BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780329|ref|YP_003064742.1| 30S ribosomal protein S6
[Candidatus Liberibacter asiaticus str. psy62]
         (135 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|86357078|ref|YP_468970.1| 30S ribosomal protein S6 [Rhizobium etli CFN 42]
 gi|123512430|sp|Q2KA93|RS6_RHIEC RecName: Full=30S ribosomal protein S6
 gi|86281180|gb|ABC90243.1| 30S ribosomal protein S6 [Rhizobium etli CFN 42]
          Length = 152

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 91/125 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDIS+QQ+   + QY+ +I+ NGG+V  +   G++++ YRI+KNRKA+Y
Sbjct: 1   MALYEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             M+I +PPAAI EM+R+MRI E+VLR +T+ V+ HE+ P+  +Q+ DRDDR  R   DR
Sbjct: 61  ALMDIDAPPAAIQEMERQMRISEDVLRYMTIAVEKHEEGPSAMLQKRDRDDRGPREGGDR 120

Query: 121 NVDRK 125
              R+
Sbjct: 121 GPRRE 125


>gi|315122246|ref|YP_004062735.1| 30S ribosomal protein S6 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495648|gb|ADR52247.1| 30S ribosomal protein S6 [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 135

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 109/135 (80%), Positives = 122/135 (90%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFLLRQDI SQ+IKDTI QYQSLI+ENGGEVRLVNE GMRTIAYRI K+RKAYY
Sbjct: 1   MNLYEHVFLLRQDIPSQKIKDTIEQYQSLIKENGGEVRLVNEWGMRTIAYRINKHRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNIASPPA+IHE++R+MRIDENVLR LT+ VDSHE SP+LT+QR+DRDD+NDRFP+DR
Sbjct: 61  VLMNIASPPASIHELERRMRIDENVLRYLTISVDSHEDSPSLTMQRYDRDDKNDRFPKDR 120

Query: 121 NVDRKQHVSEEKPLS 135
           N DRK HV EEK LS
Sbjct: 121 NADRKSHVDEEKVLS 135


>gi|190891122|ref|YP_001977664.1| 30S ribosomal protein S6 [Rhizobium etli CIAT 652]
 gi|218514152|ref|ZP_03510992.1| 30S ribosomal protein S6 [Rhizobium etli 8C-3]
 gi|226695119|sp|B3PUT7|RS6_RHIE6 RecName: Full=30S ribosomal protein S6
 gi|190696401|gb|ACE90486.1| 30S ribosomal protein S6 [Rhizobium etli CIAT 652]
 gi|327188001|gb|EGE55231.1| 30S ribosomal protein S6 [Rhizobium etli CNPAF512]
          Length = 152

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 90/125 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDIS+QQ+   + QY+ +I+ NGG+V  +   G++++ YRI+KNRKA+Y
Sbjct: 1   MALYEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             M+I +P AAI EM+R+MRI E+VLR +T+ V+ HE+ P+  +Q+ DRDDR  R   DR
Sbjct: 61  ALMDIDAPAAAIQEMERQMRISEDVLRYMTIAVEKHEEGPSAMLQKRDRDDRGPREGGDR 120

Query: 121 NVDRK 125
              R+
Sbjct: 121 GPRRE 125


>gi|33566505|emb|CAE37761.1| 30s ribosomal protein s6 [Bordetella parapertussis]
 gi|33568499|emb|CAE32411.1| 30s ribosomal protein s6 [Bordetella bronchiseptica RB50]
          Length = 157

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +YQ+L+    G V  + + G R +AY I+K  KA+Y
Sbjct: 32  MRHYEVVFIVHPD-QSEQVPAMVERYQALVTGQSGTVHRLEDWGRRQLAYPIQKLVKAHY 90

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI    A + E++   R ++ VLR L +       +P++ ++  +R
Sbjct: 91  VCMNIECGQATLDELEHSFRYNDAVLRHLVIKTKKAPAAPSIMMKSVER 139


>gi|254780329|ref|YP_003064742.1| 30S ribosomal protein S6 [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040006|gb|ACT56802.1| 30S ribosomal protein S6 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 135

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 135/135 (100%), Positives = 135/135 (100%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY
Sbjct: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR
Sbjct: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120

Query: 121 NVDRKQHVSEEKPLS 135
           NVDRKQHVSEEKPLS
Sbjct: 121 NVDRKQHVSEEKPLS 135


>gi|13476510|ref|NP_108080.1| 30S ribosomal protein S6 [Mesorhizobium loti MAFF303099]
 gi|24212327|sp|Q984T8|RS6_RHILO RecName: Full=30S ribosomal protein S6
 gi|14027271|dbj|BAB54225.1| 30S ribosomal protein S6 [Mesorhizobium loti MAFF303099]
          Length = 166

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 57/121 (47%), Positives = 84/121 (69%), Gaps = 1/121 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S QQ+   + QY+ +I  NGG V  V   G++++ YR+ KNRKAYY
Sbjct: 1   MALYEHVFLARQDLSQQQVDALVEQYKGVISANGGSVGRVENWGLKSLTYRVNKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI-QRHDRDDRNDRFPRD 119
             M++  PPAA++EM+R+M + E+VLR LT+ V++HE+ P+  + +R +R +R     RD
Sbjct: 61  TLMDLNCPPAALNEMERQMGLSEDVLRFLTIKVEAHEEGPSAMMQKREERSERGSFGDRD 120

Query: 120 R 120
           R
Sbjct: 121 R 121


>gi|260466963|ref|ZP_05813145.1| ribosomal protein S6 [Mesorhizobium opportunistum WSM2075]
 gi|259029260|gb|EEW30554.1| ribosomal protein S6 [Mesorhizobium opportunistum WSM2075]
          Length = 163

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 57/121 (47%), Positives = 84/121 (69%), Gaps = 1/121 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S QQ+   + QY+ +I  NGG V  V   G++++ YR+ KNRKAYY
Sbjct: 1   MALYEHVFLARQDLSQQQVDALVEQYKGVIAANGGSVGRVENWGLKSLTYRVNKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI-QRHDRDDRNDRFPRD 119
             M++  PPAA++EM+R+M + E+VLR LT+ V++HE+ P+  + +R +R +R     RD
Sbjct: 61  TLMDLTCPPAALNEMERQMGLSEDVLRFLTIKVEAHEEGPSAMMQKREERSERGGFGDRD 120

Query: 120 R 120
           R
Sbjct: 121 R 121


>gi|163857369|ref|YP_001631667.1| 30S ribosomal protein S6 [Bordetella petrii DSM 12804]
 gi|226703426|sp|A9ITA2|RS6_BORPD RecName: Full=30S ribosomal protein S6
 gi|163261097|emb|CAP43399.1| 30S ribosomal protein S6 [Bordetella petrii]
          Length = 125

 Score =  139 bits (350), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +YQ+L+   GG V  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFIVHPD-QSEQVPAMVERYQTLVTGQGGAVHRLEDWGRRQLAYPIQKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI    A + E++   R ++ VLR L +     + SP++ ++  +R++         
Sbjct: 60  VCMNIECGQATLDELEHSFRYNDAVLRHLVIKTKKAQTSPSIMMKSVEREEARKASTEAS 119

Query: 121 NVDRKQ 126
              + Q
Sbjct: 120 APAQAQ 125


>gi|319784438|ref|YP_004143914.1| ribosomal protein S6 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317170326|gb|ADV13864.1| ribosomal protein S6 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 166

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 56/121 (46%), Positives = 83/121 (68%), Gaps = 1/121 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S QQ+   + QY+ +I  NGG V  V   G++++ YR+ KNRKAYY
Sbjct: 1   MALYEHVFLARQDLSQQQVDALVEQYKGVISANGGSVGRVENWGLKSLTYRVNKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI-QRHDRDDRNDRFPRD 119
             M++  P AA++EM+R+M + E+VLR LT+ V++HE+ P+  + +R +R +R     RD
Sbjct: 61  TLMDLNCPAAALNEMERQMGLSEDVLRFLTIKVEAHEEGPSAMMQKREERSERGGFGDRD 120

Query: 120 R 120
           R
Sbjct: 121 R 121


>gi|237745858|ref|ZP_04576338.1| small subunit ribosomal protein S6 [Oxalobacter formigenes HOxBLS]
 gi|229377209|gb|EEO27300.1| small subunit ribosomal protein S6 [Oxalobacter formigenes HOxBLS]
          Length = 125

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 63/120 (52%), Gaps = 1/120 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ +   GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKNSVTSRGGKIHRVEDWGRRQLAYMINKFAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      ++E++   + ++ +LR LT+ +   E  P+  ++   +++         
Sbjct: 60  VLMNIECDGETLNELETAFKFNDAILRHLTVKMKHAETGPSPMMKSAQKEESAKAPAPAE 119


>gi|325981279|ref|YP_004293681.1| 30S ribosomal protein S6 [Nitrosomonas sp. AL212]
 gi|325530798|gb|ADZ25519.1| ribosomal protein S6 [Nitrosomonas sp. AL212]
          Length = 139

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 67/134 (50%), Gaps = 3/134 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+ ++    G+V  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYRGIVTSKNGKVHRVEDWGRRQLAYLIQKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      ++++    +  + +LR LTL        P+  +++ +R         + 
Sbjct: 60  VLMNIECDQEILNDLDHAFKFSDAILRHLTLKTKGPVTEPSPMMRQVERAGSASLQDSEE 119

Query: 121 NVDRKQHVSEEKPL 134
             D  +  S+E P+
Sbjct: 120 TAD--ETDSDETPV 131


>gi|119897009|ref|YP_932222.1| 30S ribosomal protein S6 [Azoarcus sp. BH72]
 gi|166226799|sp|A1K3D0|RS6_AZOSB RecName: Full=30S ribosomal protein S6
 gi|119669422|emb|CAL93335.1| RpsF protein [Azoarcus sp. BH72]
          Length = 127

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 62/128 (48%), Gaps = 1/128 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S++    G++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIDRYKSIVTARNGQIHRLEDWGRRQLAYPIQKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI     A+ E++   + ++ VLR LT+ +     +P+  ++             + 
Sbjct: 60  VLMNIECDGEALGELEHAFKFNDAVLRHLTIKMKKAVTTPSPMMKEEKSRSLTPAAGDEG 119

Query: 121 NVDRKQHV 128
                   
Sbjct: 120 KPAEAAEA 127


>gi|209520393|ref|ZP_03269156.1| ribosomal protein S6 [Burkholderia sp. H160]
 gi|209499178|gb|EDZ99270.1| ribosomal protein S6 [Burkholderia sp. H160]
          Length = 124

 Score =  138 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+  I  +GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKGTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      + E++   + ++ VLR L + +   E  P+  ++   R++         
Sbjct: 60  VCMNIECDQTTLDELEHAFKFNDAVLRHLIVKLKKAETGPSPMMKEVQREEAKKSAAAQP 119

Query: 121 NVDRK 125
              + 
Sbjct: 120 TEAQA 124


>gi|225023644|ref|ZP_03712836.1| hypothetical protein EIKCOROL_00507 [Eikenella corrodens ATCC
           23834]
 gi|224943526|gb|EEG24735.1| hypothetical protein EIKCOROL_00507 [Eikenella corrodens ATCC
           23834]
          Length = 124

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 40/122 (32%), Positives = 68/122 (55%), Gaps = 1/122 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y++LI E+GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTLITESGGHIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI   PAAI E++   R ++ VLR LT+ +D      +  ++     +  +  P++ 
Sbjct: 60  VLMNIECTPAAIEELETGFRFNDAVLRHLTIKMDEAVTEASPMMKEEKSKNLLNGQPQEE 119

Query: 121 NV 122
             
Sbjct: 120 AA 121


>gi|209548657|ref|YP_002280574.1| 30S ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226695120|sp|B5ZWC9|RS6_RHILW RecName: Full=30S ribosomal protein S6
 gi|209534413|gb|ACI54348.1| ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 155

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 57/111 (51%), Positives = 84/111 (75%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDIS+QQ+   + QY+ +I+ NGG+V  +   G++++ YRI+KNRKA+Y
Sbjct: 1   MALYEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
             M+I +P AA+ EM+R+MRI E+VLR +T+ V+ HE+ P+  +Q+ DRDD
Sbjct: 61  ALMDIDAPAAAVQEMERQMRISEDVLRYMTIAVEKHEEGPSAMMQKRDRDD 111


>gi|116251321|ref|YP_767159.1| 30S ribosomal protein S6 [Rhizobium leguminosarum bv. viciae 3841]
 gi|241203935|ref|YP_002975031.1| 30S ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|166227372|sp|Q1MJ10|RS6_RHIL3 RecName: Full=30S ribosomal protein S6
 gi|115255969|emb|CAK07050.1| putative 30S ribosomal protein S6 [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|240857825|gb|ACS55492.1| ribosomal protein S6 [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 155

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 57/111 (51%), Positives = 84/111 (75%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDIS+QQ+   + QY+ +I+ NGG+V  +   G++++ YRI+KNRKA+Y
Sbjct: 1   MALYEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
             M+I +P AA+ EM+R+MRI E+VLR +T+ V+ HE+ P+  +Q+ DRDD
Sbjct: 61  ALMDIDAPAAAVQEMERQMRISEDVLRYMTIAVEKHEEGPSAMMQKRDRDD 111


>gi|293604273|ref|ZP_06686680.1| 30S ribosomal protein S6 [Achromobacter piechaudii ATCC 43553]
 gi|292817150|gb|EFF76224.1| 30S ribosomal protein S6 [Achromobacter piechaudii ATCC 43553]
          Length = 124

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +YQ+L+   GG V  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFIVHPD-QSEQVPAMVERYQALVTGQGGSVHRLEDWGRRQLAYPIQKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           V +NI    A + E++   R ++ VLR L +     + +P++ ++  +R++        
Sbjct: 60  VCLNIECGQATLDELEHSFRYNDAVLRHLVIKTKKAQTTPSIMMKSVEREEARKASAEA 118


>gi|146277395|ref|YP_001167554.1| 30S ribosomal protein S6 [Rhodobacter sphaeroides ATCC 17025]
 gi|166227374|sp|A4WS85|RS6_RHOS5 RecName: Full=30S ribosomal protein S6
 gi|145555636|gb|ABP70249.1| SSU ribosomal protein S6P [Rhodobacter sphaeroides ATCC 17025]
          Length = 132

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 52/126 (41%), Positives = 83/126 (65%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  I  + +++ +NGG+V      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVFISRQDLSNAQAEGLIEHFSTVLADNGGKVVDREYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
            F+   +P AA+ EM+R MR+ ++V+R LT+ VD H + P++ +Q+ D  +R DR  R  
Sbjct: 61  AFLKSDAPSAAVQEMERLMRLHDDVMRVLTIKVDKHAEGPSIQMQKRDERERGDRGDRPD 120

Query: 121 NVDRKQ 126
             DR +
Sbjct: 121 RGDRGE 126


>gi|325265835|ref|ZP_08132521.1| 30S ribosomal protein S6 [Kingella denitrificans ATCC 33394]
 gi|324982473|gb|EGC18099.1| 30S ribosomal protein S6 [Kingella denitrificans ATCC 33394]
          Length = 169

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 65/125 (52%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E GG++  + + G R +AY I K  KA+Y
Sbjct: 46  MRHYEIVFIVHPD-QSEQVNAMVERYKTMITEAGGKIHRLEDWGRRQLAYPINKIHKAHY 104

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI + PA + E++   R ++ +LR LT+ + +     +  ++             + 
Sbjct: 105 VLMNIEATPATVEELETGFRFNDAILRHLTIQMKAAVTEASPMMREEKSKSLIAGETANE 164

Query: 121 NVDRK 125
           +    
Sbjct: 165 DSAEA 169


>gi|237748615|ref|ZP_04579095.1| small subunit ribosomal protein S6 [Oxalobacter formigenes OXCC13]
 gi|229379977|gb|EEO30068.1| small subunit ribosomal protein S6 [Oxalobacter formigenes OXCC13]
          Length = 121

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 63/111 (56%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ +   GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKNSVTTRGGKIHRVEDWGRRQLAYMINKFAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI      ++E++   + ++ +LR LT+ +   E  P+  ++   +++
Sbjct: 60  VLMNIECDGETLNELETAFKFNDAILRHLTVKMKHAETGPSPMMKSAQKEE 110


>gi|295676422|ref|YP_003604946.1| ribosomal protein S6 [Burkholderia sp. CCGE1002]
 gi|295436265|gb|ADG15435.1| ribosomal protein S6 [Burkholderia sp. CCGE1002]
          Length = 124

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 63/125 (50%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S I  +GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      + E++   + ++ VLR L + +   E  P+  ++   R++         
Sbjct: 60  VCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQREEAKKSAAAQP 119

Query: 121 NVDRK 125
              + 
Sbjct: 120 TEAQA 124


>gi|167836329|ref|ZP_02463212.1| 30S ribosomal protein S6 [Burkholderia thailandensis MSMB43]
          Length = 124

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 61/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S I  +GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI    A + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 60  VCMNIECDQATLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQR 108


>gi|71906855|ref|YP_284442.1| 30S ribosomal protein S6 [Dechloromonas aromatica RCB]
 gi|91207911|sp|Q47GQ9|RS6_DECAR RecName: Full=30S ribosomal protein S6
 gi|71846476|gb|AAZ45972.1| SSU ribosomal protein S6P [Dechloromonas aromatica RCB]
          Length = 127

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 61/110 (55%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE  F++  D  S+Q+   + +Y++++   GG +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEICFIVHPD-QSEQVPGMVERYRAIVTAKGGSIHRLEDWGRRQLAYPIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MNI      ++E++   + ++ VLR LT+ + +   +P+  ++     
Sbjct: 60  VLMNIECDGDTLNELEHSFKFNDAVLRHLTVKMKAAVTTPSPMMKEEKSK 109


>gi|150395965|ref|YP_001326432.1| 30S ribosomal protein S6 [Sinorhizobium medicae WSM419]
 gi|166227387|sp|A6U7G7|RS6_SINMW RecName: Full=30S ribosomal protein S6
 gi|150027480|gb|ABR59597.1| ribosomal protein S6 [Sinorhizobium medicae WSM419]
          Length = 145

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 58/112 (51%), Positives = 86/112 (76%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDI+ QQ+   + QY+ +I+ NGG+V  V   G++++ YRI+KNRKA+Y
Sbjct: 1   MALYEHVFLARQDITPQQVDGLVEQYKGVIEANGGKVGRVENWGLKSLTYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
           V M+I +P  A+HE++R+MRI+E++LR +T+ VD HE+ P+  +Q+ DRDDR
Sbjct: 61  VLMDIDAPAPAVHEVERQMRINEDILRYMTIAVDKHEEGPSAMMQKRDRDDR 112


>gi|319778268|ref|YP_004129181.1| SSU ribosomal protein S6p [Taylorella equigenitalis MCE9]
 gi|317108292|gb|ADU91038.1| SSU ribosomal protein S6p [Taylorella equigenitalis MCE9]
          Length = 159

 Score =  135 bits (341), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 68/131 (51%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V+++  D  S+Q+     +Y +LI+ NGG+V    + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVYIVHPD-QSEQVPAMTERYTALIKSNGGQVHRSEDWGRRILAYPIQKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI      + E++   R ++ +LR L +   +    P++ ++  +R++       + 
Sbjct: 60  VCLNIECNQETLDELENNFRYNDAILRHLVIKQKAAVTEPSIMMKSTEREESRKAASAED 119

Query: 121 NVDRKQHVSEE 131
               K + S E
Sbjct: 120 RNSSKANHSAE 130


>gi|152981661|ref|YP_001352991.1| 30S ribosomal protein S6 [Janthinobacterium sp. Marseille]
 gi|166226973|sp|A6SXJ4|RS6_JANMA RecName: Full=30S ribosomal protein S6
 gi|151281738|gb|ABR90148.1| small subunit ribosomal protein S6 [Janthinobacterium sp.
           Marseille]
          Length = 122

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 64/119 (53%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+ ++   GG +  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKGIVTARGGVIHRVEDWGRRQMAYMIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           V +NI      + E++   + ++ VLR LT+ +   E +P+  ++   ++D       +
Sbjct: 60  VCLNIECDGETLAEIETGFKFNDAVLRHLTVKMKKAETAPSPMMKAVQKEDAAKSHRAE 118


