Query         gi|254780329|ref|YP_003064742.1| 30S ribosomal protein S6 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 135
No_of_seqs    117 out of 1182
Neff          6.9 
Searched_HMMs 33803
Date          Wed Jun  1 12:12:33 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780329.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >1cqm_A Ribosomal protein S6;  100.0   1E-29   3E-34  194.4  10.9  101    1-101     1-101 (101)
  2 >3i1m_F 30S ribosomal protein  100.0 3.9E-30 1.2E-34  196.8   4.2  108    1-109     1-108 (135)
  3 >2j5a_A 30S ribosomal protein  100.0 5.8E-29 1.7E-33  190.0   9.9  102    1-102     7-109 (110)
  4 >1vmb_A 30S ribosomal protein  100.0 1.7E-29   5E-34  193.1   7.1  109    1-109    18-127 (140)
  5 >3bbn_F Ribosomal protein S6;   99.9 8.4E-28 2.5E-32  183.1   5.5   97    1-97     62-167 (168)
  6 >2kjw_A TS9, 30S ribosomal pro  99.7 5.7E-17 1.7E-21  119.6   4.0   54    1-54     43-96  (96)
  7 >1gtd_A MTH169; synthetase, FG  42.9      24 0.00072   16.3   3.8   66    5-89      6-76  (85)
  8 >1b7y_B Phers, protein (phenyl  39.6      27 0.00081   16.0   3.1   27   14-40     73-99  (102)
  9 >2dgb_A Hypothetical protein P  38.6      28 0.00084   15.9   3.9   67    5-90      7-77  (84)
 10 >1u8s_A Glycine cleavage syste  31.6      37  0.0011   15.2   6.3   53   19-81     16-68  (86)
 11 >2zw2_A Putative uncharacteriz  27.8      43  0.0013   14.8   4.4   74    5-97      9-88  (92)
 12 >2vxh_A Chlorite dismutase; he  25.9      47  0.0014   14.6   5.8   68    7-82     29-100 (251)
 13 >1a6f_A RNAse P protein, ribon  24.2      50  0.0015   14.4   2.5   33    2-34     79-111 (119)

No 1  
>>1cqm_A Ribosomal protein S6; alzheimer disease, oligomerization; 1.65A {Thermus thermophilus} (A:)
Probab=99.96  E-value=1e-29  Score=194.39  Aligned_cols=101  Identities=24%  Similarity=0.451  Sum_probs=97.7

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEECCCCCEEEEEEEEEECCHHHHHHHHHHHC
Q ss_conf             98705999987899999999999999999985697899970368653530322241899999998089779999999808
Q gi|254780329|r    1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMR   80 (135)
Q Consensus         1 M~~YE~~~i~~p~~~~~~~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY~I~k~~~G~Y~~~~f~~~~~~i~el~~~lk   80 (135)
                      ||+||++||++|++++++++++++++.+.|.++||.|.++++||+|+|||||+|+++|+|++++|+++|+.+++|++.|+
T Consensus         1 M~~YE~~~i~~~~~~~~~~~~~~~~~~~~i~~~gg~i~~~e~~G~r~LaY~Ikk~~~G~Y~~~~f~~~~~~i~el~~~lr   80 (101)
T 1cqm_A            1 MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELR   80 (101)
T ss_dssp             CEEEEEEEEECTTCCHHHHHHHHHHHHHHHHHTTCEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEECHHHHHHHHHHHH
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCEECCCCCEEEEEEEEEEECHHHHHHHHHHHC
T ss_conf             98614999988999999999999999999987898999998761510660747876899999999959999999999867


Q ss_pred             CCCHHEEEEEEEECCCCCCCC
Q ss_conf             980210011244113455643
Q gi|254780329|r   81 IDENVLRSLTLLVDSHEQSPT  101 (135)
Q Consensus        81 ~~~~VLR~l~vk~~~~~~~~~  101 (135)
                      +|++|||||++|+++....++
T Consensus        81 ~~~~VlR~l~vk~~~~~~~~s  101 (101)
T 1cqm_A           81 IRDNVRRVMVVKSQEPFLANA  101 (101)
T ss_dssp             TSTTEEEEEEEECSSCCC---
T ss_pred             CCCCEEEEEEEECCCCCCCCC
T ss_conf             898848999997277668999


