HHsearch alignment for GI: 254780328 and conserved domain: PRK08267

>PRK08267 short chain dehydrogenase; Provisional.
Probab=99.43  E-value=4.3e-14  Score=106.35  Aligned_cols=158  Identities=23%  Similarity=0.307  Sum_probs=112.0

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHH-----CCCCEEEEECCCHHHHHHHHHHC------CCCEE
Q ss_conf             47999687882779999999987988999926876752130-----23867984268999999998756------98899
Q gi|254780328|r    4 KNVLVVGGAGYIGAHTCRVLYERGFLPIVLDNLSSGHAEFV-----LWGPLEQVDICDYTNLRAVFAKY------QPASV   72 (333)
Q Consensus         4 kkIlItG~tGfiGs~l~~~L~~~g~~v~~~d~~~~~~~~~~-----~~~~~~~~Di~d~~~l~~~~~~~------~~d~V   72 (333)
T Consensus         2 K~vlITGassGIG~a~A~~~a~~G~~V~~~~r~~~~l~~~~~~l~~~~~~~~~~Dvtd~~~v~~~~~~~~~~~~G~iDiL   81 (258)
T PRK08267          2 KSIFITGAASGIGRATARLFAARGWRVGAYDINEDGLAALAAELGAERAWTGALDVTDRAAWDAALADFCAATGGRLDVL   81 (258)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEE
T ss_conf             98999072268999999999987999999988899999999983699679999117999999999999999958998689


Q ss_pred             EECHHHCCCCC----CCCCCEEEEEECCCCCCCCCCCCC----CCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCCCCCC
Q ss_conf             95714401122----343100123301233322211222----222222222333322-222222222222222222222
Q gi|254780328|r   73 MHFAGLTNISE----SVKNPSLFYEINIKGSFNLIATAI----ESNVRRFIFSSTCAT-YGIPHNTIITENDPQESITPY  143 (333)
Q Consensus        73 iHlAa~~~~~~----~~~~p~~~~~~Nv~gt~~ll~~~~----~~~~~~~i~~SS~~v-YG~~~~~~~~E~~~~~p~~~Y  143 (333)
T Consensus        82 VNNAGi~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~m~~~~~g~IvnisS~~g~~~~p------------~~~~Y  149 (258)
T PRK08267         82 FNNAGILRGGPFEDIPLEAHDRVIDINVKGVLNGAYAALPYLKATPGARVINTSSASAIYGQP------------QLAVY  149 (258)
T ss_pred             EECCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCC------------CCCHH
T ss_conf             988877999882449999999999997399999999999999977992799990654467999------------98669


Q ss_pred             CCCCCCCCCCCCCCCCC---CCCCCCCCCCCCC
Q ss_conf             22222333222222222---2222222222222
Q gi|254780328|r  144 GYTKYVVERELLQHNKV---NGLRSVVLRYFNA  173 (333)
Q Consensus       144 g~sK~~~E~~~~~~~~~---~~~~~~~~R~~~v  173 (333)
T Consensus       150 ~aSK~av~~lt~sla~El~~~gIrVn~v~PG~v  182 (258)
T PRK08267        150 SATKFAVRGLTEALDLEWRRHGIRVADVMPLFV  182 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCC
T ss_conf             999999999999999984301918999971889