>gi|91783363|ref|YP_558569.1| 30S ribosomal protein S6 [Burkholderia xenovorans LB400]
 gi|170692292|ref|ZP_02883455.1| ribosomal protein S6 [Burkholderia graminis C4D1M]
 gi|187923776|ref|YP_001895418.1| 30S ribosomal protein S6 [Burkholderia phytofirmans PsJN]
 gi|296157724|ref|ZP_06840558.1| ribosomal protein S6 [Burkholderia sp. Ch1-1]
 gi|307729537|ref|YP_003906761.1| 30S ribosomal protein S6 [Burkholderia sp. CCGE1003]
 gi|323526191|ref|YP_004228344.1| 30S ribosomal protein S6 [Burkholderia sp. CCGE1001]
 gi|122970480|sp|Q13ZH2|RS6_BURXL RecName: Full=30S ribosomal protein S6
 gi|226703435|sp|B2T3N3|RS6_BURPP RecName: Full=30S ribosomal protein S6
 gi|91687317|gb|ABE30517.1| SSU ribosomal protein S6P [Burkholderia xenovorans LB400]
 gi|170142722|gb|EDT10887.1| ribosomal protein S6 [Burkholderia graminis C4D1M]
 gi|187714970|gb|ACD16194.1| ribosomal protein S6 [Burkholderia phytofirmans PsJN]
 gi|295891970|gb|EFG71754.1| ribosomal protein S6 [Burkholderia sp. Ch1-1]
 gi|307584072|gb|ADN57470.1| ribosomal protein S6 [Burkholderia sp. CCGE1003]
 gi|323383193|gb|ADX55284.1| ribosomal protein S6 [Burkholderia sp. CCGE1001]
          Length = 124

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S I  +GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSTITSHGGQIHRIEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      + E++   + ++ VLR L + +   E  P+  ++   R++         
Sbjct: 60  VCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQREEAKKSAATQP 119

Query: 121 NVDRK 125
           +  + 
Sbjct: 120 SEAQA 124


>gi|307294385|ref|ZP_07574229.1| ribosomal protein S6 [Sphingobium chlorophenolicum L-1]
 gi|306880536|gb|EFN11753.1| ribosomal protein S6 [Sphingobium chlorophenolicum L-1]
          Length = 137

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 53/134 (39%), Positives = 86/134 (64%), Gaps = 1/134 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD++  Q+         +++EN G+V  V   G+R++AY+I KNRKA+Y
Sbjct: 1   MALYEHVFLARQDLAQAQVDALAETATKIVEENEGKVTKVETWGLRSLAYKIAKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI +P   + E++R+ +I+E+++R +T+ VD  E  P++ +++ +R +R DR PR  
Sbjct: 61  VMLNIDAPAGVVAELERQTQINEDIIRYMTIKVDELEGGPSVMMRKQERSERGDRGPRGD 120

Query: 121 NVDR-KQHVSEEKP 133
             DR  +   EE P
Sbjct: 121 RGDRGPRREREEAP 134


>gi|237654325|ref|YP_002890639.1| 30S ribosomal protein S6 [Thauera sp. MZ1T]
 gi|237625572|gb|ACR02262.1| ribosomal protein S6 [Thauera sp. MZ1T]
          Length = 128

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 33/129 (25%), Positives = 65/129 (50%), Gaps = 1/129 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+S++    G++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKSIVTTRNGQIHRLEDWGRRQMAYPIQKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      + E++   + ++ VLR LT+ +     +P+  ++       N      +
Sbjct: 60  VLMNIECDGETLAELEHSFKFNDAVLRHLTIKMKKAVTTPSPMMKEEKSRSMNIGADDAK 119

Query: 121 NVDRKQHVS 129
             D +   +
Sbjct: 120 PADSEAAAA 128


>gi|53719094|ref|YP_108080.1| 30S ribosomal protein S6 [Burkholderia pseudomallei K96243]
 gi|53723581|ref|YP_103060.1| 30S ribosomal protein S6 [Burkholderia mallei ATCC 23344]
 gi|67640204|ref|ZP_00439019.1| 30S ribosomal protein S6 [Burkholderia mallei GB8 horse 4]
 gi|76810465|ref|YP_333811.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1710b]
 gi|83721320|ref|YP_442700.1| 30S ribosomal protein S6 [Burkholderia thailandensis E264]
 gi|121600145|ref|YP_993214.1| 30S ribosomal protein S6 [Burkholderia mallei SAVP1]
 gi|124386277|ref|YP_001026011.1| 30S ribosomal protein S6 [Burkholderia mallei NCTC 10229]
 gi|126440551|ref|YP_001059287.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 668]
 gi|126450631|ref|YP_001080722.1| 30S ribosomal protein S6 [Burkholderia mallei NCTC 10247]
 gi|126453081|ref|YP_001066555.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1106a]
 gi|134277876|ref|ZP_01764591.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 305]
 gi|167581639|ref|ZP_02374513.1| 30S ribosomal protein S6 [Burkholderia thailandensis TXDOH]
 gi|167619759|ref|ZP_02388390.1| 30S ribosomal protein S6 [Burkholderia thailandensis Bt4]
 gi|167719190|ref|ZP_02402426.1| 30S ribosomal protein S6 [Burkholderia pseudomallei DM98]
 gi|167738192|ref|ZP_02410966.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 14]
 gi|167815381|ref|ZP_02447061.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 91]
 gi|167823789|ref|ZP_02455260.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 9]
 gi|167845332|ref|ZP_02470840.1| 30S ribosomal protein S6 [Burkholderia pseudomallei B7210]
 gi|167893874|ref|ZP_02481276.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 7894]
 gi|167902328|ref|ZP_02489533.1| 30S ribosomal protein S6 [Burkholderia pseudomallei NCTC 13177]
 gi|167910566|ref|ZP_02497657.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 112]
 gi|167918592|ref|ZP_02505683.1| 30S ribosomal protein S6 [Burkholderia pseudomallei BCC215]
 gi|217421378|ref|ZP_03452882.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 576]
 gi|226197319|ref|ZP_03792896.1| 30S ribosomal protein S6 [Burkholderia pseudomallei Pakistan 9]
 gi|237812613|ref|YP_002897064.1| ribosomal protein S6 [Burkholderia pseudomallei MSHR346]
 gi|242314479|ref|ZP_04813495.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1106b]
 gi|254178587|ref|ZP_04885242.1| 30S ribosomal protein S6 [Burkholderia mallei ATCC 10399]
 gi|254179490|ref|ZP_04886089.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1655]
 gi|254189118|ref|ZP_04895629.1| 30S ribosomal protein S6 [Burkholderia pseudomallei Pasteur 52237]
 gi|254197983|ref|ZP_04904405.1| 30S ribosomal protein S6 [Burkholderia pseudomallei S13]
 gi|254200006|ref|ZP_04906372.1| 30S ribosomal protein S6 [Burkholderia mallei FMH]
 gi|254206339|ref|ZP_04912691.1| 30S ribosomal protein S6 [Burkholderia mallei JHU]
 gi|254258001|ref|ZP_04949055.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1710a]
 gi|254297372|ref|ZP_04964825.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 406e]
 gi|254358246|ref|ZP_04974519.1| 30S ribosomal protein S6 [Burkholderia mallei 2002721280]
 gi|257138912|ref|ZP_05587174.1| 30S ribosomal protein S6 [Burkholderia thailandensis E264]
 gi|61215454|sp|Q62JQ9|RS6_BURMA RecName: Full=30S ribosomal protein S6
 gi|61215467|sp|Q63UY6|RS6_BURPS RecName: Full=30S ribosomal protein S6
 gi|91207904|sp|Q3JRJ2|RS6_BURP1 RecName: Full=30S ribosomal protein S6
 gi|123536854|sp|Q2SWJ9|RS6_BURTA RecName: Full=30S ribosomal protein S6
 gi|166226807|sp|A3MKD6|RS6_BURM7 RecName: Full=30S ribosomal protein S6
 gi|166226808|sp|A2S242|RS6_BURM9 RecName: Full=30S ribosomal protein S6
 gi|166226809|sp|A1V4R1|RS6_BURMS RecName: Full=30S ribosomal protein S6
 gi|166226810|sp|A3NW34|RS6_BURP0 RecName: Full=30S ribosomal protein S6
 gi|166226811|sp|A3NAB6|RS6_BURP6 RecName: Full=30S ribosomal protein S6
 gi|52209508|emb|CAH35460.1| putative 30S ribosomal protein S6 [Burkholderia pseudomallei
           K96243]
 gi|52427004|gb|AAU47597.1| ribosomal protein S6 [Burkholderia mallei ATCC 23344]
 gi|76579918|gb|ABA49393.1| ribosomal protein S6 [Burkholderia pseudomallei 1710b]
 gi|83655145|gb|ABC39208.1| ribosomal protein S6 [Burkholderia thailandensis E264]
 gi|121228955|gb|ABM51473.1| 30S ribosomal protein S6 [Burkholderia mallei SAVP1]
 gi|124294297|gb|ABN03566.1| 30S ribosomal protein S6 [Burkholderia mallei NCTC 10229]
 gi|126220044|gb|ABN83550.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 668]
 gi|126226723|gb|ABN90263.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1106a]
 gi|126243501|gb|ABO06594.1| 30S ribosomal protein S6 [Burkholderia mallei NCTC 10247]
 gi|134251526|gb|EBA51605.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 305]
 gi|147749602|gb|EDK56676.1| 30S ribosomal protein S6 [Burkholderia mallei FMH]
 gi|147753782|gb|EDK60847.1| 30S ribosomal protein S6 [Burkholderia mallei JHU]
 gi|148027373|gb|EDK85394.1| 30S ribosomal protein S6 [Burkholderia mallei 2002721280]
 gi|157807511|gb|EDO84681.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 406e]
 gi|157936797|gb|EDO92467.1| 30S ribosomal protein S6 [Burkholderia pseudomallei Pasteur 52237]
 gi|160699626|gb|EDP89596.1| 30S ribosomal protein S6 [Burkholderia mallei ATCC 10399]
 gi|169654724|gb|EDS87417.1| 30S ribosomal protein S6 [Burkholderia pseudomallei S13]
 gi|184210030|gb|EDU07073.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1655]
 gi|217395120|gb|EEC35138.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 576]
 gi|225930698|gb|EEH26708.1| 30S ribosomal protein S6 [Burkholderia pseudomallei Pakistan 9]
 gi|237503908|gb|ACQ96226.1| ribosomal protein S6 [Burkholderia pseudomallei MSHR346]
 gi|238520890|gb|EEP84346.1| 30S ribosomal protein S6 [Burkholderia mallei GB8 horse 4]
 gi|242137718|gb|EES24120.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1106b]
 gi|254216690|gb|EET06074.1| 30S ribosomal protein S6 [Burkholderia pseudomallei 1710a]
          Length = 124

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S I  +GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI      + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 60  VCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQR 108


>gi|254430019|ref|ZP_05043726.1| ribosomal protein S6 [Alcanivorax sp. DG881]
 gi|196196188|gb|EDX91147.1| ribosomal protein S6 [Alcanivorax sp. DG881]
          Length = 113

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y +++ +  G +  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEVVFLVHPD-QSEQVSAMVERYSAIVTDGKGTIHRVEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V +NI      + E++   R ++ V+R L +  D+    P+   +  +++
Sbjct: 60  VMLNIECDGETLGELENTFRFNDAVIRHLVIRRDNAVTEPSPLAKHDEKE 109


>gi|134095347|ref|YP_001100422.1| 30S ribosomal protein S6 [Herminiimonas arsenicoxydans]
 gi|166226972|sp|A4G712|RS6_HERAR RecName: Full=30S ribosomal protein S6
 gi|133739250|emb|CAL62299.1| 30S ribosomal subunit protein S6 [Herminiimonas arsenicoxydans]
          Length = 122

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 64/119 (53%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+ ++   GG V  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKGIVTARGGVVHRVEDWGRRQMAYLIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           V +NI      + E++   + ++ VLR LT+ +   E +P+  ++   ++D       +
Sbjct: 60  VCLNIECDGETLTEIETGFKFNDAVLRHLTVKMKKAETAPSPMMKAVQKEDAAKSHRTE 118


>gi|78066643|ref|YP_369412.1| 30S ribosomal protein S6 [Burkholderia sp. 383]
 gi|161524573|ref|YP_001579585.1| 30S ribosomal protein S6 [Burkholderia multivorans ATCC 17616]
 gi|167586986|ref|ZP_02379374.1| ribosomal protein S6 [Burkholderia ubonensis Bu]
 gi|189350671|ref|YP_001946299.1| 30S ribosomal protein S6 [Burkholderia multivorans ATCC 17616]
 gi|221198146|ref|ZP_03571192.1| 30S ribosomal protein S6 [Burkholderia multivorans CGD2M]
 gi|221208363|ref|ZP_03581366.1| 30S ribosomal protein S6 [Burkholderia multivorans CGD2]
 gi|221215114|ref|ZP_03588081.1| 30S ribosomal protein S6 [Burkholderia multivorans CGD1]
 gi|91207905|sp|Q39FJ8|RS6_BURS3 RecName: Full=30S ribosomal protein S6
 gi|226703433|sp|A9AJW1|RS6_BURM1 RecName: Full=30S ribosomal protein S6
 gi|77967388|gb|ABB08768.1| SSU ribosomal protein S6P [Burkholderia sp. 383]
 gi|160342002|gb|ABX15088.1| ribosomal protein S6 [Burkholderia multivorans ATCC 17616]
 gi|189334693|dbj|BAG43763.1| small subunit ribosomal protein S6 [Burkholderia multivorans ATCC
           17616]
 gi|221165050|gb|EED97529.1| 30S ribosomal protein S6 [Burkholderia multivorans CGD1]
 gi|221171776|gb|EEE04220.1| 30S ribosomal protein S6 [Burkholderia multivorans CGD2]
 gi|221182078|gb|EEE14479.1| 30S ribosomal protein S6 [Burkholderia multivorans CGD2M]
 gi|325522547|gb|EGD01099.1| 30S ribosomal protein S6 [Burkholderia sp. TJI49]
          Length = 124

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ I  +GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKTTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI      + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 60  VCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQR 108


>gi|186475676|ref|YP_001857146.1| 30S ribosomal protein S6 [Burkholderia phymatum STM815]
 gi|226703434|sp|B2JG18|RS6_BURP8 RecName: Full=30S ribosomal protein S6
 gi|184192135|gb|ACC70100.1| ribosomal protein S6 [Burkholderia phymatum STM815]
          Length = 124

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ I  +GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKTTITSHGGQIHRIEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI    A + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 60  VCMNIECDQATLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQR 108


>gi|110835052|ref|YP_693911.1| 30S ribosomal protein S6 [Alcanivorax borkumensis SK2]
 gi|123345339|sp|Q0VMF9|RS6_ALCBS RecName: Full=30S ribosomal protein S6
 gi|110648163|emb|CAL17639.1| 30S ribosomal protein S6 [Alcanivorax borkumensis SK2]
          Length = 113

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y +++ +  G +  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEVVFLVHPD-QSEQVSAMVERYSAIVTDGKGTIHRVEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V +NI      + E++   R ++ V+R L +  D+    P+   +  +++
Sbjct: 60  VMLNIECDGETLGELENTFRFNDAVIRHLVIRRDNAITEPSPLAKHDEKE 109


>gi|254252202|ref|ZP_04945520.1| Ribosomal protein S6 [Burkholderia dolosa AUO158]
 gi|124894811|gb|EAY68691.1| Ribosomal protein S6 [Burkholderia dolosa AUO158]
          Length = 133

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ I  +GG++  V + G R +AY I K  KA+Y
Sbjct: 10  MRHYEIVFIVHPD-QSEQVPAMIERYKTTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHY 68

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI      + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 69  VCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQR 117


>gi|56477751|ref|YP_159340.1| 30S ribosomal protein S6 [Aromatoleum aromaticum EbN1]
 gi|81357242|sp|Q5P2M5|RS6_AZOSE RecName: Full=30S ribosomal protein S6
 gi|56313794|emb|CAI08439.1| 30S Ribosomal protein S6 [Aromatoleum aromaticum EbN1]
          Length = 128

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 63/129 (48%), Gaps = 1/129 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++++    G++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFIVHPD-QSEQVPAMIERYKAIVTARNGQIHRLEDWGRRQMAYPIQKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI     A+ E++   + ++ VLR L +   +   +P+  ++             D 
Sbjct: 60  VLMNIECDGEALGELEHAFKFNDAVLRHLVVKTKAAVTTPSPMMKEEKSRSLTAAPATDE 119

Query: 121 NVDRKQHVS 129
               +   +
Sbjct: 120 AKPAEAESA 128


>gi|332283718|ref|YP_004415629.1| 30S ribosomal protein S6 [Pusillimonas sp. T7-7]
 gi|330427671|gb|AEC19005.1| 30S ribosomal protein S6 [Pusillimonas sp. T7-7]
          Length = 126

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 65/127 (51%), Gaps = 1/127 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +YQ ++  NGG V  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFIVHPD-QSEQVPAMIERYQGVVTTNGGTVHRLEDWGRRQLAYPIQKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI     A+ E++   R ++ +LR L +       + +L ++  +R++         
Sbjct: 60  VCLNIECGQVALDELEHSFRYNDAILRHLVIKTKKPVTAASLMMKSVEREEARKASAETT 119