No 2  
>>3i1m_F 30S ribosomal protein S6; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1p6g_F 1p87_F* 1vs7_F* 2avy_F 2aw7_F 1vs5_F 2i2u_F 2i2p_F* 2qan_F* 2qb9_F* 2qbb_F* 2qbd_F 2qbf_F 2qbh_F* 2qbj_F* 2qou_F* 2qow_F* 2qoy_F* 2qp0_F* 2vho_F ... (F:)
Probab=99.96  E-value=3.9e-30  Score=196.81  Aligned_cols=108  Identities=30%  Similarity=0.555  Sum_probs=101.4

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEECCCCCEEEEEEEEEECCHHHHHHHHHHHC
Q ss_conf             98705999987899999999999999999985697899970368653530322241899999998089779999999808
Q gi|254780329|r    1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMR   80 (135)
Q Consensus         1 M~~YE~~~i~~p~~~~~~~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY~I~k~~~G~Y~~~~f~~~~~~i~el~~~lk   80 (135)
                      |++||+|||++|+++ +++.++++++.++|.++||+|.++++||+|+|||+|+|+++|+|++|+|+++|+.+.+|++.|+
T Consensus         1 M~~YE~~~il~~~~~-~e~~~~i~~~~~~i~~~gg~i~~v~~~G~r~LaY~Ikk~~~G~Y~~~~f~~~~~~i~el~~~l~   79 (135)
T 3i1m_F            1 MRHYEIVFMVHPDQS-EQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFR   79 (135)
T ss_dssp             CCEECBEEEECSTTT-TSHHHHHHHHHHHHHHTTCEECCCEEEEEECCSSCTTSSSCEEEEECCEECCTTHHHHHHHHHH
T ss_pred             CCCCEEEEEECCCCH-HHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCEEEEEEEECCCCHHHHHHHHHHHH
T ss_conf             986239999688817-8999999999999986898899875113434675267787799999983489899999999970


Q ss_pred             CCCHHEEEEEEEECCCCCCCCHHHHHHHH
Q ss_conf             98021001124411345564357653212
Q gi|254780329|r   81 IDENVLRSLTLLVDSHEQSPTLTIQRHDR  109 (135)
Q Consensus        81 ~~~~VLR~l~vk~~~~~~~~~~~~~~~~~  109 (135)
                      +|++|||||+||+++....+++.......
T Consensus        80 ~~~~VlR~~~vk~~~~~~~~~~~~~~~~~  108 (135)
T 3i1m_F           80 FNDAVIRSMVMRTKHAVTEASPMVKAKDE  108 (135)
T ss_dssp             HCSSEESCCBCCCSSCCCSCC--------
T ss_pred             CCHHHEEEEEEEECCCCCCCCHHHHHHHH
T ss_conf             36400044788723566675754420122


No 3  
>>2j5a_A 30S ribosomal protein S6; ribonucleoprotein, RNA-binding, rRNA-binding, protein folding; 2.3A {Aquifex aeolicus} (A:)
Probab=99.96  E-value=5.8e-29  Score=189.96  Aligned_cols=102  Identities=28%  Similarity=0.569  Sum_probs=97.5

