>TIGR01759 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 Malate dehydrogenases catalyse the interconversion of malate and oxaloacetate using dinucleotide cofactors . The enzymes in this entry are found in archaea, bacteria and eukaryotes and fall into two distinct groups. The first group are cytoplamsic, NAD-dependent enzymes which participate in the citric acid cycle (1.1.1.37 from EC). The second group are found in plant chloroplasts, use NADP as cofactor, and participate in the C4 cycle (1.1.1.82 from EC). Structural studies indicate that these enzymes are homodimers with very sinmilar overall topology, though the chloroplast enzymes also have N- and C-terminal extensions, and all contain the classical Rossman fold for NAD(P)H binding , , , . Substrate specificity is determined by a mobile loop at the active site which uses charge balancing to discriminate between the correct substrates (malate and oxaloacetate) and other potential oxo/hydroxyacid substrates the enzyme may encounter within the cell .; GO: 0016615 malate dehydrogenase activity, 0006108 malate metabolic process.

Probab=95.12 E-value=0.014 Score=35.11 Aligned_cols=103 Identities=20% Similarity=0.192 Sum_probs=55.9 Q ss_pred CEEEEECCCCHHHHHHHHHHHHC---CC-EEEE---EECCCCCC------HHHHCCC-C-EEEEECCCHHHHHHHHHHCC Q ss_conf 47999687882779999999987---98-8999---92687675------2130238-6-79842689999999987569 Q gi|254780328|r 4 KNVLVVGGAGYIGAHTCRVLYER---GF-LPIV---LDNLSSGH------AEFVLWG-P-LEQVDICDYTNLRAVFAKYQ 68 (333) Q Consensus 4 kkIlItG~tGfiGs~l~~~L~~~---g~-~v~~---~d~~~~~~------~~~~~~~-~-~~~~Di~d~~~l~~~~~~~~ 68 (333) T Consensus 4 ~rV~VTGAAGQI~Y~Ll~~iA~G~~fG~Dqpv~L~LLdIP~A~~~LeGV~MEL~DCAFPlL~~v~~T--~~p~eAF~dv- 80 (329) T TIGR01759 4 VRVAVTGAAGQIGYSLLFRIASGELFGKDQPVVLHLLDIPQAMKALEGVVMELEDCAFPLLAGVVAT--TDPEEAFKDV- 80 (329) T ss_pred EEEEEECCHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHCCCCCCCCCCEEC--CCHHHHHCCC- T ss_conf 3799737446789999889855610488984688860772331133443553530645223511221--6868751898- Q ss_pred CCEEEECHHHCCCCCCCCCCEEEEEECCCCCCC---CCCCCCCCCCC Q ss_conf 889995714401122343100123301233322---21122222222 Q gi|254780328|r 69 PASVMHFAGLTNISESVKNPSLFYEINIKGSFN---LIATAIESNVR 112 (333) Q Consensus 69 ~d~ViHlAa~~~~~~~~~~p~~~~~~Nv~gt~~---ll~~~~~~~~~ 112 (333) T Consensus 81 -D~AlLvGa~PR-K~GMER-~DLL~~Ng~IF~~QG~aLn~~Ak~~vK 124 (329) T TIGR01759 81 -DVALLVGAFPR-KPGMER-RDLLSKNGKIFKEQGKALNKVAKKDVK 124 (329) T ss_pred -CEEEEECCCCC-CCCCCH-HHHHHHCCHHHHHHHHHHHHHCCCCCE T ss_conf -75776136689-588447-999872225468799999986189856

HHsearch alignment for GI: 254780328 and conserved domain: TIGR01759