Query: 121 NVDRKQH 127
              + + 
Sbjct: 120 TASQSEE 126


>gi|22124559|ref|NP_667982.1| 30S ribosomal protein S6 [Yersinia pestis KIM 10]
 gi|45440396|ref|NP_991935.1| 30S ribosomal protein S6 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51594790|ref|YP_068981.1| 30S ribosomal protein S6 [Yersinia pseudotuberculosis IP 32953]
 gi|108806087|ref|YP_650003.1| 30S ribosomal protein S6 [Yersinia pestis Antiqua]
 gi|108813443|ref|YP_649210.1| 30S ribosomal protein S6 [Yersinia pestis Nepal516]
 gi|123440773|ref|YP_001004765.1| 30S ribosomal protein S6 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|153950227|ref|YP_001402593.1| 30S ribosomal protein S6 [Yersinia pseudotuberculosis IP 31758]
 gi|153997316|ref|ZP_02022416.1| 30S ribosomal protein S6 [Yersinia pestis CA88-4125]
 gi|162419609|ref|YP_001605263.1| 30S ribosomal protein S6 [Yersinia pestis Angola]
 gi|165928153|ref|ZP_02223985.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165937530|ref|ZP_02226093.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011303|ref|ZP_02232201.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166214044|ref|ZP_02240079.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401345|ref|ZP_02306845.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420582|ref|ZP_02312335.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167423107|ref|ZP_02314860.1| ribosomal protein S6 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170025999|ref|YP_001722504.1| 30S ribosomal protein S6 [Yersinia pseudotuberculosis YPIII]
 gi|186893799|ref|YP_001870911.1| 30S ribosomal protein S6 [Yersinia pseudotuberculosis PB1/+]
 gi|218930553|ref|YP_002348428.1| 30S ribosomal protein S6 [Yersinia pestis CO92]
 gi|229836649|ref|ZP_04456815.1| 30S ribosomal subunit protein S6 [Yersinia pestis Pestoides A]
 gi|229839193|ref|ZP_04459352.1| 30S ribosomal subunit protein S6 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229899757|ref|ZP_04514898.1| 30S ribosomal subunit protein S6 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229903919|ref|ZP_04519032.1| 30S ribosomal subunit protein S6 [Yersinia pestis Nepal516]
 gi|270489091|ref|ZP_06206165.1| ribosomal protein S6 [Yersinia pestis KIM D27]
 gi|294505336|ref|YP_003569398.1| 30S ribosomal protein S6 [Yersinia pestis Z176003]
 gi|332160035|ref|YP_004296612.1| 30S ribosomal protein S6 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|24212313|sp|Q8ZB81|RS6_YERPE RecName: Full=30S ribosomal protein S6
 gi|61216169|sp|Q66FA2|RS6_YERPS RecName: Full=30S ribosomal protein S6
 gi|123246054|sp|Q1CBW4|RS6_YERPA RecName: Full=30S ribosomal protein S6
 gi|123372931|sp|Q1CEH0|RS6_YERPN RecName: Full=30S ribosomal protein S6
 gi|166227403|sp|A1JIS8|RS6_YERE8 RecName: Full=30S ribosomal protein S6
 gi|167011250|sp|A7FMW5|RS6_YERP3 RecName: Full=30S ribosomal protein S6
 gi|226705652|sp|B2K2L3|RS6_YERPB RecName: Full=30S ribosomal protein S6
 gi|226705653|sp|A9QYL5|RS6_YERPG RecName: Full=30S ribosomal protein S6
 gi|226705654|sp|B1JMM4|RS6_YERPY RecName: Full=30S ribosomal protein S6
 gi|21957359|gb|AAM84233.1|AE013667_6 30S ribosomal subunit protein S6 [Yersinia pestis KIM 10]
 gi|45435253|gb|AAS60812.1| 30S ribosomal protein S6 [Yersinia pestis biovar Microtus str.
           91001]
 gi|51588072|emb|CAH19678.1| 30S ribosomal protein S6 [Yersinia pseudotuberculosis IP 32953]
 gi|108777091|gb|ABG19610.1| SSU ribosomal protein S6P [Yersinia pestis Nepal516]
 gi|108778000|gb|ABG12058.1| SSU ribosomal protein S6P [Yersinia pestis Antiqua]
 gi|115349164|emb|CAL22127.1| 30S ribosomal protein S6 [Yersinia pestis CO92]
 gi|122087734|emb|CAL10519.1| 30S ribosomal protein S6 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|149288953|gb|EDM39033.1| 30S ribosomal protein S6 [Yersinia pestis CA88-4125]
 gi|152961722|gb|ABS49183.1| ribosomal protein S6 [Yersinia pseudotuberculosis IP 31758]
 gi|162352424|gb|ABX86372.1| ribosomal protein S6 [Yersinia pestis Angola]
 gi|165914635|gb|EDR33249.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str. IP275]
 gi|165919840|gb|EDR37141.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989687|gb|EDR41988.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166204839|gb|EDR49319.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961388|gb|EDR57409.1| ribosomal protein S6 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167049370|gb|EDR60778.1| ribosomal protein S6 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057277|gb|EDR67023.1| ribosomal protein S6 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169752533|gb|ACA70051.1| ribosomal protein S6 [Yersinia pseudotuberculosis YPIII]
 gi|186696825|gb|ACC87454.1| ribosomal protein S6 [Yersinia pseudotuberculosis PB1/+]
 gi|229679689|gb|EEO75792.1| 30S ribosomal subunit protein S6 [Yersinia pestis Nepal516]
 gi|229687249|gb|EEO79324.1| 30S ribosomal subunit protein S6 [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229695559|gb|EEO85606.1| 30S ribosomal subunit protein S6 [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229706333|gb|EEO92341.1| 30S ribosomal subunit protein S6 [Yersinia pestis Pestoides A]
 gi|262363400|gb|ACY60121.1| 30S ribosomal protein S6 [Yersinia pestis D106004]
 gi|262367223|gb|ACY63780.1| 30S ribosomal protein S6 [Yersinia pestis D182038]
 gi|270337595|gb|EFA48372.1| ribosomal protein S6 [Yersinia pestis KIM D27]
 gi|294355795|gb|ADE66136.1| 30S ribosomal protein S6 [Yersinia pestis Z176003]
 gi|318607405|emb|CBY28903.1| SSU ribosomal protein S6p [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|320013743|gb|ADV97314.1| 30S ribosomal subunit protein S6 [Yersinia pestis biovar Medievalis
           str. Harbin 35]
 gi|325664265|gb|ADZ40909.1| 30S ribosomal protein S6 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862081|emb|CBX72247.1| 30S ribosomal protein S6 [Yersinia enterocolitica W22703]
          Length = 130

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 66/131 (50%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P  AI E++   R ++ V+RS+ + V       +  ++  D       F  + 
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERHDFASEA 119

Query: 121 NVDRKQHVSEE 131
           N D +   SEE
Sbjct: 120 NDDSEAGDSEE 130


>gi|311105033|ref|YP_003977886.1| 30S ribosomal protein S6 [Achromobacter xylosoxidans A8]
 gi|310759722|gb|ADP15171.1| ribosomal protein S6 [Achromobacter xylosoxidans A8]
          Length = 125

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 63/109 (57%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +YQ+L+   GG V  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFIVHPD-QSEQVPAMVERYQALVTGQGGSVHRLEDWGRRQLAYPIQKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V +NI    A + E++   R ++ VLR L +     + +P++ ++  +R
Sbjct: 60  VCLNIECGQATLDELEHSFRYNDAVLRHLVIKTKKAQATPSIMMKSVER 108


>gi|145600834|ref|YP_001164910.1| 30S ribosomal protein S6 [Yersinia pestis Pestoides F]
 gi|166227404|sp|A4TRM5|RS6_YERPP RecName: Full=30S ribosomal protein S6
 gi|145212530|gb|ABP41937.1| SSU ribosomal protein S6P [Yersinia pestis Pestoides F]
          Length = 130

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 66/131 (50%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPISKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P  AI E++   R ++ V+RS+ + V       +  ++  D       F  + 
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERHDFASEA 119

Query: 121 NVDRKQHVSEE 131
           N D +   SEE
Sbjct: 120 NDDSEAGDSEE 130


>gi|170733233|ref|YP_001765180.1| 30S ribosomal protein S6 [Burkholderia cenocepacia MC0-3]
 gi|206560309|ref|YP_002231073.1| 30S ribosomal protein S6 [Burkholderia cenocepacia J2315]
 gi|226703431|sp|B1JTF3|RS6_BURCC RecName: Full=30S ribosomal protein S6
 gi|226703432|sp|B4EBH3|RS6_BURCJ RecName: Full=30S ribosomal protein S6
 gi|169816475|gb|ACA91058.1| ribosomal protein S6 [Burkholderia cenocepacia MC0-3]
 gi|198036350|emb|CAR52246.1| 30S ribosomal protein S6 [Burkholderia cenocepacia J2315]
          Length = 124

 Score =  134 bits (338), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S I  +GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI      + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 60  VCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQR 108


>gi|33593752|ref|NP_881396.1| 30S ribosomal protein S6 [Bordetella pertussis Tohama I]
 gi|161609278|ref|NP_888459.2| 30S ribosomal protein S6 [Bordetella bronchiseptica RB50]
 gi|161610393|ref|NP_884697.2| 30S ribosomal protein S6 [Bordetella parapertussis 12822]
 gi|61215726|sp|Q7VV89|RS6_BORPE RecName: Full=30S ribosomal protein S6
 gi|61215731|sp|Q7W7P8|RS6_BORPA RecName: Full=30S ribosomal protein S6
 gi|61215737|sp|Q7WL35|RS6_BORBR RecName: Full=30S ribosomal protein S6
 gi|33563825|emb|CAE43069.1| 30s ribosomal protein s6 [Bordetella pertussis Tohama I]
 gi|332383154|gb|AEE68001.1| 30S ribosomal protein S6 [Bordetella pertussis CS]
          Length = 126

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +YQ+L+    G V  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFIVHPD-QSEQVPAMVERYQALVTGQSGTVHRLEDWGRRQLAYPIQKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI    A + E++   R ++ VLR L +       +P++ ++  +R
Sbjct: 60  VCMNIECGQATLDELEHSFRYNDAVLRHLVIKTKKAPAAPSIMMKSVER 108


>gi|115351862|ref|YP_773701.1| 30S ribosomal protein S6 [Burkholderia ambifaria AMMD]
 gi|134295904|ref|YP_001119639.1| 30S ribosomal protein S6 [Burkholderia vietnamiensis G4]
 gi|170703444|ref|ZP_02894215.1| ribosomal protein S6 [Burkholderia ambifaria IOP40-10]
 gi|171321590|ref|ZP_02910521.1| ribosomal protein S6 [Burkholderia ambifaria MEX-5]
 gi|172060832|ref|YP_001808484.1| 30S ribosomal protein S6 [Burkholderia ambifaria MC40-6]
 gi|122323036|sp|Q0BEQ6|RS6_BURCM RecName: Full=30S ribosomal protein S6
 gi|166226812|sp|A4JEV1|RS6_BURVG RecName: Full=30S ribosomal protein S6
 gi|226703430|sp|B1YRJ4|RS6_BURA4 RecName: Full=30S ribosomal protein S6
 gi|115281850|gb|ABI87367.1| SSU ribosomal protein S6P [Burkholderia ambifaria AMMD]
 gi|134139061|gb|ABO54804.1| SSU ribosomal protein S6P [Burkholderia vietnamiensis G4]
 gi|170131642|gb|EDT00199.1| ribosomal protein S6 [Burkholderia ambifaria IOP40-10]
 gi|171093123|gb|EDT38340.1| ribosomal protein S6 [Burkholderia ambifaria MEX-5]
 gi|171993349|gb|ACB64268.1| ribosomal protein S6 [Burkholderia ambifaria MC40-6]
          Length = 124

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ I  +GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI      + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 60  VCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQR 108


>gi|167562479|ref|ZP_02355395.1| 30S ribosomal protein S6 [Burkholderia oklahomensis EO147]
 gi|167569663|ref|ZP_02362537.1| 30S ribosomal protein S6 [Burkholderia oklahomensis C6786]
          Length = 124

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S I  +GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSTITSHGGQIHRVEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI      + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 60  VCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAESGPSPMMKEVQR 108


>gi|114564512|ref|YP_752026.1| 30S ribosomal protein S6 [Shewanella frigidimarina NCIMB 400]
 gi|122298730|sp|Q07XS7|RS6_SHEFN RecName: Full=30S ribosomal protein S6
 gi|114335805|gb|ABI73187.1| SSU ribosomal protein S6P [Shewanella frigidimarina NCIMB 400]
          Length = 130

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 64/131 (48%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  +I    G V  + + G R +AY I+   KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGVITAANGTVHRLEDWGRRQLAYPIQDLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +   +I E++   R ++ VLR++ +   +     +   +  D  D       DR
Sbjct: 60  VLLNVEASAESIEELETAFRFNDAVLRNMVMRTKAAVTEASPMAKARDERDSRRSPSDDR 119

Query: 121 NVDRKQHVSEE 131
           NV+     + E
Sbjct: 120 NVEESAEENAE 130


>gi|330817225|ref|YP_004360930.1| 30S ribosomal protein S6 [Burkholderia gladioli BSR3]
 gi|327369618|gb|AEA60974.1| 30S ribosomal protein S6 [Burkholderia gladioli BSR3]
          Length = 124

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S I   GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSTITTRGGQIHRVEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V +NI    A + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 60  VCLNIECDQATLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQR 108


>gi|162662263|gb|EDQ49163.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 141

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 65/121 (53%), Gaps = 1/121 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S+Q+   + +Y+ +I   GG+V    + G R +AY I K  KA+Y
Sbjct: 22  MRHYEIVLLIHPD-QSEQVPAMLERYKGMITAGGGKVHREEDWGRRQLAYMINKLAKAHY 80

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + +NI +  A + E++   + ++ VLR LT+     + +P+  ++  +R++       ++
Sbjct: 81  LCLNIEADQAVMAELEHAFKFNDAVLRHLTVQKKKADTAPSSMMKTVEREEARKASQTEQ 140

Query: 121 N 121
            
Sbjct: 141 A 141


>gi|254248015|ref|ZP_04941336.1| Ribosomal protein S6 [Burkholderia cenocepacia PC184]
 gi|124872791|gb|EAY64507.1| Ribosomal protein S6 [Burkholderia cenocepacia PC184]
          Length = 133

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ I  +GG++  V + G R +AY I K  KA+Y
Sbjct: 10  MRHYEIVFIVHPD-QSEQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHY 68

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI      + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 69  VCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQR 117


>gi|304312010|ref|YP_003811608.1| 30S ribosomal protein S6 [gamma proteobacterium HdN1]
 gi|301797743|emb|CBL45965.1| 30S ribosomal protein S6 [gamma proteobacterium HdN1]
          Length = 141

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 36/117 (30%), Positives = 64/117 (54%), Gaps = 1/117 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+ +I E GG++    + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMVERYKGVITEGGGKIHRFEDWGRRQLAYPIDKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFP 117
           + MN+     A+ E+    R ++ VLR++ +  D    S +  ++  D+ +R  R P
Sbjct: 60  ILMNVECSQEALDELGTNFRYNDAVLRNIVIRKDEAVTSESPMLKAGDKPERERRSP 116


>gi|239995321|ref|ZP_04715845.1| 30S ribosomal protein S6 [Alteromonas macleodii ATCC 27126]
          Length = 133

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 36/132 (27%), Positives = 74/132 (56%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y ++++++GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTTILKQDGGQIHRLEDWGRRQLAYPIEKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN-DRFPRD 119
           V +N  +   A+ E++   R ++ +LR++ +   +    P+  ++   R +R  D  PR 
Sbjct: 60  VLINAEASAEAVDELENAFRFNDVILRNMVMRTKTAVTEPSPMMKEEPRRERRDDSAPRQ 119

Query: 120 RNVDRKQHVSEE 131
              ++K   +E+
Sbjct: 120 DRAEKKTETTED 131


>gi|107028947|ref|YP_626042.1| 30S ribosomal protein S6 [Burkholderia cenocepacia AU 1054]
 gi|116689895|ref|YP_835518.1| 30S ribosomal protein S6 [Burkholderia cenocepacia HI2424]
 gi|123179949|sp|Q1BH36|RS6_BURCA RecName: Full=30S ribosomal protein S6
 gi|166226806|sp|A0K7Z8|RS6_BURCH RecName: Full=30S ribosomal protein S6
 gi|105898111|gb|ABF81069.1| SSU ribosomal protein S6P [Burkholderia cenocepacia AU 1054]
 gi|116647984|gb|ABK08625.1| SSU ribosomal protein S6P [Burkholderia cenocepacia HI2424]
          Length = 124

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ I  +GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKTTITTHGGQIHRVEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI      + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 60  VCMNIECDQTTLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQR 108


>gi|332995433|gb|AEF05488.1| 30S ribosomal protein S6 [Alteromonas sp. SN2]
          Length = 132

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 73/131 (55%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y +++++N G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTTILKQNDGQIHRLEDWGRRQLAYPIEKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N  +   A+ E++   R ++ +LR++ +   +    P+   +   R+ R+D  PR  
Sbjct: 60  VLINAEATAEAVDELENAFRYNDVILRNMVMRTKNAVTEPSPMTKEERRERRDDSAPRTE 119

Query: 121 NVDRKQHVSEE 131
             +R+   +E+
Sbjct: 120 RAERRPESTED 130


>gi|312796131|ref|YP_004029053.1| SSU ribosomal protein S6P [Burkholderia rhizoxinica HKI 454]
 gi|312167906|emb|CBW74909.1| SSU ribosomal protein S6P [Burkholderia rhizoxinica HKI 454]
          Length = 127

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 66/126 (52%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE  F++  D  S+Q+   I +Y+S I  +GG++  + + G R +AY I K  KA+Y
Sbjct: 3   MRHYEITFIVHPD-QSEQVPAMIEKYKSTITSHGGQIHRIEDWGRRQLAYMIEKLAKAHY 61

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI    A + E++   + ++ VLR L + +   E  P+  ++   R++      + +
Sbjct: 62  VCMNIECDQATLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQREEAKKAAAQPQ 121

Query: 121 NVDRKQ 126
             + + 
Sbjct: 122 ASEAQA 127


>gi|300311390|ref|YP_003775482.1| 30S ribosomal protein S6 [Herbaspirillum seropedicae SmR1]
 gi|124483538|emb|CAM32642.1| 30S ribosomal subunit protein S6 [Herbaspirillum seropedicae]
 gi|300074175|gb|ADJ63574.1| 30S ribosomal subunit S6 protein [Herbaspirillum seropedicae SmR1]
          Length = 121

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 64/122 (52%), Gaps = 1/122 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+ ++   GG+V  V + G R +AY+I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKGIVTTRGGKVHRVEDWGRRQLAYQIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI      + E++   + ++ VLR LT+ +   E  P+  ++   ++D         
Sbjct: 60  VCLNIEVDSETLAEIETGFKFNDAVLRHLTVKMKKAETGPSPILKAVQKEDAAKSRTEAP 119

Query: 121 NV 122
             
Sbjct: 120 AA 121


>gi|270265014|ref|ZP_06193277.1| 30S ribosomal protein S6 [Serratia odorifera 4Rx13]
 gi|270040948|gb|EFA14049.1| 30S ribosomal protein S6 [Serratia odorifera 4Rx13]
          Length = 132

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 41/133 (30%), Positives = 70/133 (52%), Gaps = 3/133 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAAGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD--RDDRNDRFPR 118
           V +N+ +P  AI E++   R ++ V+RS+ + V       +  ++  D  R DR + F  
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRGDRREDFAN 119

Query: 119 DRNVDRKQHVSEE 131
           + + D     SEE
Sbjct: 120 ETSDDADAGDSEE 132


>gi|296285059|ref|ZP_06863057.1| 30S ribosomal protein S6 [Citromicrobium bathyomarinum JL354]
          Length = 123

 Score =  133 bits (334), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 50/123 (40%), Positives = 80/123 (65%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S  Q+     Q   +I+ N G+V      G++ +AY+I +NRKA++
Sbjct: 1   MALYEHVFLARQDLSQSQVDALAAQATEIIESNEGKVTKTETWGLKNLAYKIDRNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI  P A + E++R+ RI+E+V+R +T+ VD HE+ P+  +++++RD +  R   DR
Sbjct: 61  VLLNIEGPGAMVAELERQTRINEDVIRYMTIRVDEHEEGPSAMMRKNERDSKKRRERSDR 120

Query: 121 NVD 123
             D
Sbjct: 121 GDD 123


>gi|30248222|ref|NP_840292.1| 30S ribosomal protein S6 [Nitrosomonas europaea ATCC 19718]
 gi|61215748|sp|Q82XQ6|RS6_NITEU RecName: Full=30S ribosomal protein S6
 gi|30180107|emb|CAD84109.1| Ribosomal protein S6 [Nitrosomonas europaea ATCC 19718]
          Length = 146

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 65/133 (48%), Gaps = 1/133 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+     +Y +++    G++  + + G R + Y I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVSAMTERYSNIVTGRSGKIHRLEDWGRRQLTYPIQKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI     +++E++   + ++ +LR L + ++    +P+  +Q       +       
Sbjct: 60  VLMNIECDQESLNELEHSFKFNDAILRHLVIRMNGPITTPSPMMQEGKSRPPHSSDEDSE 119

Query: 121 NVDRKQHVSEEKP 133
           N    +  + + P
Sbjct: 120 NTAPAKAKTADSP 132


>gi|317402863|gb|EFV83405.1| 30S ribosomal protein S6 [Achromobacter xylosoxidans C54]
          Length = 124

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 64/114 (56%), Gaps = 1/114 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++     S+Q+   + +YQ+L+   GG V  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFIVHPA-QSEQVPAMVERYQALVTGQGGSVHRLEDWGRRQLAYPIQKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
           V +NI    A + E++   R ++ VLR L +     + +P++ ++  +R++   
Sbjct: 60  VCLNIECGQATLDELEHSFRYNDAVLRHLVIKTKKAQTAPSIMMKSVEREEARK 113


>gi|157368693|ref|YP_001476682.1| 30S ribosomal protein S6 [Serratia proteamaculans 568]
 gi|167011248|sp|A8G8W4|RS6_SERP5 RecName: Full=30S ribosomal protein S6
 gi|157320457|gb|ABV39554.1| ribosomal protein S6 [Serratia proteamaculans 568]
          Length = 132

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/133 (30%), Positives = 69/133 (51%), Gaps = 3/133 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAAGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD--RDDRNDRFPR 118
           V +N+ +P  AI E++   R ++ V+RS+ + V       +  ++  D  R DR + F  
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRGDRREDFAN 119

Query: 119 DRNVDRKQHVSEE 131
           +   D     SEE
Sbjct: 120 ETADDADAGDSEE 132