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEECCCCCEEEEEEEEEECC-HHHHHHHHHHH
Q ss_conf             98705999987899999999999999999985697899970368653530322241899999998089-77999999980
Q gi|254780329|r    1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP-PAAIHEMKRKM   79 (135)
Q Consensus         1 M~~YE~~~i~~p~~~~~~~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY~I~k~~~G~Y~~~~f~~~-~~~i~el~~~l   79 (135)
                      ||+||+++|++|++++++++++++++.+.|.++||+|.++++||.|+|||||+|+++|+|++++|+++ |+++++|++.|
T Consensus         7 M~~YE~~~il~~~~~~~~~~~~~~~~~~~i~~~gg~v~~~~~~G~r~LaY~I~k~~~G~Y~~~~f~~~~p~~i~el~~~l   86 (110)
T 2j5a_A            7 LRYYETVFAVKPTLSEEEMKKKFEQVKEFIKQKGGEILYEEDWGMRQLAYPIQKFNNARYFLVQFKTENPQLPNELDFQL   86 (110)
T ss_dssp             CEEEEEEEEECTTSCHHHHHHHHHHHHHHHHHTTEEEEEEEEEEEEECSSCSSSCSEEEEEEEEEEESCTTHHHHHHHHH
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCEECCHHHHHHHCCEEEEEEEEEEECCHHHHHHHHHHH
T ss_conf             67100999988999989999999999999997898189983322003043431235059999999978789999999986


Q ss_pred             CCCCHHEEEEEEEECCCCCCCCH
Q ss_conf             89802100112441134556435
Q gi|254780329|r   80 RIDENVLRSLTLLVDSHEQSPTL  102 (135)
Q Consensus        80 k~~~~VLR~l~vk~~~~~~~~~~  102 (135)
                      ++|++||||++||+++....++.
T Consensus        87 r~~~~VlR~~~vk~~e~~~~~s~  109 (110)
T 2j5a_A           87 KIDEDVIRWLNIQIKESEVKKNA  109 (110)
T ss_dssp             HHCTTEEEEEEEEECGGGCCCC-
T ss_pred             CCCCCEEEEEEEEECCCCCCCCC
T ss_conf             26757468999998445567788


No 4  
>>1vmb_A 30S ribosomal protein S6; TM0603, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.70A {Thermotoga maritima} (A:)
Probab=99.96  E-value=1.7e-29  Score=193.09  Aligned_cols=109  Identities=18%  Similarity=0.393  Sum_probs=101.2

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHC-CCEEEEEECCCCCCCCEECCCCCEEEEEEEEEECCHHHHHHHHHHH
Q ss_conf             987059999878999999999999999999856-9789997036865353032224189999999808977999999980
Q gi|254780329|r    1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQEN-GGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKM   79 (135)
Q Consensus         1 M~~YE~~~i~~p~~~~~~~~~~~~~~~~~i~~~-gg~i~~~e~wG~r~LAY~I~k~~~G~Y~~~~f~~~~~~i~el~~~l   79 (135)
                      |+.||+++|++|+++++++..+++++.++|.++ ||.|.++++||.|+|||+|+|+++|+|++|.|.++|+++.+|++.|
T Consensus        18 M~~YE~~~Il~p~~~~~~~~~~~~~~~~~i~~~~Gg~I~~~~~~G~r~LaY~IkK~~~G~Y~~~~f~~~p~~i~el~~~l   97 (140)
T 1vmb_A           18 ERIYESMFIIAPNVPEEERENLVERVKKIIEERVKGKIDKVERMGMRKFAYEIKKFNEGDYTVIYFRCDGQNLQELENFY   97 (140)
T ss_dssp             CEEEEEEEEECTTSCHHHHHHHHHHHHHHHHHTTCCEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEECSSSTHHHHHHH
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCEEEEEEEEEECCHHHHHHHHHHH
T ss_conf             44001999989999989999999999999985589889897602333554523437889999999506867899999987


Q ss_pred             CCCCHHEEEEEEEECCCCCCCCHHHHHHHH
Q ss_conf             898021001124411345564357653212
Q gi|254780329|r   80 RIDENVLRSLTLLVDSHEQSPTLTIQRHDR  109 (135)
Q Consensus        80 k~~~~VLR~l~vk~~~~~~~~~~~~~~~~~  109 (135)
                      ++|++||||++||+++....+++.......
T Consensus        98 r~~~~VlR~l~vk~~~~~~~~~~~~~~~~~  127 (140)
T 1vmb_A           98 RVTPEIIRWQTFRRFDLEKKERKAQREKAA  127 (140)
T ss_dssp             HTCTTEEEEEEEECHHHHHHHHHHHC----
T ss_pred             CCCCCEEEEEEEECCCCCCCCCHHHHCCCC
T ss_conf             067573589999804554450333331210


