HHsearch alignment of GI: 254780329 and MMDB domain: 2j5a_A_

>2j5a_A (A:) 30S ribosomal protein S6; ribonucleoprotein, RNA-binding, rRNA-binding, protein folding; 2.3A {Aquifex aeolicus}
Probab=99.96  E-value=5.8e-29  Score=189.96  Aligned_cols=102  Identities=28%  Similarity=0.569  Sum_probs=97.5

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEECCCCCEEEEEEEEEECC-HHHHHHHHHHH
Q ss_conf             98705999987899999999999999999985697899970368653530322241899999998089-77999999980
Q gi|254780329|r    1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP-PAAIHEMKRKM   79 (135)
Q Consensus         1 M~~YE~~~i~~p~~~~~~~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY~I~k~~~G~Y~~~~f~~~-~~~i~el~~~l   79 (135)
                      ||+||+++|++|++++++++++++++.+.|.++||+|.++++||.|+|||||+|+++|+|++++|+++ |+++++|++.|
T Consensus         7 M~~YE~~~il~~~~~~~~~~~~~~~~~~~i~~~gg~v~~~~~~G~r~LaY~I~k~~~G~Y~~~~f~~~~p~~i~el~~~l   86 (110)
T 2j5a_A            7 LRYYETVFAVKPTLSEEEMKKKFEQVKEFIKQKGGEILYEEDWGMRQLAYPIQKFNNARYFLVQFKTENPQLPNELDFQL   86 (110)
T ss_dssp             CEEEEEEEEECTTSCHHHHHHHHHHHHHHHHHTTEEEEEEEEEEEEECSSCSSSCSEEEEEEEEEEESCTTHHHHHHHHH
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCEECCHHHHHHHCCEEEEEEEEEEECCHHHHHHHHHHH
T ss_conf             67100999988999989999999999999997898189983322003043431235059999999978789999999986


Q ss_pred             CCCCHHEEEEEEEECCCCCCCCH
Q ss_conf             89802100112441134556435
Q gi|254780329|r   80 RIDENVLRSLTLLVDSHEQSPTL  102 (135)
Q Consensus        80 k~~~~VLR~l~vk~~~~~~~~~~  102 (135)
                      ++|++||||++||+++....++.
T Consensus        87 r~~~~VlR~~~vk~~e~~~~~s~  109 (110)
T 2j5a_A           87 KIDEDVIRWLNIQIKESEVKKNA  109 (110)
T ss_dssp             HHCTTEEEEEEEEECGGGCCCC-
T ss_pred             CCCCCEEEEEEEEECCCCCCCCC
T ss_conf             26757468999998445567788