>gi|328544025|ref|YP_004304134.1| 30S ribosomal protein S6 [polymorphum gilvum SL003B-26A1]
 gi|326413769|gb|ADZ70832.1| 30S ribosomal protein S6 [Polymorphum gilvum SL003B-26A1]
          Length = 153

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 80/106 (75%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S+QQ++  + Q++ LI+  GG V  +   G+R++AYRI+KNRKA+Y
Sbjct: 1   MPLYEHVFLARQDVSTQQVEQLVDQFKGLIESGGGTVGKIENWGLRSLAYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             MNI +P AAI EM+R+M ++E++LR +T+ V++H+  P+  +Q+
Sbjct: 61  TLMNIDAPHAAIAEMERQMGLNEDILRFMTIKVEAHDDEPSAMMQK 106


>gi|332143174|ref|YP_004428912.1| 30S ribosomal protein S6 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|226703415|sp|B4S012|RS6_ALTMD RecName: Full=30S ribosomal protein S6
 gi|327553196|gb|AEA99914.1| 30S ribosomal protein S6 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 133

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 74/132 (56%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y ++++++GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTTILKQDGGQVHRLEDWGRRQLAYPIEKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN-DRFPRD 119
           V +N  +   A+ E++   R ++ +LR++ +   +    P+  ++   R +R  D  PR 
Sbjct: 60  VLINAEATAEAVDELENAFRFNDVILRNMVMRTKTAVTEPSPMMKEEPRRERRDDSAPRQ 119

Query: 120 RNVDRKQHVSEE 131
              ++K   +E+
Sbjct: 120 ERAEKKTETTED 131


>gi|260575001|ref|ZP_05843002.1| ribosomal protein S6 [Rhodobacter sp. SW2]
 gi|259022623|gb|EEW25918.1| ribosomal protein S6 [Rhodobacter sp. SW2]
          Length = 157

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 53/126 (42%), Positives = 82/126 (65%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQDISS Q +  I  + ++I +NGG+V      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDISSTQAESLIEHFSTVIADNGGKVVEHEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
            F+   +P AAI EM+R  R+ ++V+R LT+ VD+H + P++ +Q+ D  DR DR     
Sbjct: 61  AFLKTDAPSAAIQEMERLARLHDDVMRVLTIKVDAHVEGPSVQMQKRDERDRGDRPEGGF 120

Query: 121 NVDRKQ 126
             +R++
Sbjct: 121 GGERRE 126


>gi|238027016|ref|YP_002911247.1| 30S ribosomal protein S6 [Burkholderia glumae BGR1]
 gi|237876210|gb|ACR28543.1| Ribosomal protein S6 [Burkholderia glumae BGR1]
          Length = 124

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 60/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S I   GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSTITTRGGQIHRVEDWGRRQLAYMIEKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI    A + E++   + ++ VLR L + +   E  P+  ++   R
Sbjct: 60  VCMNIECDQATLDELEHAFKFNDAVLRHLIVKMKKAETGPSPMMKEVQR 108


>gi|293393198|ref|ZP_06637513.1| 30S ribosomal protein S6 [Serratia odorifera DSM 4582]
 gi|291424344|gb|EFE97558.1| 30S ribosomal protein S6 [Serratia odorifera DSM 4582]
          Length = 132

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/133 (30%), Positives = 69/133 (51%), Gaps = 3/133 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAQGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD--RDDRNDRFPR 118
           V +N+ +P  AI E++   R ++ V+RS+ + V       +  ++  D  R DR + F  
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRGDRREDFAN 119

Query: 119 DRNVDRKQHVSEE 131
           +   D     SEE
Sbjct: 120 ETADDADAGDSEE 132


>gi|259907189|ref|YP_002647545.1| 30S ribosomal protein S6 [Erwinia pyrifoliae Ep1/96]
 gi|224962811|emb|CAX54269.1| 30S ribosomal protein S6 [Erwinia pyrifoliae Ep1/96]
 gi|283476998|emb|CAY72890.1| 30S ribosomal protein S6 [Erwinia pyrifoliae DSM 12163]
          Length = 131

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITGAEGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P AAI E++   R ++ V+RS+ + V       +  ++ + +R +R + F  +
Sbjct: 60  VLLNVEAPQAAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERREDFANE 119

Query: 120 RNVDRKQHVSEE 131
            + D     SEE
Sbjct: 120 TSDDADAGDSEE 131


>gi|74318123|ref|YP_315863.1| 30S ribosomal protein S6 [Thiobacillus denitrificans ATCC 25259]
 gi|91207799|sp|Q3SH31|RS6_THIDA RecName: Full=30S ribosomal protein S6
 gi|74057618|gb|AAZ98058.1| ribosomal protein S6 [Thiobacillus denitrificans ATCC 25259]
          Length = 127

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 1/128 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ I   GG V  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYRANIAARGGNVHRLEDWGRRQMAYPIQKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      + E++   + ++ VLR LT+  D+   + +  ++     D       D 
Sbjct: 60  VLMNIECDQETLEELEHGFKFNDAVLRHLTIKRDAAVTAASPMMKEEKARDLLQGAKADA 119

Query: 121 NVDRKQHV 128
             ++    
Sbjct: 120 PAEQPAAA 127


>gi|322831169|ref|YP_004211196.1| ribosomal protein S6 [Rahnella sp. Y9602]
 gi|321166370|gb|ADW72069.1| ribosomal protein S6 [Rahnella sp. Y9602]
          Length = 130

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y ++I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSAVITNAAGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P  AI E++   R ++ V+RS+ +         +  ++  D          + 
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRDRREDFAEA 119

Query: 121 NVDRKQHVSEE 131
           N D +   SEE
Sbjct: 120 NDDAEAGDSEE 130


>gi|300715052|ref|YP_003739855.1| 30S ribosomal protein S6 [Erwinia billingiae Eb661]
 gi|299060888|emb|CAX57995.1| 30S ribosomal protein S6 [Erwinia billingiae Eb661]
          Length = 131

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITGAEGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P   I E++   R ++ V+RS+ + V       +  ++ + +R DR + F  +
Sbjct: 60  VLLNVEAPQEVIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRDRREDFANE 119

Query: 120 RNVDRKQHVSEE 131
            + D     SEE
Sbjct: 120 TSDDADAGDSEE 131


>gi|253999143|ref|YP_003051206.1| 30S ribosomal protein S6 [Methylovorus sp. SIP3-4]
 gi|313201244|ref|YP_004039902.1| 30S ribosomal protein S6 [Methylovorus sp. MP688]
 gi|253985822|gb|ACT50679.1| ribosomal protein S6 [Methylovorus sp. SIP3-4]
 gi|312440560|gb|ADQ84666.1| ribosomal protein S6 [Methylovorus sp. MP688]
          Length = 125

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 60/110 (54%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++L+  NGG +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFIVHPD-QSEQVPAMIERYRTLVTSNGGAIHRLEDWGRRQLAYPIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MNI      + E++   + ++ VLR LT+       +P+  ++     
Sbjct: 60  VLMNIECNQTVLEELEHAFKFNDAVLRHLTIATKEAVVAPSPMMKEEKSK 109


>gi|317493583|ref|ZP_07952004.1| ribosomal protein S6 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918526|gb|EFV39864.1| ribosomal protein S6 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 132

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 68/133 (51%), Gaps = 3/133 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAAGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD--RDDRNDRFPR 118
           V +N+ +P  AI E++   R ++ V+RS+ +         +  ++  D  R DR + F  
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRGDRREDFAN 119

Query: 119 DRNVDRKQHVSEE 131
           +   D     SEE
Sbjct: 120 ETADDADAGDSEE 132


>gi|91775679|ref|YP_545435.1| SSU ribosomal protein S6P [Methylobacillus flagellatus KT]
 gi|123380513|sp|Q1H1P3|RS6_METFK RecName: Full=30S ribosomal protein S6
 gi|91709666|gb|ABE49594.1| SSU ribosomal protein S6P [Methylobacillus flagellatus KT]
          Length = 131

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++L+  NGG +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYRTLVTSNGGTIHRLEDWGRRQLAYPIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MNI      ++E++   + ++ VLR LTL  D    +P+  ++     
Sbjct: 60  VLMNIEVSQEVLNELEHAFKFNDAVLRHLTLNTDEAVTAPSPMMKEEKSK 109


>gi|146310036|ref|YP_001175110.1| 30S ribosomal protein S6 [Enterobacter sp. 638]
 gi|167011246|sp|A4W5S9|RS6_ENT38 RecName: Full=30S ribosomal protein S6
 gi|145316912|gb|ABP59059.1| SSU ribosomal protein S6P [Enterobacter sp. 638]
          Length = 131

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITAAEGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P  AI E++   R ++ V+RS+ +   +     +  ++ + +R +R D F  +
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRTKNAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D     SEE
Sbjct: 120 TADDSDAGDSEE 131


>gi|206579361|ref|YP_002240848.1| ribosomal protein S6 [Klebsiella pneumoniae 342]
 gi|288937505|ref|YP_003441564.1| ribosomal protein S6 [Klebsiella variicola At-22]
 gi|290512243|ref|ZP_06551610.1| small subunit ribosomal protein S6 [Klebsiella sp. 1_1_55]
 gi|226703477|sp|B5Y307|RS6_KLEP3 RecName: Full=30S ribosomal protein S6
 gi|206568419|gb|ACI10195.1| ribosomal protein S6 [Klebsiella pneumoniae 342]
 gi|288892214|gb|ADC60532.1| ribosomal protein S6 [Klebsiella variicola At-22]
 gi|289775238|gb|EFD83239.1| small subunit ribosomal protein S6 [Klebsiella sp. 1_1_55]
          Length = 131

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITAAAGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P  AI E++   R ++ V+RS+ +         +  ++ + +R +R + F  +
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERREDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D +   SEE
Sbjct: 120 TADDSEAGDSEE 131


>gi|261342857|ref|ZP_05970715.1| ribosomal protein S6 [Enterobacter cancerogenus ATCC 35316]
 gi|288314900|gb|EFC53838.1| ribosomal protein S6 [Enterobacter cancerogenus ATCC 35316]
          Length = 131

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 67/132 (50%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITAAEGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P  AI E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEAIDELETNFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D     SEE
Sbjct: 120 TADDSDAGDSEE 131


>gi|253996554|ref|YP_003048618.1| 30S ribosomal protein S6 [Methylotenera mobilis JLW8]
 gi|253983233|gb|ACT48091.1| ribosomal protein S6 [Methylotenera mobilis JLW8]
          Length = 127

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 61/110 (55%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++LI  NGG +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFIVHPD-QSEQVPAMIERYRALITSNGGAIHRLEDWGRRQLAYPIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MNI      + E++   + ++ VLR LT+   +   +P+  ++     
Sbjct: 60  VLMNIECNQTVLEELEHGFKFNDAVLRHLTMATKTAVTAPSPMMKEEKSK 109


>gi|73541694|ref|YP_296214.1| 30S ribosomal protein S6 [Ralstonia eutropha JMP134]
 gi|91207785|sp|Q46ZR3|RS6_RALEJ RecName: Full=30S ribosomal protein S6
 gi|72119107|gb|AAZ61370.1| SSU ribosomal protein S6P [Ralstonia eutropha JMP134]
          Length = 124

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 63/125 (50%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+SL+   GG+V  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSLVTSQGGQVHRVEDWGRRQMAYMIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI      + E++   + ++ VLR L +     E +P+  ++   R++         
Sbjct: 60  VCVNIECGKETLAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKEVQREEARKAAQTTT 119

Query: 121 NVDRK 125
                
Sbjct: 120 EGQAA 124


>gi|24375418|ref|NP_719461.1| 30S ribosomal protein S6 [Shewanella oneidensis MR-1]
 gi|32171551|sp|Q8EAH2|RS6_SHEON RecName: Full=30S ribosomal protein S6
 gi|24350259|gb|AAN56905.1|AE015825_4 ribosomal protein S6 [Shewanella oneidensis MR-1]
          Length = 131

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 1/129 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E  G++  + + G R +AY I+   KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITEANGKIHRLEDWGRRQLAYPIQDLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ VLR++ +         +   +  D  D       DR
Sbjct: 60  VLMNVEAPAETIEELETAFRFNDAVLRNMVMRTKGAITEASPMAKAKDERDSRRGPAGDR 119

Query: 121 NVDRKQHVS 129
           + D      
Sbjct: 120 SYDEANAEE 128


>gi|253991545|ref|YP_003042901.1| 30S ribosomal protein S6 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638423|emb|CAR67045.1| 30s ribosomal protein s6 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782995|emb|CAQ86160.1| 30s ribosomal protein s6 [Photorhabdus asymbiotica]
          Length = 131

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 67/132 (50%), Gaps = 1/132 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAQGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P  A+ E++   R ++ V+RS+ + V       +  ++  D     D    D 
Sbjct: 60  VLMNVEAPQEAVDELETNFRFNDAVIRSMIMRVKHAVTEASPMVKAKDERRSRDYSLEDA 119

Query: 121 NVDRKQHVSEEK 132
            VD ++    E+
Sbjct: 120 GVDAEEAGDSEE 131


>gi|94501372|ref|ZP_01307892.1| ribosomal protein S6 [Oceanobacter sp. RED65]
 gi|94426485|gb|EAT11473.1| ribosomal protein S6 [Oceanobacter sp. RED65]
          Length = 137

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y   I+E GG++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPSMIERYTGSIKEAGGQIHRLEDWGRRHLAYPIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      + E+    R ++ V+RS+ + +       +       R DR D    + 
Sbjct: 60  VLMNIECDNDTLAELNNTFRFNDAVIRSMVIRMKDAVTEASPIKAAESRQDRRDEPKAEP 119

Query: 121 NVDRKQ 126
             + K 
Sbjct: 120 KAETKS 125


>gi|317049742|ref|YP_004117390.1| 30S ribosomal protein S6 [Pantoea sp. At-9b]
 gi|316951359|gb|ADU70834.1| ribosomal protein S6 [Pantoea sp. At-9b]
          Length = 131

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 67/132 (50%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITGAQGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P   I E++   R ++ V+RS+ + V       +  ++ + +R +R + F  +
Sbjct: 60  VLLNVEAPQEVIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERREDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D     SEE
Sbjct: 120 AADDSDAGDSEE 131


>gi|152973066|ref|YP_001338212.1| 30S ribosomal protein S6 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|238892680|ref|YP_002917414.1| 30S ribosomal protein S6 [Klebsiella pneumoniae NTUH-K2044]
 gi|262045372|ref|ZP_06018396.1| 30S ribosomal protein S6 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|330003413|ref|ZP_08304611.1| ribosomal protein S6 [Klebsiella sp. MS 92-3]
 gi|166226974|sp|A6THB1|RS6_KLEP7 RecName: Full=30S ribosomal protein S6
 gi|150957915|gb|ABR79945.1| 30S ribosomal protein S6 [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|238544996|dbj|BAH61347.1| 30S ribosomal protein S6 [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259037290|gb|EEW38537.1| 30S ribosomal protein S6 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328536973|gb|EGF63266.1| ribosomal protein S6 [Klebsiella sp. MS 92-3]
          Length = 131

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITAAAGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P  AI E++   R ++ V+RS+ +         +  ++ + +R +R + F  +
Sbjct: 60  VLMNVEAPQEAIDELETNFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERREDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D +   SEE
Sbjct: 120 TADDSEAGDSEE 131


>gi|188535073|ref|YP_001908870.1| 30S ribosomal protein S6 [Erwinia tasmaniensis Et1/99]
 gi|292489608|ref|YP_003532498.1| 30S ribosomal protein S6 [Erwinia amylovora CFBP1430]
 gi|292898171|ref|YP_003537540.1| 30S ribosomal protein S6 [Erwinia amylovora ATCC 49946]
 gi|226703466|sp|B2VCW1|RS6_ERWT9 RecName: Full=30S ribosomal protein S6
 gi|188030115|emb|CAO98001.1| 30S ribosomal protein S6 [Erwinia tasmaniensis Et1/99]
 gi|291198019|emb|CBJ45122.1| 30S ribosomal protein S6 [Erwinia amylovora ATCC 49946]
 gi|291555045|emb|CBA23118.1| 30S ribosomal protein S6 [Erwinia amylovora CFBP1430]
 gi|310765320|gb|ADP10270.1| 30S ribosomal protein S6 [Erwinia sp. Ejp617]
 gi|312173785|emb|CBX82039.1| 30S ribosomal protein S6 [Erwinia amylovora ATCC BAA-2158]
          Length = 131

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 70/132 (53%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITGAEGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P  AI E++   R ++ V+RS+ + V       +  ++ + +R +R + F  +
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERREDFANE 119

Query: 120 RNVDRKQHVSEE 131
            + D     SEE
Sbjct: 120 TSDDADAGDSEE 131


>gi|120600214|ref|YP_964788.1| 30S ribosomal protein S6 [Shewanella sp. W3-18-1]
 gi|146291858|ref|YP_001182282.1| 30S ribosomal protein S6 [Shewanella putrefaciens CN-32]
 gi|166227384|sp|A4Y3F0|RS6_SHEPC RecName: Full=30S ribosomal protein S6
 gi|166227386|sp|A1RNI9|RS6_SHESW RecName: Full=30S ribosomal protein S6
 gi|120560307|gb|ABM26234.1| SSU ribosomal protein S6P [Shewanella sp. W3-18-1]
 gi|145563548|gb|ABP74483.1| SSU ribosomal protein S6P [Shewanella putrefaciens CN-32]
 gi|319425092|gb|ADV53166.1| ribosomal protein S6 [Shewanella putrefaciens 200]
          Length = 131

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 1/129 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  +I E  G +  + + G R +AY I+   KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGVITEANGTIHRLEDWGRRQLAYPIQDLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ VLR++ +         +   +  D  D       +R
Sbjct: 60  VLMNVEAPAETIEELETAFRFNDAVLRNMVMRTKVAVTEASPMARARDERDSRRGPAGER 119

Query: 121 NVDRKQHVS 129
           + D      
Sbjct: 120 SYDEAHAEE 128


>gi|120555298|ref|YP_959649.1| 30S ribosomal protein S6 [Marinobacter aquaeolei VT8]
 gi|166226978|sp|A1U393|RS6_MARAV RecName: Full=30S ribosomal protein S6
 gi|120325147|gb|ABM19462.1| SSU ribosomal protein S6P [Marinobacter aquaeolei VT8]
          Length = 137

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/137 (32%), Positives = 72/137 (52%), Gaps = 5/137 (3%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y S+I E+GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMIERYTSVITEDGGKVHRLEDWGRRHLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN----DRF 116
           V MNI    AA+ E+    R ++ ++R L L  D      +       R+DR     DR 
Sbjct: 60  VLMNIECSQAAMDELTHNFRFNDAIIRDLILRRDEAVTDLSPMKAAESREDRRSGGDDRP 119

Query: 117 PRDRNVDRKQHVSEEKP 133
            R  + + +Q  S+++ 
Sbjct: 120 RRSADSEERQSASQDEE 136


>gi|319787276|ref|YP_004146751.1| ribosomal protein S6 [Pseudoxanthomonas suwonensis 11-1]
 gi|317465788|gb|ADV27520.1| ribosomal protein S6 [Pseudoxanthomonas suwonensis 11-1]
          Length = 143

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 58/114 (50%), Gaps = 1/114 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y+ LI+  GG +  + + G R +AY I+   KA+Y
Sbjct: 1   MRHYEVVFLVHPD-QSEQVPAMIERYKGLIENAGGSIHRLEDWGRRQLAYPIQNLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
           V  N     AAI E+    R ++ +LR L +  D  E   +L ++  D      
Sbjct: 60  VLFNAEVTQAAIDELVETFRFNDAILRHLVIRRDGPETEQSLIMKSKDEKGDKP 113


>gi|90408974|ref|ZP_01217106.1| 30S ribosomal protein S6 [Psychromonas sp. CNPT3]
 gi|90309922|gb|EAS38075.1| 30S ribosomal protein S6 [Psychromonas sp. CNPT3]
          Length = 130