No 5  
>>3bbn_F Ribosomal protein S6; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} (F:)
Probab=99.94  E-value=8.4e-28  Score=183.13  Aligned_cols=97  Identities=21%  Similarity=0.428  Sum_probs=93.5

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEECCCC---------CEEEEEEEEEECCHHH
Q ss_conf             9870599998789999999999999999998569789997036865353032224---------1899999998089779
Q gi|254780329|r    1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKN---------RKAYYVFMNIASPPAA   71 (135)
Q Consensus         1 M~~YE~~~i~~p~~~~~~~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY~I~k~---------~~G~Y~~~~f~~~~~~   71 (135)
                      |+.||+|+|++|++++++++++++++.+.|.++||+|.++++||+|+|||+|+|+         ++|+|++|+|.++|+.
T Consensus        62 M~~YE~~~Il~p~l~e~e~~~~i~~~~~~i~~~Gg~i~~ve~~G~R~LAY~IkK~~~a~~~~~~~~G~Y~~i~f~~~p~~  141 (168)
T 3bbn_F           62 LRQYETMAVLRPDMTEDERLTLTQKYEELLVAGGAMYVEVFNRGVIPLAYSIKRKNKAGETNNYLDGIYLLFTYFTKPES  141 (168)
T ss_dssp             CEEEEEEEEECTTSCHHHHHSTTHHHHHHHTTTSCEEEEEEEEEECCCSSCTTSCSSSCSSCCCCCCEEEEEEEEECTTS
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHCCCCCCCCEEEEEEEEEEECHHH
T ss_conf             77010899988989989999999999999987898078863143212202221223101001300789999999809999


Q ss_pred             HHHHHHHHCCCCHHEEEEEEEECCCC
Q ss_conf             99999980898021001124411345
Q gi|254780329|r   72 IHEMKRKMRIDENVLRSLTLLVDSHE   97 (135)
Q Consensus        72 i~el~~~lk~~~~VLR~l~vk~~~~~   97 (135)
                      +.+|++.|++|++|||||+||+++..
T Consensus       142 i~ele~~lr~d~~VlR~l~vK~~e~k  167 (168)
T 3bbn_F          142 ISPLEAALVTDDDVIRSSSFKIRKRK  167 (168)
T ss_dssp             SHHHHHHHHTSSCCSEEECCBCCSCC
T ss_pred             HHHHHHHHCCCCCEEEEEEEEECCCC
T ss_conf             99999997267570478999834744


No 6  
>>2kjw_A TS9, 30S ribosomal protein S6; S6 permutant, solution structure, backbone dynamics, folding, ribonucleoprotein, RNA-binding, rRNA-binding; NMR {Thermus thermophilus} (A:)
Probab=99.65  E-value=5.7e-17  Score=119.65  Aligned_cols=54  Identities=30%  Similarity=0.426  Sum_probs=53.3

Q ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEECCC
Q ss_conf             987059999878999999999999999999856978999703686535303222
Q gi|254780329|r    1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRK   54 (135)
Q Consensus         1 M~~YE~~~i~~p~~~~~~~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY~I~k   54 (135)
                      ||.||+|||++|++++++++++++++.++|+++||+|.++++||+|+|||||+|
T Consensus        43 Mr~YE~m~Il~pdLsee~v~~l~e~~~~~I~~~GG~I~~ve~WG~RkLAY~I~K   96 (96)
T 2kjw_A           43 PGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK   96 (96)
T ss_dssp             SSCEEEEEECCSSCCHHHHHHHHHHHHHHHHHHTCCCSCCEECCCCCCCCSCCC
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCC
T ss_conf             887159999899899899999999999999868988988842235034671579


