nudix hydrolase include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance and "house-cleaning" enzy

Probab=99.89 E-value=1.9e-22 Score=149.78 Aligned_cols=118 Identities=33% Similarity=0.553 Sum_probs=95.1 Q ss_pred EEEEEEEECCCEEEEEEECCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCEEEEEEEECCCCCCEEEEE Q ss_conf 99999993598699999178988898382257310178748899998888762652024420255665205788606999 Q gi|254780325|r 12 VVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFHLLMP 91 (141) Q Consensus 12 vv~~~ii~~~~~iLl~~R~~~~~~~g~W~lPGG~ve~gEs~~~a~~REv~EEtgi~~~~~~~~~~~~~~~~~~~~~~~~~ 91 (141) T Consensus 2 ~~~~ii~~~~~~vLl~~r~~~--~~~~w~~PgG~ve~gE~~~~aa~RE~~EEtGl~~~~~~~~~~~~~~~~~~~~~~~~~ 79 (123) T cd02883 2 AVGAVILDEDGRVLLVRRADS--PGGLWELPGGGVEPGETLEEAAIREVREETGLDVDVLRLLGVYEVESPDEGEHAVVF 79 (123) T ss_pred EEEEEEEECCCEEEEEEECCC--CCCEEECCCEECCCCCCHHHHHHHHHHHHHCCEEEEEEEEEEEEEECCCCCCEEEEE T ss_conf 999999979999999994289--989599981431599898997566788985945677589999998777899669999 Q ss_pred EEEEEEECCEE---CCCHHHEEEECCHHHHCCCCCCCCCHHHH Q ss_conf 99999754837---68823315702778832488973698999 Q gi|254780325|r 92 FFVCHCFEGIP---QSCEGQQLQWVALDDLQNYSMLPADLSLI 131 (141) Q Consensus 92 ~~~~~~~~~~~---~~~E~~~~~Wi~~~el~~~~~~~~~~~ii 131 (141) T Consensus 80 ~f~~~~~~~~~~~~~~~e~~~~~W~~~~el~~~~~~~~~~~~~ 122 (123) T cd02883 80 VFLARLVGGEPTLLPPDEISEVRWVTLDELPALALSPALRPAL 122 (123) T ss_pred EEEEEECCCCCCCCCCCCEEEEEEEEHHHHHCCCCCHHHHHHH T ss_conf 9999995895212898668999998499913499983675965

HHsearch alignment for GI: 254780325 and conserved domain: cd02883