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/130 (28%), Positives = 69/130 (53%), Gaps = 2/130 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVNGMIERYTTSITEAGGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MNI +    + +++   R ++ V+R++ +   +     ++  + R +R +R DR PR 
Sbjct: 60  VLMNIEAEQNVLDDLENAFRFNDAVIRTMIMRTKTAVTEASVVAKAREERSERADRAPRA 119

Query: 120 RNVDRKQHVS 129
              + +   +
Sbjct: 120 PRPEARTETT 129


>gi|113971592|ref|YP_735385.1| 30S ribosomal protein S6 [Shewanella sp. MR-4]
 gi|114046196|ref|YP_736746.1| 30S ribosomal protein S6 [Shewanella sp. MR-7]
 gi|123131744|sp|Q0HYW6|RS6_SHESR RecName: Full=30S ribosomal protein S6
 gi|123324698|sp|Q0HF39|RS6_SHESM RecName: Full=30S ribosomal protein S6
 gi|113886276|gb|ABI40328.1| SSU ribosomal protein S6P [Shewanella sp. MR-4]
 gi|113887638|gb|ABI41689.1| SSU ribosomal protein S6P [Shewanella sp. MR-7]
          Length = 131

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/129 (27%), Positives = 62/129 (48%), Gaps = 1/129 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  +I E  G++  + + G R +AY I+   KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGVITEANGKIHRLEDWGRRQLAYPIQDLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ VLR++ +         +   +  D  D       DR
Sbjct: 60  VLMNVEAPAETIEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKAKDERDSRRGPAGDR 119

Query: 121 NVDRKQHVS 129
           + D      
Sbjct: 120 SYDEANAEE 128


>gi|157373896|ref|YP_001472496.1| 30S ribosomal protein S6 [Shewanella sediminis HAW-EB3]
 gi|189045587|sp|A8FR95|RS6_SHESH RecName: Full=30S ribosomal protein S6
 gi|157316270|gb|ABV35368.1| ribosomal protein S6 [Shewanella sediminis HAW-EB3]
          Length = 139

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/135 (26%), Positives = 66/135 (48%), Gaps = 1/135 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y  ++ + GG+V  + + G R +AY I +  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPGMIERYTGILTQAGGQVHRLEDWGRRQLAYPIIELHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +   ++ E++   R ++ VLRS+ +   +     +   +  D  D       +R
Sbjct: 60  VLMNVEASAESVEELETAFRFNDAVLRSMVMRTKAAITEASPMAKAKDERDSRRSSEGER 119

Query: 121 NVDRKQHVSEEKPLS 135
                +   E K  +
Sbjct: 120 RSAPAEATEEVKETA 134


>gi|294011583|ref|YP_003545043.1| ribosomal protein S6 [Sphingobium japonicum UT26S]
 gi|292674913|dbj|BAI96431.1| ribosomal protein S6 [Sphingobium japonicum UT26S]
          Length = 134

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 49/133 (36%), Positives = 83/133 (62%), Gaps = 2/133 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD++  Q+         +++E  G+V  V   G+R++AY+I KNRKA+Y
Sbjct: 1   MALYEHVFLARQDLAQAQVDALAETATKIVEEMQGKVTKVETWGLRSLAYKIAKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI +P   + E++R+ +I+E+++R +T+ VD  E  P++ +++ +R +R  R  R  
Sbjct: 61  VMLNIDAPAGVVAELERQTQINEDIIRYMTIKVDELETGPSVMMRKQERAERGPRGERGD 120

Query: 121 NVDRKQHVSEEKP 133
              R++   EE P
Sbjct: 121 RGPRRER--EEAP 131


>gi|304396941|ref|ZP_07378821.1| ribosomal protein S6 [Pantoea sp. aB]
 gi|308188255|ref|YP_003932386.1| 30S ribosomal protein S6 [Pantoea vagans C9-1]
 gi|304355737|gb|EFM20104.1| ribosomal protein S6 [Pantoea sp. aB]
 gi|308058765|gb|ADO10937.1| 30S ribosomal protein S6 [Pantoea vagans C9-1]
          Length = 131

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITGAEGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P  AI E++   R ++ V+RS+ + V +     +  ++ + +R DR + F  +
Sbjct: 60  VLMNVEAPQEAIDELETNFRFNDAVIRSMVMRVKNAVTEASPMVKAKDERRDRREDFANE 119

Query: 120 RNVDRKQHVSEE 131
              +     SEE
Sbjct: 120 SADESDAGDSEE 131


>gi|283834820|ref|ZP_06354561.1| ribosomal protein S6 [Citrobacter youngae ATCC 29220]
 gi|291069068|gb|EFE07177.1| ribosomal protein S6 [Citrobacter youngae ATCC 29220]
          Length = 131

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 66/132 (50%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITAAEGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLLNVEAPQEVIDELETNFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D     SEE
Sbjct: 120 TADDADAGDSEE 131


>gi|227112368|ref|ZP_03826024.1| 30S ribosomal protein S6 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227325960|ref|ZP_03829984.1| 30S ribosomal protein S6 [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
 gi|253689797|ref|YP_003018987.1| ribosomal protein S6 [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|261822829|ref|YP_003260935.1| 30S ribosomal protein S6 [Pectobacterium wasabiae WPP163]
 gi|259495340|sp|C6DE15|RS6_PECCP RecName: Full=30S ribosomal protein S6
 gi|251756375|gb|ACT14451.1| ribosomal protein S6 [Pectobacterium carotovorum subsp. carotovorum
           PC1]
 gi|261606842|gb|ACX89328.1| ribosomal protein S6 [Pectobacterium wasabiae WPP163]
          Length = 130

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTATITGAQGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P  AI E++   R ++ V+RS+ + V       +  ++  D          + 
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERREDFAEA 119

Query: 121 NVDRKQHVSEE 131
             D     SEE
Sbjct: 120 GDDVDAGDSEE 130


>gi|149203936|ref|ZP_01880904.1| ribosomal protein S6 [Roseovarius sp. TM1035]
 gi|149142378|gb|EDM30423.1| ribosomal protein S6 [Roseovarius sp. TM1035]
          Length = 141

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 53/124 (42%), Positives = 83/124 (66%), Gaps = 2/124 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+SS Q +  I  + +++ ENGG +      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSSAQAEGLIEHFGAVLTENGGTLVEHEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
            F+   +P +A+ EM+R MR+ ++V+R LT+ VD+HE+ P++ +Q+  RD+R DR  R  
Sbjct: 61  AFLKSDAPSSAVQEMERLMRLHDDVMRVLTVKVDAHEEGPSVQMQK--RDERGDRPDRGD 118

Query: 121 NVDR 124
             DR
Sbjct: 119 RPDR 122


>gi|50122534|ref|YP_051701.1| 30S ribosomal protein S6 [Pectobacterium atrosepticum SCRI1043]
 gi|61215523|sp|Q6D135|RS6_ERWCT RecName: Full=30S ribosomal protein S6
 gi|49613060|emb|CAG76511.1| 30S ribosomal protein S6 [Pectobacterium atrosepticum SCRI1043]
          Length = 130

 Score =  131 bits (330), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 64/131 (48%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTATITGAQGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P  AI E++   R ++ V+RS+ + V       +  ++  D          + 
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERREDFAEA 119

Query: 121 NVDRKQHVSEE 131
             D +   SEE
Sbjct: 120 GDDVEAGDSEE 130


>gi|260767149|ref|ZP_05876093.1| SSU ribosomal protein S6p [Vibrio furnissii CIP 102972]
 gi|260617870|gb|EEX43045.1| SSU ribosomal protein S6p [Vibrio furnissii CIP 102972]
 gi|315181339|gb|ADT88253.1| 30S ribosomal protein S6 [Vibrio furnissii NCTC 11218]
          Length = 122

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 66/123 (53%), Gaps = 1/123 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGKVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +  A I E++   R ++ VLR++ +   +    P++ ++  +   + D    + 
Sbjct: 60  VLMNVEADQAVIDELETAFRFNDAVLRNMIMRTKAAITEPSIMLKAKEERSKRDEAKFEA 119

Query: 121 NVD 123
           + +
Sbjct: 120 DAE 122


>gi|161579540|ref|YP_114470.2| 30S ribosomal protein S6 [Methylococcus capsulatus str. Bath]
 gi|61215443|sp|Q606H8|RS6_METCA RecName: Full=30S ribosomal protein S6
          Length = 136

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 42/129 (32%), Positives = 63/129 (48%), Gaps = 2/129 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S Q+   I +Y+S+I+   G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSGQVPAMIERYRSIIEGAAGRIHRLEDWGRRQLAYPIAKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI    A + E++   R ++ VLRSLT+  D     P+   +    D   DR P D 
Sbjct: 60  VLMNIECDQATLEELESGFRFNDAVLRSLTIRRDEAVTEPSALARSGS-DAEADRAPADE 118

Query: 121 NVDRKQHVS 129
                    
Sbjct: 119 GSVEAAGAE 127


>gi|37528392|ref|NP_931737.1| 30S ribosomal protein S6 [Photorhabdus luminescens subsp. laumondii
           TTO1]
 gi|61216269|sp|Q7MYU7|RS6_PHOLL RecName: Full=30S ribosomal protein S6
 gi|36787830|emb|CAE16945.1| 30S ribosomal protein S6 [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 131

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 67/132 (50%), Gaps = 1/132 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAQGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ V+RS+ + V       +  ++  D     D    D 
Sbjct: 60  VLMNVEAPQEVIDELETNFRFNDAVIRSMIMRVKHAVTEASPMVKAKDERRSRDYSLEDA 119

Query: 121 NVDRKQHVSEEK 132
           N+D ++    E+
Sbjct: 120 NMDAEEAGDSEE 131


>gi|92113016|ref|YP_572944.1| SSU ribosomal protein S6P [Chromohalobacter salexigens DSM 3043]
 gi|122420514|sp|Q1QZ63|RS6_CHRSD RecName: Full=30S ribosomal protein S6
 gi|91796106|gb|ABE58245.1| SSU ribosomal protein S6P [Chromohalobacter salexigens DSM 3043]
          Length = 135

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 68/134 (50%), Gaps = 6/134 (4%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y  L+ ENGG V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMVERYTGLVTENGGTVHRLEDWGRRHLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD-----RDDRNDR 115
           V MNI      + E++   R ++ ++RSL +         +  ++  +     R+++++R
Sbjct: 60  VLMNIECSGETLDEIENIFRFNDAIIRSLVVRCKEAITEASPMMKPAEEKPRRREEKSER 119

Query: 116 FPRDRNVDRKQHVS 129
              +RN +      
Sbjct: 120 PRTERNEEAPADAE 133


>gi|157147829|ref|YP_001455147.1| 30S ribosomal protein S6 [Citrobacter koseri ATCC BAA-895]
 gi|166226820|sp|A8AMJ8|RS6_CITK8 RecName: Full=30S ribosomal protein S6
 gi|157085034|gb|ABV14712.1| hypothetical protein CKO_03633 [Citrobacter koseri ATCC BAA-895]
          Length = 131

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 67/132 (50%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLLNVEAPQEVIDELETNFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D     SEE
Sbjct: 120 TADDADAGDSEE 131


>gi|145588607|ref|YP_001155204.1| 30S ribosomal protein S6 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|189045486|sp|A4SVX6|RS6_POLSQ RecName: Full=30S ribosomal protein S6
 gi|145047013|gb|ABP33640.1| SSU ribosomal protein S6P [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 124

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 62/119 (52%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ +   GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIDRYKATLAAAGGKIHRIEDWGRRQMAYMIDKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           V MNI      + E++   + ++ VLR L +     E  P++ ++   R++       D
Sbjct: 60  VCMNIECDQKTLEELEHAFKFNDAVLRHLIIKTKKAETEPSIMMKEVQREEARKSAQSD 118


>gi|320539667|ref|ZP_08039331.1| 30S ribosomal subunit protein S6 [Serratia symbiotica str. Tucson]
 gi|320030279|gb|EFW12294.1| 30S ribosomal subunit protein S6 [Serratia symbiotica str. Tucson]
          Length = 132

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 41/133 (30%), Positives = 68/133 (51%), Gaps = 3/133 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAQGQVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD--RDDRNDRFPR 118
           V +N+ +P  AI E++     ++ V+RS+ + V       +  ++  D  R DR + F  
Sbjct: 60  VLLNVEAPQEAIDELETNFHFNDAVIRSMVMRVKHAVTEASPMVKAKDERRGDRREDFAN 119

Query: 119 DRNVDRKQHVSEE 131
           +   D     SEE
Sbjct: 120 ETADDVDAGDSEE 132


>gi|291619077|ref|YP_003521819.1| RpsF [Pantoea ananatis LMG 20103]
 gi|291154107|gb|ADD78691.1| RpsF [Pantoea ananatis LMG 20103]
 gi|327395409|dbj|BAK12831.1| 30S ribosomal protein S6 RpsF [Pantoea ananatis AJ13355]
          Length = 131

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITGAEGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P   I E++   R ++ V+RS+ + V +     +  ++ + +R +R + F  +
Sbjct: 60  VLLNVEAPQEVIDELETNFRFNDAVIRSMVMRVKNAVTEASPMVKAKDERRERREDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D     SEE
Sbjct: 120 SADDSDAGDSEE 131


>gi|117919153|ref|YP_868345.1| 30S ribosomal protein S6 [Shewanella sp. ANA-3]
 gi|166227385|sp|A0KT20|RS6_SHESA RecName: Full=30S ribosomal protein S6
 gi|117611485|gb|ABK46939.1| SSU ribosomal protein S6P [Shewanella sp. ANA-3]
          Length = 131

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 1/129 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E  G++  + + G R +AY I+   KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITEANGKIHRLEDWGRRQLAYPIQDLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ VLR++ +         +   +  D  D       DR
Sbjct: 60  VLMNVEAPAETIEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKAKDERDSRRGPAGDR 119

Query: 121 NVDRKQHVS 129
           + D      
Sbjct: 120 SYDEANAEE 128


>gi|121601858|ref|YP_988809.1| 30S ribosomal protein S6 [Bartonella bacilliformis KC583]
 gi|166226802|sp|A1US56|RS6_BARBK RecName: Full=30S ribosomal protein S6
 gi|120614035|gb|ABM44636.1| ribosomal protein S6 [Bartonella bacilliformis KC583]
          Length = 136

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 59/126 (46%), Positives = 88/126 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDI+ QQ+ + +  Y+++I+ +GG+V      G+R++AYRIRKNRKA+Y
Sbjct: 1   MALYEHVFLARQDIAPQQVDELLKTYKNVIESHGGKVERTENWGLRSLAYRIRKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI +P AAI EM+R+MRI+E++LR +T+ V+ HE+  +  + R DRDD   +     
Sbjct: 61  VLINIDAPAAAIAEMERQMRINEDILRYITIRVEKHEKEQSAMLSRPDRDDFPGKDEERP 120

Query: 121 NVDRKQ 126
              R+Q
Sbjct: 121 RPSRRQ 126


>gi|296100963|ref|YP_003611109.1| ribosomal protein S6 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295055422|gb|ADF60160.1| ribosomal protein S6 [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295098347|emb|CBK87437.1| ribosomal protein S6 [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 131

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 67/132 (50%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSAAITGAEGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D     SEE
Sbjct: 120 TADDSDAGDSEE 131


>gi|237729129|ref|ZP_04559610.1| 30S ribosomal protein S6 [Citrobacter sp. 30_2]
 gi|226908858|gb|EEH94776.1| 30S ribosomal protein S6 [Citrobacter sp. 30_2]
          Length = 131

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTAAITGAEGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D +   SEE
Sbjct: 120 TADDAEAGDSEE 131


>gi|300023233|ref|YP_003755844.1| ribosomal protein S6 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525054|gb|ADJ23523.1| ribosomal protein S6 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 179

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 80/111 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH FL RQD++  Q++  + ++Q +++E  G+V      G++ +A++I+KNRKA+Y
Sbjct: 1   MPLYEHTFLARQDVTQAQVEALMKEFQDVVEEGQGKVTKQEYWGLKNLAFKIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
            F NI +PPAA+ EM+R+M I+ +V+R LT+ V+ HE  P++ +++ DR++
Sbjct: 61  AFFNIDAPPAAVTEMERRMGINSDVIRFLTIRVEEHETEPSVQMRKQDREE 111


>gi|300691705|ref|YP_003752700.1| 30S ribosomal subunit protein S6 [Ralstonia solanacearum PSI07]
 gi|299078765|emb|CBJ51425.1| 30S ribosomal subunit protein S6 [Ralstonia solanacearum PSI07]
          Length = 122

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 63/120 (52%), Gaps = 1/120 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S +   GG+V  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSTVTSQGGQVHRVEDWGRRQLAYMIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      + E++   + ++ VLR L +     E +P+  ++   R++      +  
Sbjct: 60  VCMNIECGKETLAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKEVQREEAKKAAAQSE 119


>gi|17546026|ref|NP_519428.1| 30S ribosomal protein S6 [Ralstonia solanacearum GMI1000]
 gi|24212307|sp|Q8XZT8|RS6_RALSO RecName: Full=30S ribosomal protein S6
 gi|17428321|emb|CAD15009.1| probable 30s ribosomal protein s6 [Ralstonia solanacearum GMI1000]
 gi|299067359|emb|CBJ38558.1| 30S ribosomal subunit protein S6 [Ralstonia solanacearum CMR15]
          Length = 122

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 63/120 (52%), Gaps = 1/120 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S +   GG+V  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSTVTSQGGQVHRVEDWGRRQLAYMIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI      + E++   + ++ VLR L +     E +P+  ++   R++      +  
Sbjct: 60  VCVNIECGKETLAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKEVQREEAKKAAAQSE 119


>gi|290473409|ref|YP_003466275.1| 30S ribosomal subunit protein S6 [Xenorhabdus bovienii SS-2004]
 gi|289172708|emb|CBJ79479.1| 30S ribosomal subunit protein S6 [Xenorhabdus bovienii SS-2004]
          Length = 132

 Score =  130 bits (327), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 65/133 (48%), Gaps = 1/133 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAQGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P  AI E++   R ++ V+RS+ + V      P+  ++  D     D    + 
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEPSPMVKAKDERRSRDLVLEED 119

Query: 121 NVDRKQHVSEEKP 133
             D      + + 
Sbjct: 120 MADDADEAGDSEE 132


>gi|161505108|ref|YP_001572219.1| 30S ribosomal protein S6 [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189045491|sp|A9MFL1|RS6_SALAR RecName: Full=30S ribosomal protein S6
 gi|160866455|gb|ABX23078.1| hypothetical protein SARI_03242 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 131

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMIMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D +   SEE
Sbjct: 120 TADDAEAGDSEE 131


>gi|242238246|ref|YP_002986427.1| 30S ribosomal protein S6 [Dickeya dadantii Ech703]
 gi|242130303|gb|ACS84605.1| ribosomal protein S6 [Dickeya dadantii Ech703]
          Length = 130

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 63/131 (48%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P   I E++   R ++ V+RS+ + V       +  ++  D          + 
Sbjct: 60  VLLNVEAPQEVIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERRDEYAEA 119

Query: 121 NVDRKQHVSEE 131
             D +   SEE
Sbjct: 120 GDDAEAGDSEE 130


>gi|91791879|ref|YP_561530.1| 30S ribosomal protein S6 [Shewanella denitrificans OS217]
 gi|123061287|sp|Q12RW9|RS6_SHEDO RecName: Full=30S ribosomal protein S6
 gi|91713881|gb|ABE53807.1| SSU ribosomal protein S6P [Shewanella denitrificans OS217]
          Length = 130

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 58/120 (48%), Gaps = 1/120 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  +I    G +  + + G R +AY I+   KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSGVITAANGTIHRLEDWGRRQLAYPIQDLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +   +I E++   R ++ VLR++ +         +   +  D  D       DR
Sbjct: 60  VLMNVEATAESIEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKARDERDSRRSPSDDR 119


>gi|307546116|ref|YP_003898595.1| 30S ribosomal protein S6 [Halomonas elongata DSM 2581]
 gi|307218140|emb|CBV43410.1| 30S ribosomal protein S6 [Halomonas elongata DSM 2581]
          Length = 123