No 7  
>>1gtd_A MTH169; synthetase, FGAM synthetase, purine synthesis pathway, PSI, protein structure initiative, NESG; 2.56A {Methanobacterium thermoautotrophicum} (A:)
Probab=42.86  E-value=24  Score=16.27  Aligned_cols=66  Identities=5%  Similarity=0.095  Sum_probs=45.7

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEECCCCCEEEEEEEEEECCH-----HHHHHHHHHH
Q ss_conf             59999878999999999999999999856978999703686535303222418999999980897-----7999999980
Q gi|254780329|r    5 EHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPP-----AAIHEMKRKM   79 (135)
Q Consensus         5 E~~~i~~p~~~~~~~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY~I~k~~~G~Y~~~~f~~~~-----~~i~el~~~l   79 (135)
                      ++.+-++|.+-+.+...+..-                   +++|.|.++.-+.|-|+.+.++++.     ..+.++-..|
T Consensus         6 ~V~V~lK~gVlDPqG~aI~~a-------------------L~~lG~~V~~VRvGK~iel~i~~~~~e~a~~~v~~~c~~l   66 (85)
T 1gtd_A            6 EVRIRLKKGXLNPEAATIERA-------------------LALLGYEVEDTDTTDVITFTXDEDSLEAVEREVEDXCQRL   66 (85)
T ss_dssp             EEEEEECTTSCCHHHHHHHHH-------------------HHHHTCCCEEEEEEEEEEEEECCSCHHHHHHHHHHHHHHT
T ss_pred             EEEEEECCCCCCCHHHHHHHH-------------------HHHCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             999997897738489999999-------------------9865986304787669999977899899999999999986


Q ss_pred             CCCCHHEEEE
Q ss_conf             8980210011
Q gi|254780329|r   80 RIDENVLRSL   89 (135)
Q Consensus        80 k~~~~VLR~l   89 (135)
                      -.|+.|=-|-
T Consensus        67 LaNpvIE~y~   76 (85)
T 1gtd_A           67 LCNPVIHDYD   76 (85)
T ss_dssp             TCCTTTEEEE
T ss_pred             CCCCCEEEEE
T ss_conf             3976547899


No 8  
>>1b7y_B Phers, protein (phenylalanyl-tRNA synthetase); enzyme, alpha/beta homodimer; HET: FYA; 2.50A {Thermus thermophilus} (B:684-785)
Probab=39.56  E-value=27  Score=15.96  Aligned_cols=27  Identities=7%  Similarity=0.321  Sum_probs=11.9

Q ss_pred             CCHHHHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             999999999999999998569789997
Q gi|254780329|r   14 ISSQQIKDTIGQYQSLIQENGGEVRLV   40 (135)
Q Consensus        14 ~~~~~~~~~~~~~~~~i~~~gg~i~~~   40 (135)
                      |++++++++.+++...+.+.|+++..+
T Consensus        73 Lt~~ev~~~~~~i~~~l~~~~a~lRg~   99 (102)
T 1b7y_B           73 LRDEEVEEAVSRVAEALRARGFGLRGL   99 (102)
T ss_dssp             CCHHHHHHHHHHHHHHHHCC-------
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCEECCC
T ss_conf             799999999999999999759797888


No 9  
>>2dgb_A Hypothetical protein PURS; purine, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Thermus thermophilus} PDB: 2cuw_A (A:)
Probab=38.63  E-value=28  Score=15.87  Aligned_cols=67  Identities=7%  Similarity=0.046  Sum_probs=47.7

