RPSBLAST alignment for GI: 254780328 and conserved domain: PLN02653

>gnl|CDD|178259 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase. Length = 340
 Score = 39.4 bits (92), Expect = 0.001
 Identities = 62/289 (21%), Positives = 110/289 (38%), Gaps = 60/289 (20%)

Query: 53  DICDYTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNL---IATAIES 109
           D+ D ++LR      +P  V + A  ++++ S + P    ++   G+  L   +    + 
Sbjct: 68  DLSDASSLRRWLDDIKPDEVYNLAAQSHVAVSFEMPDYTADVVATGALRLLEAVRLHGQE 127

Query: 110 NVR--RFIFSSTCATYGIPHNTIITENDPQESITP-YGYTKYVVERELLQHNKVNGLRSV 166
             R  ++  + +   YG       +   PQ   TP +  + Y V +       VN     
Sbjct: 128 TGRQIKYYQAGSSEMYG-------STPPPQSETTPFHPRSPYAVAKVAAHWYTVN----- 175

Query: 167 VLRYFNAAGATL-DSIIGEWHNP---ETHV---IPLAI-KTAMGYQNSFKVF-GQDYATR 217
              Y  A G    + I+    +P   E  V   I  A+ +  +G Q   K+F G   A+R
Sbjct: 176 ---YREAYGLFACNGILFNHESPRRGENFVTRKITRAVGRIKVGLQK--KLFLGNLDASR 230

Query: 218 DGTCLRDYIHVLDLANAHIMALEYLINQGDSIAINLGTGTGITVKEIISTIQSMYECAFP 277
           D     DY+           A+  ++ Q       + T    TV+E +       E AF 
Sbjct: 231 DWGFAGDYVE----------AMWLMLQQEKPDDYVVATEESHTVEEFL-------EEAFG 273

Query: 278 ---ITYESRRIGDP----PS----LVADNKKAKKILGWNPKYKLRDIIE 315
              + ++     DP    P+    L  D  KA+++LGW PK     +++
Sbjct: 274 YVGLNWKDHVEIDPRYFRPAEVDNLKGDASKAREVLGWKPKVGFEQLVK 322