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 62/123 (50%), Gaps = 2/123 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y  ++ ENGG V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMVERYTGIVTENGGTVHRLEDWGRRHMAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+      + E++   R ++ ++RSL +         +  ++   D+  R D  PR 
Sbjct: 60  VLMNVECSGETLEEIENIFRFNDAIIRSLVVRCKEAITEASPMMKPAEDKRARRDEKPRT 119

Query: 120 RNV 122
              
Sbjct: 120 AES 122


>gi|16763208|ref|NP_458825.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16767637|ref|NP_463252.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29144687|ref|NP_808029.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56416182|ref|YP_153257.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62182835|ref|YP_219252.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|156932421|ref|YP_001436337.1| 30S ribosomal protein S6 [Cronobacter sakazakii ATCC BAA-894]
 gi|161617663|ref|YP_001591628.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168263255|ref|ZP_02685228.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|168464724|ref|ZP_02698627.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|194443034|ref|YP_002043644.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194450923|ref|YP_002048433.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194471096|ref|ZP_03077080.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194735616|ref|YP_002117331.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197251398|ref|YP_002149305.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197262329|ref|ZP_03162403.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197365105|ref|YP_002144742.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|200389133|ref|ZP_03215745.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204926729|ref|ZP_03217931.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205355146|ref|YP_002228947.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207859536|ref|YP_002246187.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213028574|ref|ZP_03343021.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213161637|ref|ZP_03347347.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213428643|ref|ZP_03361393.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213609730|ref|ZP_03369556.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213648999|ref|ZP_03379052.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213864945|ref|ZP_03387064.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224586230|ref|YP_002640029.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238910548|ref|ZP_04654385.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|260599462|ref|YP_003212033.1| 30S ribosomal protein S6 [Cronobacter turicensis z3032]
 gi|283786874|ref|YP_003366739.1| 30S ribosomal subunit protein S6 [Citrobacter rodentium ICC168]
 gi|54039532|sp|P66594|RS6_SALTI RecName: Full=30S ribosomal protein S6
 gi|54041975|sp|P66593|RS6_SALTY RecName: Full=30S ribosomal protein S6
 gi|75478846|sp|Q57GJ1|RS6_SALCH RecName: Full=30S ribosomal protein S6
 gi|81599615|sp|Q5PJ58|RS6_SALPA RecName: Full=30S ribosomal protein S6
 gi|166226829|sp|A7MM76|RS6_ENTS8 RecName: Full=30S ribosomal protein S6
 gi|189045492|sp|A9N518|RS6_SALPB RecName: Full=30S ribosomal protein S6
 gi|226695123|sp|B5F3B7|RS6_SALA4 RecName: Full=30S ribosomal protein S6
 gi|226695125|sp|B5R0R8|RS6_SALEP RecName: Full=30S ribosomal protein S6
 gi|226695126|sp|B5R9E8|RS6_SALG2 RecName: Full=30S ribosomal protein S6
 gi|226695127|sp|B4TFD5|RS6_SALHS RecName: Full=30S ribosomal protein S6
 gi|226695128|sp|B4T3F1|RS6_SALNS RecName: Full=30S ribosomal protein S6
 gi|226695129|sp|B5BKK9|RS6_SALPK RecName: Full=30S ribosomal protein S6
 gi|226695130|sp|B4TT33|RS6_SALSV RecName: Full=30S ribosomal protein S6
 gi|254765451|sp|C0Q6F8|RS6_SALPC RecName: Full=30S ribosomal protein S6
 gi|25294538|pir||AG1052 30s ribosomal protein S6 [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16422953|gb|AAL23211.1| 30S ribosomal subunit protein S6 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16505516|emb|CAD06868.1| 30s ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29140326|gb|AAO71889.1| 30s ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56130439|gb|AAV79945.1| 30s ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62130468|gb|AAX68171.1| 30S ribosomal subunit protein S6 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|156530675|gb|ABU75501.1| hypothetical protein ESA_00200 [Cronobacter sakazakii ATCC BAA-894]
 gi|161367027|gb|ABX70795.1| hypothetical protein SPAB_05526 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401697|gb|ACF61919.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194409227|gb|ACF69446.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194457460|gb|EDX46299.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194711118|gb|ACF90339.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195632912|gb|EDX51366.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197096582|emb|CAR62194.1| 30s ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197215101|gb|ACH52498.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Agona str. SL483]
 gi|197240584|gb|EDY23204.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|199606231|gb|EDZ04776.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|204323394|gb|EDZ08589.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205274927|emb|CAR39996.1| 30s ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205348027|gb|EDZ34658.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Hadar str. RI_05P066]
 gi|206711339|emb|CAR35717.1| 30s ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224470758|gb|ACN48588.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|260218639|emb|CBA33949.1| 30S ribosomal protein S6 [Cronobacter turicensis z3032]
 gi|261249481|emb|CBG27346.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267996725|gb|ACY91610.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|282950328|emb|CBG89975.1| 30S ribosomal subunit protein S6 [Citrobacter rodentium ICC168]
 gi|301160878|emb|CBW20410.1| 30s ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312915488|dbj|BAJ39462.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320088817|emb|CBY98575.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321222645|gb|EFX47717.1| SSU ribosomal protein S6p [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322615553|gb|EFY12473.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618613|gb|EFY15502.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322621974|gb|EFY18824.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627698|gb|EFY24489.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631005|gb|EFY27769.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637776|gb|EFY34477.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642338|gb|EFY38943.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322643991|gb|EFY40539.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650934|gb|EFY47319.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653577|gb|EFY49905.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659762|gb|EFY56005.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322662027|gb|EFY58243.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666224|gb|EFY62402.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322672644|gb|EFY68755.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322676074|gb|EFY72145.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322680558|gb|EFY76596.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322684548|gb|EFY80552.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322717337|gb|EFZ08908.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323132728|gb|ADX20158.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323192863|gb|EFZ78089.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323197261|gb|EFZ82401.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323201622|gb|EFZ86686.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323206136|gb|EFZ91098.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323213144|gb|EFZ97946.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215518|gb|EGA00262.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323219503|gb|EGA03988.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227806|gb|EGA11960.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323228976|gb|EGA13105.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236412|gb|EGA20488.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238683|gb|EGA22735.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323241866|gb|EGA25895.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247985|gb|EGA31922.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254684|gb|EGA38495.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258257|gb|EGA41934.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263597|gb|EGA47118.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265807|gb|EGA49303.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323270251|gb|EGA53699.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326630304|gb|EGE36647.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332991202|gb|AEF10185.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 131

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D +   SEE
Sbjct: 120 TADDAEAGDSEE 131


>gi|188495956|ref|ZP_03003226.1| ribosomal protein S6 [Escherichia coli 53638]
 gi|194439549|ref|ZP_03071623.1| ribosomal protein S6 [Escherichia coli 101-1]
 gi|253775175|ref|YP_003038006.1| 30S ribosomal protein S6 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254164129|ref|YP_003047237.1| 30S ribosomal protein S6 [Escherichia coli B str. REL606]
 gi|256025135|ref|ZP_05439000.1| 30S ribosomal protein S6 [Escherichia sp. 4_1_40B]
 gi|297519432|ref|ZP_06937818.1| 30S ribosomal protein S6 [Escherichia coli OP50]
 gi|300928017|ref|ZP_07143570.1| ribosomal protein S6 [Escherichia coli MS 187-1]
 gi|301028023|ref|ZP_07191307.1| ribosomal protein S6 [Escherichia coli MS 196-1]
 gi|301646648|ref|ZP_07246514.1| ribosomal protein S6 [Escherichia coli MS 146-1]
 gi|188491155|gb|EDU66258.1| ribosomal protein S6 [Escherichia coli 53638]
 gi|194421548|gb|EDX37561.1| ribosomal protein S6 [Escherichia coli 101-1]
 gi|242379721|emb|CAQ34546.1| 30S ribosomal subunit protein S6, subunit of 30S ribosomal subunit
           and ribosome [Escherichia coli BL21(DE3)]
 gi|253326219|gb|ACT30821.1| ribosomal protein S6 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253976030|gb|ACT41701.1| 30S ribosomal protein S6 [Escherichia coli B str. REL606]
 gi|253980186|gb|ACT45856.1| 30S ribosomal protein S6 [Escherichia coli BL21(DE3)]
 gi|299878933|gb|EFI87144.1| ribosomal protein S6 [Escherichia coli MS 196-1]
 gi|300463968|gb|EFK27461.1| ribosomal protein S6 [Escherichia coli MS 187-1]
 gi|301075195|gb|EFK90001.1| ribosomal protein S6 [Escherichia coli MS 146-1]
 gi|323940119|gb|EGB36313.1| ribosomal protein S6 [Escherichia coli E482]
 gi|323970545|gb|EGB65804.1| ribosomal protein S6 [Escherichia coli TA007]
          Length = 131

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D     SEE
Sbjct: 120 TADDADAGDSEE 131


>gi|238021235|ref|ZP_04601661.1| hypothetical protein GCWU000324_01133 [Kingella oralis ATCC 51147]
 gi|237868215|gb|EEP69221.1| hypothetical protein GCWU000324_01133 [Kingella oralis ATCC 51147]
          Length = 124

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 66/111 (59%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+S+I E GG++  + + G R +AY+I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKSMITEAGGKIHRLEDWGRRQLAYQINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + PA I E++   R ++ VLR LT+   +    P++ +Q     +
Sbjct: 60  VLMNIEATPAIIEELETGFRFNDAVLRHLTIQKKAAVTEPSVMMQGEKSKN 110


>gi|224824685|ref|ZP_03697792.1| ribosomal protein S6 [Lutiella nitroferrum 2002]
 gi|224603178|gb|EEG09354.1| ribosomal protein S6 [Lutiella nitroferrum 2002]
          Length = 125

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 61/126 (48%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+ ++    G++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKGMVLAAEGKIHRLEDWGRRQLAYPIQKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+      + E++   + ++ VLR LT+ +D      +  ++     +  +      
Sbjct: 60  VLMNVECQAETLAEIEHAFKFNDAVLRHLTIKLDRAVTEASPMMKDEKAKNLLEPQQPAA 119