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEECCCCCEEEEEEEEEECCH----HHHHHHHHHHC
Q ss_conf             59999878999999999999999999856978999703686535303222418999999980897----79999999808
Q gi|254780329|r    5 EHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPP----AAIHEMKRKMR   80 (135)
Q Consensus         5 E~~~i~~p~~~~~~~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY~I~k~~~G~Y~~~~f~~~~----~~i~el~~~lk   80 (135)
                      ++.+-++|.+-+.+...+..    .               ++.|.|.++.-+.|-|+.+.++++.    +.+.++-..|-
T Consensus         7 ~V~V~lK~gVlDPqG~aI~~----a---------------L~~lG~~V~~VR~GK~iel~i~~~~~~~a~~v~~~c~klL   67 (84)
T 2dgb_A            7 TLLIELKKGILDPQGRAVEG----V---------------LKDLGHPVEEVRVGKVLEIVFPAENLLEAEEKAKAXGALL   67 (84)
T ss_dssp             EEEEEECTTSCCHHHHHHHH----H---------------HHHTTCCCSEEEEEEEEEEEEECSSHHHHHHHHHHHHHHH
T ss_pred             EEEEEECCCCCCCHHHHHHH----H---------------HHHCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             99999899772827999999----9---------------9975997544885669999986899899999999988874


Q ss_pred             CCCHHEEEEE
Q ss_conf             9802100112
Q gi|254780329|r   81 IDENVLRSLT   90 (135)
Q Consensus        81 ~~~~VLR~l~   90 (135)
                      .|+.|=-|-+
T Consensus        68 aNpvIE~y~i   77 (84)
T 2dgb_A           68 ANPVXEVYAL   77 (84)
T ss_dssp             SCTTTEEEEE
T ss_pred             CCCCEEEEEE
T ss_conf             9973378999


No 10 
>>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} (A:1-86)
Probab=31.59  E-value=37  Score=15.19  Aligned_cols=53  Identities=11%  Similarity=0.204  Sum_probs=41.0

Q ss_pred             HHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEECCCCCEEEEEEEEEECCHHHHHHHHHHHCC
Q ss_conf             999999999999856978999703686535303222418999999980897799999998089
Q gi|254780329|r   19 IKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRI   81 (135)
Q Consensus        19 ~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY~I~k~~~G~Y~~~~f~~~~~~i~el~~~lk~   81 (135)
                      ...++..+...+.++||.|...+.|-...          =++..+.|+.++..+.+|...|..
T Consensus        16 rpGiva~is~~la~~g~nI~~~~~~~~~~----------~f~~~~~~~~~~~~~~~l~~~l~~   68 (86)
T 1u8s_A           16 RPGICNEVVRLVTQAGCNIIDSRIAMFGK----------EFTLLMLISGSPSNITRVETTLPL   68 (86)
T ss_dssp             CTTHHHHHHHHHHHTTCEEEEEEEEEETT----------EEEEEEEEEECHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHCCCCEEEEEEEEECC----------CEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             88599999999998799599858899879----------629999850584566789999999


No 11 
>>2zw2_A Putative uncharacterized protein STS178; purine metabolism, ligase; 1.55A {Sulfolobus tokodaii} (A:)
Probab=27.80  E-value=43  Score=14.80  Aligned_cols=74  Identities=11%  Similarity=0.220  Sum_probs=50.4

Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCE-ECCCCCEEEEEEEEEECCH-H----HHHHHHHH
Q ss_conf             5999987899999999999999999985697899970368653530-3222418999999980897-7----99999998
Q gi|254780329|r    5 EHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAY-RIRKNRKAYYVFMNIASPP-A----AIHEMKRK   78 (135)
Q Consensus         5 E~~~i~~p~~~~~~~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY-~I~k~~~G~Y~~~~f~~~~-~----~i~el~~~   78 (135)
                      ++.+-++|.+-+.+-..+...+                   ..|.| .++.-+.|-|+.+.++++. +    .+.++-..
T Consensus         9 ~V~V~lK~gVlDPqG~aI~~aL-------------------~~lG~~~V~~VRvgK~~~l~i~~~~~e~a~~~v~~~c~~   69 (92)
T 2zw2_A            9 ELIITNKEGVRDPEGETIQRYV-------------------VSRFSDKIIETRAGKYLVFRVNSSSQQEATELVKKLADE   69 (92)
T ss_dssp             EEEEEECTTSCCHHHHHHHHHT-------------------HHHHCTTEEEEEEEEEEEEEEECSSHHHHHHHHHHHHHH
T ss_pred             EEEEEECCCCCCCHHHHHHHHH-------------------HHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHH
T ss_conf             9999988855380578999999-------------------863887654478765999999079989999999999964


