BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780325|ref|YP_003064738.1| mutator MutT protein [Candidatus Liberibacter asiaticus str. psy62] (141 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780325|ref|YP_003064738.1| mutator MutT protein [Candidatus Liberibacter asiaticus str. psy62] Length = 141 Score = 289 bits (739), Expect = 2e-80, Method: Compositional matrix adjust. Identities = 141/141 (100%), Positives = 141/141 (100%) Query: 1 MIDVNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTREL 60 MIDVNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTREL Sbjct: 1 MIDVNLKKILLVVACAVFEPGGKVLLSCRPKDKSHGEFWEFPGGKIEDGETPEEALTREL 60 Query: 61 FEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQN 120 FEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQN Sbjct: 61 FEELAIVVKPFSLVPLTFISHPYEKFHLLMPFFVCHCFEGIPQSCEGQQLQWVALDDLQN 120 Query: 121 YSMLPADLSLISFLRKHALHM 141 YSMLPADLSLISFLRKHALHM Sbjct: 121 YSMLPADLSLISFLRKHALHM 141 >gi|254780557|ref|YP_003064970.1| dinucleoside polyphosphate hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 33.1 bits (74), Expect = 0.002, Method: Compositional matrix adjust. Identities = 26/88 (29%), Positives = 34/88 (38%), Gaps = 12/88 (13%) Query: 28 CRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFH 87 C + H W+ P G I E P +A REL+EE I K SL+ Y+ Sbjct: 23 CFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI--KSISLLGQGDSYIQYD--- 77 Query: 88 LLMPFFVCHCFEGIPQSCEGQQLQWVAL 115 F HC + GQ +W A Sbjct: 78 -----FPAHCIQ--ENGYVGQMQKWFAF 98 >gi|254780544|ref|YP_003064957.1| phosphoglucosamine mutase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 448 Score = 24.6 bits (52), Expect = 0.77, Method: Composition-based stats. Identities = 7/10 (70%), Positives = 8/10 (80%) Query: 94 VCHCFEGIPQ 103 +CHCFE PQ Sbjct: 365 ICHCFEEYPQ 374 >gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Score = 22.7 bits (47), Expect = 2.5, Method: Compositional matrix adjust. Identities = 12/35 (34%), Positives = 16/35 (45%) Query: 54 EALTRELFEELAIVVKPFSLVPLTFISHPYEKFHL 88 E L EL E L IV+ S+ +S FH+ Sbjct: 190 EELIHELRESLTIVIVTHSMQQAARVSQRAAMFHM 224 >gi|254780547|ref|YP_003064960.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 21.6 bits (44), Expect = 6.8, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 117 DLQNYSMLPADLSLISFL 134 D +YS+ PAD+ ++S L Sbjct: 55 DTSSYSIRPADIQVLSNL 72 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.142 0.452 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,265 Number of Sequences: 1233 Number of extensions: 3824 Number of successful extensions: 8 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 5 length of query: 141 length of database: 328,796 effective HSP length: 66 effective length of query: 75 effective length of database: 247,418 effective search space: 18556350 effective search space used: 18556350 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 34 (17.7 bits)