Query: 121 NVDRKQ 126
             +   
Sbjct: 120 EAEVAA 125


>gi|15804789|ref|NP_290830.1| 30S ribosomal protein S6 [Escherichia coli O157:H7 EDL933]
 gi|15834430|ref|NP_313203.1| 30S ribosomal protein S6 [Escherichia coli O157:H7 str. Sakai]
 gi|24115554|ref|NP_710064.1| 30S ribosomal protein S6 [Shigella flexneri 2a str. 301]
 gi|26251098|ref|NP_757138.1| 30S ribosomal protein S6 [Escherichia coli CFT073]
 gi|30065571|ref|NP_839742.1| 30S ribosomal protein S6 [Shigella flexneri 2a str. 2457T]
 gi|74314681|ref|YP_313100.1| 30S ribosomal protein S6 [Shigella sonnei Ss046]
 gi|82546558|ref|YP_410505.1| 30S ribosomal protein S6 [Shigella boydii Sb227]
 gi|82779398|ref|YP_405747.1| 30S ribosomal protein S6 [Shigella dysenteriae Sd197]
 gi|89110920|ref|AP_004700.1| 30S ribosomal subunit protein S6 [Escherichia coli str. K-12
           substr. W3110]
 gi|91213749|ref|YP_543735.1| 30S ribosomal protein S6 [Escherichia coli UTI89]
 gi|110808115|ref|YP_691635.1| 30S ribosomal protein S6 [Shigella flexneri 5 str. 8401]
 gi|117626546|ref|YP_859869.1| 30S ribosomal protein S6 [Escherichia coli APEC O1]
 gi|157157810|ref|YP_001465700.1| 30S ribosomal protein S6 [Escherichia coli E24377A]
 gi|157163665|ref|YP_001460983.1| 30S ribosomal protein S6 [Escherichia coli HS]
 gi|168751448|ref|ZP_02776470.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4113]
 gi|168754772|ref|ZP_02779779.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4401]
 gi|168760443|ref|ZP_02785450.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4501]
 gi|168766480|ref|ZP_02791487.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4486]
 gi|168774087|ref|ZP_02799094.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4196]
 gi|168780633|ref|ZP_02805640.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4076]
 gi|168784838|ref|ZP_02809845.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC869]
 gi|168801856|ref|ZP_02826863.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC508]
 gi|170021790|ref|YP_001726744.1| 30S ribosomal protein S6 [Escherichia coli ATCC 8739]
 gi|170083646|ref|YP_001732966.1| 30S ribosomal subunit protein S6 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170682447|ref|YP_001746595.1| 30S ribosomal protein S6 [Escherichia coli SMS-3-5]
 gi|170766562|ref|ZP_02901015.1| ribosomal protein S6 [Escherichia albertii TW07627]
 gi|187734235|ref|YP_001882889.1| 30S ribosomal protein S6 [Shigella boydii CDC 3083-94]
 gi|191165624|ref|ZP_03027464.1| ribosomal protein S6 [Escherichia coli B7A]
 gi|191170756|ref|ZP_03032308.1| ribosomal protein S6 [Escherichia coli F11]
 gi|193066024|ref|ZP_03047082.1| ribosomal protein S6 [Escherichia coli E22]
 gi|193070872|ref|ZP_03051804.1| ribosomal protein S6 [Escherichia coli E110019]
 gi|194426546|ref|ZP_03059100.1| ribosomal protein S6 [Escherichia coli B171]
 gi|194434603|ref|ZP_03066860.1| ribosomal protein S6 [Shigella dysenteriae 1012]
 gi|195935990|ref|ZP_03081372.1| 30S ribosomal protein S6 [Escherichia coli O157:H7 str. EC4024]
 gi|208809437|ref|ZP_03251774.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4206]
 gi|208812869|ref|ZP_03254198.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4045]
 gi|208818740|ref|ZP_03259060.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4042]
 gi|209398367|ref|YP_002273742.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4115]
 gi|209921690|ref|YP_002295774.1| 30S ribosomal protein S6 [Escherichia coli SE11]
 gi|215489544|ref|YP_002331975.1| 30S ribosomal protein S6 [Escherichia coli O127:H6 str. E2348/69]
 gi|217324465|ref|ZP_03440549.1| ribosomal protein S6 [Escherichia coli O157:H7 str. TW14588]
 gi|218551470|ref|YP_002385262.1| 30S ribosomal protein S6 [Escherichia fergusonii ATCC 35469]
 gi|218556752|ref|YP_002389666.1| 30S ribosomal protein S6 [Escherichia coli IAI1]
 gi|218561359|ref|YP_002394272.1| 30S ribosomal protein S6 [Escherichia coli S88]
 gi|218692583|ref|YP_002400795.1| 30S ribosomal protein S6 [Escherichia coli ED1a]
 gi|218697951|ref|YP_002405618.1| 30S ribosomal protein S6 [Escherichia coli 55989]
 gi|218702897|ref|YP_002410526.1| 30S ribosomal protein S6 [Escherichia coli IAI39]
 gi|227886756|ref|ZP_04004561.1| ribosomal protein S6 [Escherichia coli 83972]
 gi|237703868|ref|ZP_04534349.1| ribosomal protein S6 [Escherichia sp. 3_2_53FAA]
 gi|238903307|ref|YP_002929103.1| 30S ribosomal subunit protein S6 [Escherichia coli BW2952]
 gi|254037220|ref|ZP_04871297.1| 30S ribosomal subunit protein S6 [Escherichia sp. 1_1_43]
 gi|254796219|ref|YP_003081056.1| 30S ribosomal protein S6 [Escherichia coli O157:H7 str. TW14359]
 gi|256019845|ref|ZP_05433710.1| 30S ribosomal protein S6 [Shigella sp. D9]
 gi|260847030|ref|YP_003224808.1| 30S ribosomal subunit protein S6 [Escherichia coli O103:H2 str.
           12009]
 gi|260858352|ref|YP_003232243.1| 30S ribosomal subunit protein S6 [Escherichia coli O26:H11 str.
           11368]
 gi|260870892|ref|YP_003237294.1| 30S ribosomal subunit protein S6 [Escherichia coli O111:H- str.
           11128]
 gi|261225320|ref|ZP_05939601.1| 30S ribosomal subunit protein S6 [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255428|ref|ZP_05947961.1| 30S ribosomal subunit protein S6 [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285612|ref|YP_003502430.1| Ribosomal protein S6 [Escherichia coli O55:H7 str. CB9615]
 gi|293407925|ref|ZP_06651765.1| conserved hypothetical protein [Escherichia coli B354]
 gi|293417703|ref|ZP_06660325.1| 30S ribosomal protein S6 [Escherichia coli B185]
 gi|293476509|ref|ZP_06664917.1| 30S ribosomal protein S6 [Escherichia coli B088]
 gi|296044035|ref|NP_418621.5| 30S ribosomal subunit protein S6 [Escherichia coli str. K-12
           substr. MG1655]
 gi|300816498|ref|ZP_07096719.1| ribosomal protein S6 [Escherichia coli MS 107-1]
 gi|300821294|ref|ZP_07101442.1| ribosomal protein S6 [Escherichia coli MS 119-7]
 gi|300906030|ref|ZP_07123754.1| ribosomal protein S6 [Escherichia coli MS 84-1]
 gi|300918338|ref|ZP_07134939.1| ribosomal protein S6 [Escherichia coli MS 115-1]
 gi|300922392|ref|ZP_07138512.1| ribosomal protein S6 [Escherichia coli MS 182-1]
 gi|300940687|ref|ZP_07155248.1| ribosomal protein S6 [Escherichia coli MS 21-1]
 gi|300949167|ref|ZP_07163209.1| ribosomal protein S6 [Escherichia coli MS 116-1]
 gi|300955264|ref|ZP_07167657.1| ribosomal protein S6 [Escherichia coli MS 175-1]
 gi|300987234|ref|ZP_07178063.1| ribosomal protein S6 [Escherichia coli MS 45-1]
 gi|300988552|ref|ZP_07178748.1| ribosomal protein S6 [Escherichia coli MS 200-1]
 gi|301024524|ref|ZP_07188199.1| ribosomal protein S6 [Escherichia coli MS 69-1]
 gi|301045966|ref|ZP_07193149.1| ribosomal protein S6 [Escherichia coli MS 185-1]
 gi|301302617|ref|ZP_07208747.1| ribosomal protein S6 [Escherichia coli MS 124-1]
 gi|301325965|ref|ZP_07219386.1| ribosomal protein S6 [Escherichia coli MS 78-1]
 gi|306815585|ref|ZP_07449734.1| 30S ribosomal protein S6 [Escherichia coli NC101]
 gi|307140897|ref|ZP_07500253.1| 30S ribosomal protein S6 [Escherichia coli H736]
 gi|307314851|ref|ZP_07594443.1| ribosomal protein S6 [Escherichia coli W]
 gi|309787732|ref|ZP_07682343.1| ribosomal protein S6 [Shigella dysenteriae 1617]
 gi|309797012|ref|ZP_07691412.1| ribosomal protein S6 [Escherichia coli MS 145-7]
 gi|312965874|ref|ZP_07780100.1| ribosomal protein S6 [Escherichia coli 2362-75]
 gi|312973991|ref|ZP_07788162.1| ribosomal protein S6 [Escherichia coli 1827-70]
 gi|331644952|ref|ZP_08346069.1| ribosomal protein S6 [Escherichia coli H736]
 gi|331650325|ref|ZP_08351397.1| ribosomal protein S6 [Escherichia coli M605]
 gi|331656029|ref|ZP_08357017.1| ribosomal protein S6 [Escherichia coli M718]
 gi|331660775|ref|ZP_08361707.1| ribosomal protein S6 [Escherichia coli TA206]
 gi|331665864|ref|ZP_08366758.1| ribosomal protein S6 [Escherichia coli TA143]
 gi|331671109|ref|ZP_08371942.1| ribosomal protein S6 [Escherichia coli TA271]
 gi|331671352|ref|ZP_08372150.1| ribosomal protein S6 [Escherichia coli TA280]
 gi|331680330|ref|ZP_08380989.1| ribosomal protein S6 [Escherichia coli H591]
 gi|331681219|ref|ZP_08381856.1| ribosomal protein S6 [Escherichia coli H299]
 gi|332280985|ref|ZP_08393398.1| 30S ribosomal subunit protein S6 [Shigella sp. D9]
 gi|61236240|sp|P0A4D0|RS6_ECOL6 RecName: Full=30S ribosomal protein S6
 gi|61236246|sp|P0A4D1|RS6_ECO57 RecName: Full=30S ribosomal protein S6
 gi|61236252|sp|P0A4D2|RS6_SHIFL RecName: Full=30S ribosomal protein S6
 gi|91207789|sp|Q31TD1|RS6_SHIBS RecName: Full=30S ribosomal protein S6
 gi|91207790|sp|Q328J9|RS6_SHIDS RecName: Full=30S ribosomal protein S6
 gi|91207791|sp|Q3YUE7|RS6_SHISS RecName: Full=30S ribosomal protein S6
 gi|122421451|sp|Q1R360|RS6_ECOUT RecName: Full=30S ribosomal protein S6
 gi|122956957|sp|Q0SX85|RS6_SHIF8 RecName: Full=30S ribosomal protein S6
 gi|166226828|sp|A1AJA5|RS6_ECOK1 RecName: Full=30S ribosomal protein S6
 gi|167011244|sp|A7ZV71|RS6_ECO24 RecName: Full=30S ribosomal protein S6
 gi|167011245|sp|A8A7U6|RS6_ECOHS RecName: Full=30S ribosomal protein S6
 gi|189045466|sp|B1IT06|RS6_ECOLC RecName: Full=30S ribosomal protein S6
 gi|226695261|sp|B2TY73|RS6_SHIB3 RecName: Full=30S ribosomal protein S6
 gi|226703457|sp|B7MLK5|RS6_ECO45 RecName: Full=30S ribosomal protein S6
 gi|226703458|sp|B5Z2K6|RS6_ECO5E RecName: Full=30S ribosomal protein S6
 gi|226703459|sp|B7NTQ6|RS6_ECO7I RecName: Full=30S ribosomal protein S6
 gi|226703460|sp|B7M9G2|RS6_ECO8A RecName: Full=30S ribosomal protein S6
 gi|226703461|sp|B1XDV1|RS6_ECODH RecName: Full=30S ribosomal protein S6
 gi|226703463|sp|B6I2A6|RS6_ECOSE RecName: Full=30S ribosomal protein S6
 gi|226703464|sp|B1LQM0|RS6_ECOSM RecName: Full=30S ribosomal protein S6
 gi|226703467|sp|B7LLY2|RS6_ESCF3 RecName: Full=30S ribosomal protein S6
 gi|254765436|sp|B7UQK9|RS6_ECO27 RecName: Full=30S ribosomal protein S6
 gi|254765437|sp|B7LCQ6|RS6_ECO55 RecName: Full=30S ribosomal protein S6
 gi|254765438|sp|B7MST0|RS6_ECO81 RecName: Full=30S ribosomal protein S6
 gi|259495332|sp|C4ZR77|RS6_ECOBW RecName: Full=30S ribosomal protein S6
 gi|12519191|gb|AAG59396.1|AE005652_13 30S ribosomal subunit protein S6 [Escherichia coli O157:H7 str.
           EDL933]
 gi|26111530|gb|AAN83712.1|AE016771_223 30S ribosomal protein S6 [Escherichia coli CFT073]
 gi|42845|emb|CAA27652.1| unnamed protein product [Escherichia coli]
 gi|537041|gb|AAA97096.1| 30S ribosomal subunit protein S6 [Escherichia coli str. K-12
           substr. MG1655]
 gi|13364653|dbj|BAB38599.1| 30S ribosomal subunit protein S6 [Escherichia coli O157:H7 str.
           Sakai]
 gi|24054885|gb|AAN45771.1| 30S ribosomal subunit protein S6 [Shigella flexneri 2a str. 301]
 gi|30043835|gb|AAP19554.1| 30S ribosomal subunit protein S6 [Shigella flexneri 2a str. 2457T]
 gi|73858158|gb|AAZ90865.1| 30S ribosomal subunit protein S6 [Shigella sonnei Ss046]
 gi|81243546|gb|ABB64256.1| 30S ribosomal subunit protein S6 [Shigella dysenteriae Sd197]
 gi|81247969|gb|ABB68677.1| 30S ribosomal subunit protein S6 [Shigella boydii Sb227]
 gi|85676951|dbj|BAE78201.1| 30S ribosomal subunit protein S6 [Escherichia coli str. K12 substr.
           W3110]
 gi|91075323|gb|ABE10204.1| 30S ribosomal protein S6 [Escherichia coli UTI89]
 gi|110617663|gb|ABF06330.1| 30S ribosomal subunit protein S6 [Shigella flexneri 5 str. 8401]
 gi|115515670|gb|ABJ03745.1| 30S ribosomal subunit protein S6 [Escherichia coli APEC O1]
 gi|157069345|gb|ABV08600.1| ribosomal protein S6 [Escherichia coli HS]
 gi|157079840|gb|ABV19548.1| ribosomal protein S6 [Escherichia coli E24377A]
 gi|169756718|gb|ACA79417.1| ribosomal protein S6 [Escherichia coli ATCC 8739]
 gi|169891481|gb|ACB05188.1| 30S ribosomal subunit protein S6 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170124000|gb|EDS92931.1| ribosomal protein S6 [Escherichia albertii TW07627]
 gi|170520165|gb|ACB18343.1| ribosomal protein S6 [Escherichia coli SMS-3-5]
 gi|187431227|gb|ACD10501.1| ribosomal protein S6 [Shigella boydii CDC 3083-94]
 gi|187770274|gb|EDU34118.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4196]
 gi|188014482|gb|EDU52604.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4113]
 gi|189001825|gb|EDU70811.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4076]
 gi|189357892|gb|EDU76311.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4401]
 gi|189363927|gb|EDU82346.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4486]
 gi|189368955|gb|EDU87371.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4501]
 gi|189375098|gb|EDU93514.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC869]
 gi|189376062|gb|EDU94478.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC508]
 gi|190904319|gb|EDV64028.1| ribosomal protein S6 [Escherichia coli B7A]
 gi|190908980|gb|EDV68567.1| ribosomal protein S6 [Escherichia coli F11]
 gi|192926347|gb|EDV80983.1| ribosomal protein S6 [Escherichia coli E22]
 gi|192955818|gb|EDV86289.1| ribosomal protein S6 [Escherichia coli E110019]
 gi|194415285|gb|EDX31553.1| ribosomal protein S6 [Escherichia coli B171]
 gi|194417188|gb|EDX33300.1| ribosomal protein S6 [Shigella dysenteriae 1012]
 gi|208729238|gb|EDZ78839.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4206]
 gi|208734146|gb|EDZ82833.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4045]
 gi|208738863|gb|EDZ86545.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4042]
 gi|209159767|gb|ACI37200.1| ribosomal protein S6 [Escherichia coli O157:H7 str. EC4115]
 gi|209750008|gb|ACI73311.1| 30S ribosomal subunit protein S6 [Escherichia coli]
 gi|209750010|gb|ACI73312.1| 30S ribosomal subunit protein S6 [Escherichia coli]
 gi|209750012|gb|ACI73313.1| 30S ribosomal subunit protein S6 [Escherichia coli]
 gi|209750016|gb|ACI73315.1| 30S ribosomal subunit protein S6 [Escherichia coli]
 gi|209914949|dbj|BAG80023.1| 30S ribosomal protein S6 [Escherichia coli SE11]
 gi|215267616|emb|CAS12071.1| 30S ribosomal subunit protein S6 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217320686|gb|EEC29110.1| ribosomal protein S6 [Escherichia coli O157:H7 str. TW14588]
 gi|218354683|emb|CAV01699.1| 30S ribosomal subunit protein S6 [Escherichia coli 55989]
 gi|218359012|emb|CAQ91672.1| 30S ribosomal subunit protein S6 [Escherichia fergusonii ATCC
           35469]
 gi|218363521|emb|CAR01175.1| 30S ribosomal subunit protein S6 [Escherichia coli IAI1]
 gi|218368128|emb|CAR05935.1| 30S ribosomal subunit protein S6 [Escherichia coli S88]
 gi|218372883|emb|CAR20763.1| 30S ribosomal subunit protein S6 [Escherichia coli IAI39]
 gi|218430147|emb|CAR11005.1| 30S ribosomal subunit protein S6 [Escherichia coli ED1a]
 gi|222035970|emb|CAP78715.1| 30S ribosomal protein S6 [Escherichia coli LF82]
 gi|226840326|gb|EEH72328.1| 30S ribosomal subunit protein S6 [Escherichia sp. 1_1_43]
 gi|226901780|gb|EEH88039.1| ribosomal protein S6 [Escherichia sp. 3_2_53FAA]
 gi|227836329|gb|EEJ46795.1| ribosomal protein S6 [Escherichia coli 83972]
 gi|238859801|gb|ACR61799.1| 30S ribosomal subunit protein S6 [Escherichia coli BW2952]
 gi|254595619|gb|ACT74980.1| 30S ribosomal subunit protein S6 [Escherichia coli O157:H7 str.
           TW14359]
 gi|257757001|dbj|BAI28503.1| 30S ribosomal subunit protein S6 [Escherichia coli O26:H11 str.
           11368]
 gi|257762177|dbj|BAI33674.1| 30S ribosomal subunit protein S6 [Escherichia coli O103:H2 str.
           12009]
 gi|257767248|dbj|BAI38743.1| 30S ribosomal subunit protein S6 [Escherichia coli O111:H- str.
           11128]
 gi|260450973|gb|ACX41395.1| ribosomal protein S6 [Escherichia coli DH1]
 gi|281181296|dbj|BAI57626.1| 30S ribosomal protein S6 [Escherichia coli SE15]
 gi|284924380|emb|CBG37502.1| 30S ribosomal subunit protein S6 [Escherichia coli 042]
 gi|290765485|gb|ADD59446.1| Ribosomal protein S6 [Escherichia coli O55:H7 str. CB9615]
 gi|291320962|gb|EFE60404.1| 30S ribosomal protein S6 [Escherichia coli B088]
 gi|291430421|gb|EFF03419.1| 30S ribosomal protein S6 [Escherichia coli B185]
 gi|291472176|gb|EFF14658.1| conserved hypothetical protein [Escherichia coli B354]
 gi|294491735|gb|ADE90491.1| ribosomal protein S6 [Escherichia coli IHE3034]
 gi|296040586|gb|AAC77157.5| 30S ribosomal subunit protein S6 [Escherichia coli str. K-12
           substr. MG1655]
 gi|300302009|gb|EFJ58394.1| ribosomal protein S6 [Escherichia coli MS 185-1]
 gi|300305898|gb|EFJ60418.1| ribosomal protein S6 [Escherichia coli MS 200-1]
 gi|300317841|gb|EFJ67625.1| ribosomal protein S6 [Escherichia coli MS 175-1]
 gi|300396523|gb|EFJ80061.1| ribosomal protein S6 [Escherichia coli MS 69-1]
 gi|300402197|gb|EFJ85735.1| ribosomal protein S6 [Escherichia coli MS 84-1]
 gi|300407711|gb|EFJ91249.1| ribosomal protein S6 [Escherichia coli MS 45-1]
 gi|300414470|gb|EFJ97780.1| ribosomal protein S6 [Escherichia coli MS 115-1]
 gi|300421211|gb|EFK04522.1| ribosomal protein S6 [Escherichia coli MS 182-1]
 gi|300451415|gb|EFK15035.1| ribosomal protein S6 [Escherichia coli MS 116-1]
 gi|300454575|gb|EFK18068.1| ribosomal protein S6 [Escherichia coli MS 21-1]
 gi|300526183|gb|EFK47252.1| ribosomal protein S6 [Escherichia coli MS 119-7]
 gi|300530728|gb|EFK51790.1| ribosomal protein S6 [Escherichia coli MS 107-1]
 gi|300842142|gb|EFK69902.1| ribosomal protein S6 [Escherichia coli MS 124-1]
 gi|300847318|gb|EFK75078.1| ribosomal protein S6 [Escherichia coli MS 78-1]
 gi|305851247|gb|EFM51702.1| 30S ribosomal protein S6 [Escherichia coli NC101]
 gi|306905654|gb|EFN36183.1| ribosomal protein S6 [Escherichia coli W]
 gi|307556367|gb|ADN49142.1| 30S ribosomal subunit protein S6 [Escherichia coli ABU 83972]
 gi|307629272|gb|ADN73576.1| 30S ribosomal protein S6 [Escherichia coli UM146]
 gi|308119425|gb|EFO56687.1| ribosomal protein S6 [Escherichia coli MS 145-7]
 gi|308924482|gb|EFP69978.1| ribosomal protein S6 [Shigella dysenteriae 1617]
 gi|309704704|emb|CBJ04055.1| 30S ribosomal subunit protein S6 [Escherichia coli ETEC H10407]
 gi|310331525|gb|EFP98781.1| ribosomal protein S6 [Escherichia coli 1827-70]
 gi|312289117|gb|EFR17011.1| ribosomal protein S6 [Escherichia coli 2362-75]
 gi|312948850|gb|ADR29677.1| 30S ribosomal protein S6 [Escherichia coli O83:H1 str. NRG 857C]
 gi|315063514|gb|ADT77841.1| 30S ribosomal subunit protein S6 [Escherichia coli W]
 gi|315138754|dbj|BAJ45913.1| ribosomal protein S6 [Escherichia coli DH1]
 gi|315255545|gb|EFU35513.1| ribosomal protein S6 [Escherichia coli MS 85-1]
 gi|315288481|gb|EFU47879.1| ribosomal protein S6 [Escherichia coli MS 110-3]
 gi|315293517|gb|EFU52869.1| ribosomal protein S6 [Escherichia coli MS 153-1]
 gi|315299081|gb|EFU58335.1| ribosomal protein S6 [Escherichia coli MS 16-3]
 gi|315617609|gb|EFU98215.1| ribosomal protein S6 [Escherichia coli 3431]
 gi|320176374|gb|EFW51429.1| SSU ribosomal protein S6p [Shigella dysenteriae CDC 74-1112]
 gi|320177566|gb|EFW52556.1| SSU ribosomal protein S6p [Shigella boydii ATCC 9905]
 gi|320187350|gb|EFW62044.1| SSU ribosomal protein S6p [Shigella flexneri CDC 796-83]
 gi|320190670|gb|EFW65320.1| SSU ribosomal protein S6p [Escherichia coli O157:H7 str. EC1212]
 gi|320193686|gb|EFW68321.1| SSU ribosomal protein S6p [Escherichia coli WV_060327]
 gi|320200671|gb|EFW75257.1| SSU ribosomal protein S6p [Escherichia coli EC4100B]
 gi|320638958|gb|EFX08604.1| 30S ribosomal protein S6 [Escherichia coli O157:H7 str. G5101]
 gi|320644327|gb|EFX13392.1| 30S ribosomal protein S6 [Escherichia coli O157:H- str. 493-89]
 gi|320649645|gb|EFX18169.1| 30S ribosomal protein S6 [Escherichia coli O157:H- str. H 2687]
 gi|320655041|gb|EFX23002.1| 30S ribosomal protein S6 [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320660548|gb|EFX28009.1| 30S ribosomal protein S6 [Escherichia coli O55:H7 str. USDA 5905]
 gi|320665817|gb|EFX32854.1| 30S ribosomal protein S6 [Escherichia coli O157:H7 str. LSU-61]
 gi|323155982|gb|EFZ42144.1| ribosomal protein S6 [Escherichia coli EPECa14]
 gi|323161992|gb|EFZ47864.1| ribosomal protein S6 [Escherichia coli E128010]
 gi|323166684|gb|EFZ52442.1| ribosomal protein S6 [Shigella sonnei 53G]
 gi|323171639|gb|EFZ57285.1| ribosomal protein S6 [Escherichia coli LT-68]
 gi|323176041|gb|EFZ61633.1| ribosomal protein S6 [Escherichia coli 1180]
 gi|323182306|gb|EFZ67716.1| ribosomal protein S6 [Escherichia coli 1357]
 gi|323189921|gb|EFZ75199.1| ribosomal protein S6 [Escherichia coli RN587/1]
 gi|323380407|gb|ADX52675.1| ribosomal protein S6 [Escherichia coli KO11]
 gi|323935325|gb|EGB31673.1| ribosomal protein S6 [Escherichia coli E1520]
 gi|323946049|gb|EGB42086.1| ribosomal protein S6 [Escherichia coli H120]
 gi|323950731|gb|EGB46609.1| ribosomal protein S6 [Escherichia coli H252]
 gi|323955487|gb|EGB51251.1| ribosomal protein S6 [Escherichia coli H263]
 gi|323960244|gb|EGB55885.1| ribosomal protein S6 [Escherichia coli H489]
 gi|323965587|gb|EGB61041.1| ribosomal protein S6 [Escherichia coli M863]
 gi|323975458|gb|EGB70559.1| ribosomal protein S6 [Escherichia coli TW10509]
 gi|324005264|gb|EGB74483.1| ribosomal protein S6 [Escherichia coli MS 57-2]
 gi|324013800|gb|EGB83019.1| ribosomal protein S6 [Escherichia coli MS 60-1]
 gi|324019378|gb|EGB88597.1| ribosomal protein S6 [Escherichia coli MS 117-3]
 gi|324112203|gb|EGC06181.1| ribosomal protein S6 [Escherichia fergusonii B253]
 gi|324118766|gb|EGC12658.1| ribosomal protein S6 [Escherichia coli E1167]
 gi|325499735|gb|EGC97594.1| 30S ribosomal protein S6 [Escherichia fergusonii ECD227]
 gi|326345470|gb|EGD69213.1| SSU ribosomal protein S6p [Escherichia coli O157:H7 str. 1125]
 gi|326346673|gb|EGD70407.1| SSU ribosomal protein S6p [Escherichia coli O157:H7 str. 1044]
 gi|327250141|gb|EGE61860.1| ribosomal protein S6 [Escherichia coli STEC_7v]
 gi|330908542|gb|EGH37061.1| SSU ribosomal protein S6p [Escherichia coli AA86]
 gi|331035927|gb|EGI08165.1| ribosomal protein S6 [Escherichia coli H736]
 gi|331040719|gb|EGI12877.1| ribosomal protein S6 [Escherichia coli M605]
 gi|331046383|gb|EGI18473.1| ribosomal protein S6 [Escherichia coli M718]
 gi|331051817|gb|EGI23856.1| ribosomal protein S6 [Escherichia coli TA206]
 gi|331056915|gb|EGI28909.1| ribosomal protein S6 [Escherichia coli TA143]
 gi|331061698|gb|EGI33624.1| ribosomal protein S6 [Escherichia coli TA271]
 gi|331071197|gb|EGI42554.1| ribosomal protein S6 [Escherichia coli TA280]
 gi|331071793|gb|EGI43129.1| ribosomal protein S6 [Escherichia coli H591]
 gi|331081440|gb|EGI52601.1| ribosomal protein S6 [Escherichia coli H299]
 gi|332083202|gb|EGI88433.1| ribosomal protein S6 [Shigella boydii 5216-82]
 gi|332087226|gb|EGI92360.1| ribosomal protein S6 [Shigella boydii 3594-74]
 gi|332103337|gb|EGJ06683.1| 30S ribosomal subunit protein S6 [Shigella sp. D9]
 gi|332346282|gb|AEE59616.1| ribosomal protein S6 RpsF [Escherichia coli UMNK88]
 gi|332749077|gb|EGJ79500.1| ribosomal protein S6 [Shigella flexneri K-671]
 gi|332761886|gb|EGJ92160.1| ribosomal protein S6 [Shigella flexneri 2747-71]
 gi|333009462|gb|EGK28918.1| ribosomal protein S6 [Shigella flexneri K-218]
 gi|333011182|gb|EGK30596.1| ribosomal protein S6 [Shigella flexneri K-272]
 gi|333012624|gb|EGK32004.1| ribosomal protein S6 [Shigella flexneri K-227]
 gi|333022264|gb|EGK41502.1| ribosomal protein S6 [Shigella flexneri K-304]
          Length = 131

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D +   SEE
Sbjct: 120 TADDAEAGDSEE 131