Q ss_pred             HCCCCHHEEEEEEEECCCC
Q ss_conf             0898021001124411345
Q gi|254780329|r   79 MRIDENVLRSLTLLVDSHE   97 (135)
Q Consensus        79 lk~~~~VLR~l~vk~~~~~   97 (135)
                      |.|-..|+---.+.+.+..
T Consensus        70 L~LaNpvIEdy~i~v~e~~   88 (92)
T 2zw2_A           70 MRLYNPIVHKIEIRANRIE   88 (92)
T ss_dssp             TTSSCTTTEEEEEEEEEEC
T ss_pred             CCCCCCCEEEEEEEEEEEC
T ss_conf             7776873689999999803


No 12 
>>2vxh_A Chlorite dismutase; heme-based enzyme, azospira oryzae strain GR-1, oxidoreductase, chlorate respiration, molecular oxygen production; HET: HEM; 2.1A {Azospira oryzae} (A:)
Probab=25.87  E-value=47  Score=14.60  Aligned_cols=68  Identities=21%  Similarity=0.279  Sum_probs=51.7

Q ss_pred             EEEECC---CCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCEECCC-CCEEEEEEEEEECCHHHHHHHHHHHCCC
Q ss_conf             999878---999999999999999999856978999703686535303222-4189999999808977999999980898
Q gi|254780329|r    7 VFLLRQ---DISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRK-NRKAYYVFMNIASPPAAIHEMKRKMRID   82 (135)
Q Consensus         7 ~~i~~p---~~~~~~~~~~~~~~~~~i~~~gg~i~~~e~wG~r~LAY~I~k-~~~G~Y~~~~f~~~~~~i~el~~~lk~~   82 (135)
                      +|=++|   .++.++....++++..+|.+.++.+..        =.|.+.. ...|.+.++.+.-+++.+.++.+.|+..
T Consensus        29 ~f~~d~~w~~~~~~er~~~~~e~~~~l~~~~~~~~~--------~~Y~~~glr~~aDlm~w~~~~~~~~lq~~~~~l~~t  100 (251)
T 2vxh_A           29 MFKLRPDWNKVPAMERKGAAEEVKKLIEKHKDNVLV--------DLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRST  100 (251)
T ss_dssp             EEEECGGGTTSCHHHHHTHHHHHHHHHHHTTTTCEE--------EEEECTTTCSSCSEEEEEEESSHHHHHHHHHHHHTS
T ss_pred             EEEECHHHHHCCHHHHHHHHHHHHHHHHHCCCCCEE--------EEEEEEEECCCCCEEEEEECCCHHHHHHHHHHHHHC
T ss_conf             998560221289999999999999999750566528--------999997434777889999489999999999999853


No 13 
>>1a6f_A RNAse P protein, ribonuclease P protein; endonuclease, subunit; 2.60A {Bacillus subtilis} (A:)
Probab=24.20  E-value=50  Score=14.41  Aligned_cols=33  Identities=18%  Similarity=0.246  Sum_probs=25.2

Q ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             870599998789999999999999999998569
Q gi|254780329|r    2 KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENG   34 (135)
Q Consensus         2 ~~YE~~~i~~p~~~~~~~~~~~~~~~~~i~~~g   34 (135)
                      ..|.++++++|...+....++.+.+..++.+.+
T Consensus        79 ~~~d~v~i~r~~~~~~~~~~l~~~l~~ll~k~~  111 (119)
T 1a6f_A           79 KEKDYIIIARKPASQLTYEETKKSLQHLFRKSS  111 (119)
T ss_dssp             CSSEEEEEECGGGTTCCHHHHHHHHHHHHHHTT
T ss_pred             CCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             997499996687676999999999999999824


Done!