PSIBLAST alignment of GI: 254780329 and protein with PDB id: 1cqm

>gi|10835884|pdb|1CQM|A Chain A, Protein Aggregation And Alzheimer's Disease: Crystallographic Analysis Of The Phenomenon. Engineered Version Of The Ribosomal Protein S6 Used As A Stable Scaffold To Study Oligomerization. Length = 101
>gi|10835885|pdb|1CQM|B Chain B, Protein Aggregation And Alzheimer's Disease: Crystallographic Analysis Of The Phenomenon. Engineered Version Of The Ribosomal Protein S6 Used As A Stable Scaffold To Study Oligomerization. Length = 101
 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 48/96 (50%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE   +L  ++   Q+       Q  ++  G  V  V  LG+R +AY I K+ + Y+
Sbjct: 1  MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYF 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
          ++  +  P   ++++ R++RI +NV R + +     
Sbjct: 61 LWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEP 96