>gi|258622407|ref|ZP_05717430.1| 30S ribosomal protein S6 [Vibrio mimicus VM573]
 gi|258625992|ref|ZP_05720857.1| 30S ribosomal protein S6 [Vibrio mimicus VM603]
 gi|261210397|ref|ZP_05924691.1| SSU ribosomal protein S6p [Vibrio sp. RC341]
 gi|262163854|ref|ZP_06031594.1| SSU ribosomal protein S6p [Vibrio mimicus VM223]
 gi|262172537|ref|ZP_06040215.1| SSU ribosomal protein S6p [Vibrio mimicus MB-451]
 gi|262401543|ref|ZP_06078110.1| SSU ribosomal protein S6p [Vibrio sp. RC586]
 gi|258581740|gb|EEW06624.1| 30S ribosomal protein S6 [Vibrio mimicus VM603]
 gi|258585321|gb|EEW10047.1| 30S ribosomal protein S6 [Vibrio mimicus VM573]
 gi|260840455|gb|EEX67021.1| SSU ribosomal protein S6p [Vibrio sp. RC341]
 gi|261893613|gb|EEY39599.1| SSU ribosomal protein S6p [Vibrio mimicus MB-451]
 gi|262027834|gb|EEY46499.1| SSU ribosomal protein S6p [Vibrio mimicus VM223]
 gi|262352258|gb|EEZ01387.1| SSU ribosomal protein S6p [Vibrio sp. RC586]
          Length = 122

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 67/123 (54%), Gaps = 1/123 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +  A + E++   R ++ VLR++ +   +    P++ ++  +   + D    D 
Sbjct: 60  VLMNVEADQAVVDELETAFRFNDAVLRNMIMRTKAAITEPSIMLKAREERVKRDEVKFDA 119

Query: 121 NVD 123
           +V+
Sbjct: 120 DVE 122


>gi|300704318|ref|YP_003745921.1| 30S ribosomal protein S6 [Ralstonia solanacearum CFBP2957]
 gi|299071982|emb|CBJ43312.1| 30S ribosomal subunit protein S6 [Ralstonia solanacearum CFBP2957]
          Length = 122

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 58/106 (54%), Gaps = 1/106 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+  +   GG+V  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKGTVTSQGGQVHRVEDWGRRQLAYMIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI      + E++   + ++ VLR L +     E +P+  ++ 
Sbjct: 60  VCLNIECGKETLAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKE 105


>gi|303257675|ref|ZP_07343687.1| ribosomal protein S6 [Burkholderiales bacterium 1_1_47]
 gi|331000771|ref|ZP_08324420.1| ribosomal protein S6 [Parasutterella excrementihominis YIT 11859]
 gi|302859645|gb|EFL82724.1| ribosomal protein S6 [Burkholderiales bacterium 1_1_47]
 gi|329570503|gb|EGG52228.1| ribosomal protein S6 [Parasutterella excrementihominis YIT 11859]
          Length = 138

 Score =  129 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 63/109 (57%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE  F++  D  S+Q+   I +Y++ ++ +GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEICFIVHPD-QSEQVPAMIERYKAAVESHGGKIHRLEDWGRRQLAYPIEKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI   P  + E++   R ++ VLR LT+ +   E  P+  ++  ++
Sbjct: 60  VLMNIECGPEVLEELENNFRYNDAVLRHLTVKMKKAETEPSPMMKAVEK 108


>gi|114332339|ref|YP_748561.1| 30S ribosomal protein S6 [Nitrosomonas eutropha C91]
 gi|122313013|sp|Q0ADI6|RS6_NITEC RecName: Full=30S ribosomal protein S6
 gi|114309353|gb|ABI60596.1| SSU ribosomal protein S6P [Nitrosomonas eutropha C91]
          Length = 144

 Score =  129 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 33/130 (25%), Positives = 67/130 (51%), Gaps = 2/130 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F++  D  S+Q+   I +Y ++I E  G +  + + G R + Y I+K  KA+Y
Sbjct: 1   MRHYEIIFIVHPD-QSEQVSAMIERYSNMITERSGGIHRLEDWGRRQLTYPIQKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           + MNI     +++E++   + ++ +LR L + ++    +P+  +Q    + D N R    
Sbjct: 60  ILMNIECDQESLNELEHSFKFNDAILRHLVIRMNGPVTTPSPMMQDDKSKPDENSRGTAA 119

Query: 120 RNVDRKQHVS 129
             V+     +
Sbjct: 120 PTVNVADDSA 129


>gi|82703072|ref|YP_412638.1| 30S ribosomal protein S6 [Nitrosospira multiformis ATCC 25196]
 gi|91207923|sp|Q2Y7M5|RS6_NITMU RecName: Full=30S ribosomal protein S6
 gi|82411137|gb|ABB75246.1| SSU ribosomal protein S6P [Nitrosospira multiformis ATCC 25196]
          Length = 125

 Score =  129 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 62/122 (50%), Gaps = 1/122 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++++    G+V  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVSAMIERYRNIVTARNGQVHRLEDWGRRQLAYLIQKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      + E++   + ++ +LR LTL +D    +P+  ++              +
Sbjct: 60  VLMNIECDQETLDELEHAFKFNDAILRHLTLKMDEPVTAPSPMMREEKAKSAPQPAEEAK 119

Query: 121 NV 122
             
Sbjct: 120 ET 121


>gi|170728537|ref|YP_001762563.1| 30S ribosomal protein S6 [Shewanella woodyi ATCC 51908]
 gi|226695132|sp|B1KHZ0|RS6_SHEWM RecName: Full=30S ribosomal protein S6
 gi|169813884|gb|ACA88468.1| ribosomal protein S6 [Shewanella woodyi ATCC 51908]
          Length = 139

 Score =  129 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 65/135 (48%), Gaps = 1/135 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y  ++ + GG++  + + G R +AY I +  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPGMIERYTGILTQAGGQIHRLEDWGRRQLAYPIIELHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +   ++ E++   R ++ VLR++ +   +     +   +  D  D       +R
Sbjct: 60  VLMNVEATAESVEELETAFRFNDAVLRNMVMRTKAAITEASPMAKAKDERDSRRASEGER 119

Query: 121 NVDRKQHVSEEKPLS 135
                +   E    +
Sbjct: 120 RSAPAEATEEVTEAA 134


>gi|255066236|ref|ZP_05318091.1| ribosomal protein S6 [Neisseria sicca ATCC 29256]
 gi|255049446|gb|EET44910.1| ribosomal protein S6 [Neisseria sicca ATCC 29256]
          Length = 123

 Score =  129 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMIAEAGGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|333007701|gb|EGK27178.1| ribosomal protein S6 [Shigella flexneri VA-6]
          Length = 131

 Score =  129 bits (326), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 40/132 (30%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MNI +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNIEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D +   SEE
Sbjct: 120 TADDAEAGDSEE 131


>gi|197105009|ref|YP_002130386.1| ribosomal protein S6 [Phenylobacterium zucineum HLK1]
 gi|196478429|gb|ACG77957.1| ribosomal protein S6 [Phenylobacterium zucineum HLK1]
          Length = 222

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 67/104 (64%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQDIS QQ +    Q ++LI++ GG V  +   G+R + YRI+KNRK +Y
Sbjct: 103 MALYEHVVISRQDISPQQAEALNDQLKALIEQGGGSVAKIEYWGLRNLTYRIKKNRKGHY 162

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             + I +P  A+ EM+R++ I+E+VLR +T+ VD  +   +  +
Sbjct: 163 SLLAIDAPADAVKEMERQLSINEDVLRYMTVRVDELDLELSPIL 206


>gi|329913489|ref|ZP_08275958.1| SSU ribosomal protein S6p [Oxalobacteraceae bacterium IMCC9480]
 gi|327545347|gb|EGF30582.1| SSU ribosomal protein S6p [Oxalobacteraceae bacterium IMCC9480]
          Length = 122

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++++  + G V  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKAVVAAHSGVVHRVEDWGRRQMAYLIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           V MNI      + E++   + ++ VLR LT+ +   E +P+  ++   ++D       +
Sbjct: 60  VCMNIECDNETLVEIETGFKFNDAVLRHLTVKLKKAETAPSPMMKAVQKEDAAKSHRSE 118


>gi|218707811|ref|YP_002415330.1| 30S ribosomal protein S6 [Escherichia coli UMN026]
 gi|293402825|ref|ZP_06646922.1| 30S ribosomal protein S6 [Escherichia coli FVEC1412]
 gi|298378354|ref|ZP_06988238.1| small subunit ribosomal protein S6 [Escherichia coli FVEC1302]
 gi|300899739|ref|ZP_07117964.1| ribosomal protein S6 [Escherichia coli MS 198-1]
 gi|226703462|sp|B7NGD4|RS6_ECOLU RecName: Full=30S ribosomal protein S6
 gi|218434908|emb|CAR15846.1| 30S ribosomal subunit protein S6 [Escherichia coli UMN026]
 gi|291429740|gb|EFF02754.1| 30S ribosomal protein S6 [Escherichia coli FVEC1412]
 gi|298280688|gb|EFI22189.1| small subunit ribosomal protein S6 [Escherichia coli FVEC1302]
 gi|300356711|gb|EFJ72581.1| ribosomal protein S6 [Escherichia coli MS 198-1]
          Length = 131

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D +   SEE
Sbjct: 120 TTDDAEAGDSEE 131


>gi|187478665|ref|YP_786689.1| 30S ribosomal protein S6 [Bordetella avium 197N]
 gi|123514609|sp|Q2KZ18|RS6_BORA1 RecName: Full=30S ribosomal protein S6
 gi|115423251|emb|CAJ49784.1| 30S ribosomal protein S6 [Bordetella avium 197N]
          Length = 124

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +YQSL+    G V  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFIVHPD-QSEQVPAMVERYQSLVTGQNGAVHRLEDWGRRQLAYPIQKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MNI    A + E++   R ++ VLR L +         ++ ++  +R
Sbjct: 60  VCMNIECNQATLDELEHSFRYNDAVLRHLVIKTKKAPVGASIMMKSVER 108


>gi|198243986|ref|YP_002218272.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|226695124|sp|B5FSA1|RS6_SALDC RecName: Full=30S ribosomal protein S6
 gi|197938502|gb|ACH75835.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|326626078|gb|EGE32423.1| ribosomal protein S6 [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 131

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPCMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D +   SEE
Sbjct: 120 TADDAEAGDSEE 131


>gi|28899514|ref|NP_799119.1| 30S ribosomal protein S6 [Vibrio parahaemolyticus RIMD 2210633]
 gi|91227277|ref|ZP_01261702.1| 30S ribosomal protein S6 [Vibrio alginolyticus 12G01]
 gi|260366345|ref|ZP_05778791.1| ribosomal protein S6 [Vibrio parahaemolyticus K5030]
 gi|260879408|ref|ZP_05891763.1| ribosomal protein S6 [Vibrio parahaemolyticus AN-5034]
 gi|260896873|ref|ZP_05905369.1| ribosomal protein S6 [Vibrio parahaemolyticus Peru-466]
 gi|260902021|ref|ZP_05910416.1| ribosomal protein S6 [Vibrio parahaemolyticus AQ4037]
 gi|262393105|ref|YP_003284959.1| 30S ribosomal protein S6p [Vibrio sp. Ex25]
 gi|269964442|ref|ZP_06178683.1| 30S ribosomal protein S6 [Vibrio alginolyticus 40B]
 gi|31340374|sp|Q87L72|RS6_VIBPA RecName: Full=30S ribosomal protein S6
 gi|28807750|dbj|BAC61003.1| ribosomal protein S6 [Vibrio parahaemolyticus RIMD 2210633]
 gi|91188671|gb|EAS74960.1| 30S ribosomal protein S6 [Vibrio alginolyticus 12G01]
 gi|262336699|gb|ACY50494.1| SSU ribosomal protein S6p [Vibrio sp. Ex25]
 gi|269830780|gb|EEZ84998.1| 30S ribosomal protein S6 [Vibrio alginolyticus 40B]
 gi|308086291|gb|EFO35986.1| ribosomal protein S6 [Vibrio parahaemolyticus Peru-466]
 gi|308089677|gb|EFO39372.1| ribosomal protein S6 [Vibrio parahaemolyticus AN-5034]
 gi|308109423|gb|EFO46963.1| ribosomal protein S6 [Vibrio parahaemolyticus AQ4037]
 gi|308112696|gb|EFO50236.1| ribosomal protein S6 [Vibrio parahaemolyticus K5030]
 gi|328472353|gb|EGF43223.1| 30S ribosomal protein S6 [Vibrio parahaemolyticus 10329]
          Length = 129

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/130 (26%), Positives = 66/130 (50%), Gaps = 1/130 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +  A I E++   R ++ VLR++ +   +     ++ +++ +          + 
Sbjct: 60  VLMNVEADQAVIDELETAFRFNDAVLRNMIMRTKAAITEQSIMLKQKEERAPRREERSEA 119

Query: 121 NVDRKQHVSE 130
             + K   +E
Sbjct: 120 KPEAKSEAAE 129


>gi|88810598|ref|ZP_01125855.1| Ribosomal protein S6 [Nitrococcus mobilis Nb-231]
 gi|88792228|gb|EAR23338.1| Ribosomal protein S6 [Nitrococcus mobilis Nb-231]
          Length = 141

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 72/138 (52%), Gaps = 6/138 (4%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S Q+   I +Y+SLI+ NGG++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFLVHPD-QSDQVSAMIERYRSLIEGNGGQIHRLEDWGRRQLAYPIKKLIKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD-----DRNDR 115
           + MN+   P  + E+    R ++ V+R + L        P+   +  D +     +R D+
Sbjct: 60  ILMNVECRPENMEELVSMFRFNDAVIRHMVLSRQEAITDPSPLAKSQDEERGARGERLDK 119

Query: 116 FPRDRNVDRKQHVSEEKP 133
             R    DR +  SE++ 
Sbjct: 120 QGRTDKPDRSETESEQEE 137


>gi|94310917|ref|YP_584127.1| 30S ribosomal protein S6 [Cupriavidus metallidurans CH34]
 gi|166227371|sp|Q1LLW8|RS6_RALME RecName: Full=30S ribosomal protein S6
 gi|93354769|gb|ABF08858.1| 30S ribosomal subunit protein S6 [Cupriavidus metallidurans CH34]
          Length = 124

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 61/121 (50%), Gaps = 1/121 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+ L+    G++  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKQLVTSQNGQIHRVEDWGRRQMAYMIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI      + E++   + ++ VLR L +     E +P+  ++   R++         
Sbjct: 60  VCLNIECGKDTLAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKEVQREEARKAAQTTT 119

Query: 121 N 121
            
Sbjct: 120 E 120


>gi|254467837|ref|ZP_05081243.1| ribosomal protein S6 [beta proteobacterium KB13]
 gi|207086647|gb|EDZ63930.1| ribosomal protein S6 [beta proteobacterium KB13]
          Length = 128

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 60/110 (54%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +YQ+L++ N G +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFIVHPD-QSEQVPAMIERYQTLLKTNSGNIHRLEDWGRRQLAYPIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MNI      + E++   + ++ VLR LT    +   +P+  ++     
Sbjct: 60  VLMNIECDQKTLEELETSFKFNDAVLRHLTFATKNAVTAPSPMMKEEKSK 109


>gi|222148136|ref|YP_002549093.1| 30S ribosomal protein S6 [Agrobacterium vitis S4]
 gi|254765216|sp|B9JUU2|RS6_AGRVS RecName: Full=30S ribosomal protein S6
 gi|221735124|gb|ACM36087.1| 30S ribosomal protein S6 [Agrobacterium vitis S4]
          Length = 153

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 53/106 (50%), Positives = 82/106 (77%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S+QQ+   + QY+ +I+ NGG+V  V   G++++ YRI KNRKA+Y
Sbjct: 1   MALYEHVFLARQDMSAQQVDALVEQYKGVIEANGGKVGRVENWGLKSLTYRINKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             M+I +P AA+HE++R+MRI+E+VLR +T+ V++HE+ P+  +Q+
Sbjct: 61  ALMDIDAPAAAVHEVERQMRINEDVLRYMTIAVEAHEEGPSAMMQK 106


>gi|325292470|ref|YP_004278334.1| 30S ribosomal protein S6 [Agrobacterium sp. H13-3]
 gi|325060323|gb|ADY64014.1| 30S ribosomal protein S6 [Agrobacterium sp. H13-3]
          Length = 153

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 81/106 (76%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+FL RQDIS+QQ+   + QY+ +I+  GG+V  V   G++++ YRI+KNRKA+Y
Sbjct: 1   MALYEHIFLARQDISAQQVDALVEQYKGVIESFGGKVGRVENWGLKSLTYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             M+I +P  AIHE++R+MRI+E+VLR +T+ V++HE+ P+  +Q+
Sbjct: 61  ALMDIDAPAPAIHEIERQMRINEDVLRYMTIAVEAHEEGPSAMMQK 106


>gi|297538626|ref|YP_003674395.1| 30S ribosomal protein S6 [Methylotenera sp. 301]
 gi|297257973|gb|ADI29818.1| ribosomal protein S6 [Methylotenera sp. 301]
          Length = 132

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 60/108 (55%), Gaps = 1/108 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++LI  +GG V  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYELVFIVHPD-QSEQVPAMIERYRTLITASGGAVHRLEDWGRRQLAYPIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
           V MNI      + E++   + ++ VLR L +   +   +P+  ++   
Sbjct: 60  VLMNIECNLEVLAELEHGFKFNDAVLRHLLMSKKTAVTAPSPMMKEEK 107


>gi|149184752|ref|ZP_01863070.1| ribosomal protein S6 [Erythrobacter sp. SD-21]
 gi|148832072|gb|EDL50505.1| ribosomal protein S6 [Erythrobacter sp. SD-21]
          Length = 121

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 46/121 (38%), Positives = 80/121 (66%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S  Q+         +++ N G+V      G++ +AY+I +NRKA++
Sbjct: 1   MALYEHVFLARQDLSQAQVDQLAATATEIVEANDGKVTKTETWGLKNLAYKIDRNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI  P A + E++R+ RI+E+V+R +T+ VD HE+ P++ +++++RD +  +   +R
Sbjct: 61  VMLNIEGPGAVVAELERQTRINEDVIRYMTIRVDEHEEGPSVMMRKNERDSKKRKDREER 120

Query: 121 N 121
           N
Sbjct: 121 N 121


>gi|159184610|ref|NP_529003.1| 30S ribosomal protein S6 [Agrobacterium tumefaciens str. C58]
 gi|24212301|sp|Q8UGE7|RS6_AGRT5 RecName: Full=30S ribosomal protein S6
 gi|17739486|gb|AAL42104.1| 30S ribosomal protein S6 [Agrobacterium tumefaciens str. C58]
          Length = 153

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 82/106 (77%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+FL RQDIS+QQ+   + QY+ +I+  GG+V  V   G++++ YRI+KNRKA+Y
Sbjct: 1   MALYEHIFLARQDISAQQVDALVEQYKGVIESFGGKVGRVENWGLKSLTYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             M+I +P AA+HE++R+MRI+E+VLR +T+ V++HE+ P+  +Q+
Sbjct: 61  ALMDIDAPAAAVHEVERQMRINEDVLRYMTIAVEAHEEGPSAMMQK 106


>gi|307132414|ref|YP_003884430.1| 30S ribosomal subunit protein S6 [Dickeya dadantii 3937]
 gi|306529943|gb|ADM99873.1| 30S ribosomal subunit protein S6 [Dickeya dadantii 3937]
          Length = 130

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITGAEGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ V+RS+ + V       +  ++  D          + 
Sbjct: 60  VLMNVEAPQEVIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERRDEYAEA 119

Query: 121 NVDRKQHVSEE 131
           + D +   SEE
Sbjct: 120 DDDAEVGDSEE 130


>gi|311281254|ref|YP_003943485.1| ribosomal protein S6 [Enterobacter cloacae SCF1]
 gi|308750449|gb|ADO50201.1| ribosomal protein S6 [Enterobacter cloacae SCF1]
          Length = 131

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 66/132 (50%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITAAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +    I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLLNVEASQEVIDELETNFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D     SEE
Sbjct: 120 TADDADAGDSEE 131


>gi|294788328|ref|ZP_06753571.1| ribosomal protein S6 [Simonsiella muelleri ATCC 29453]
 gi|294483759|gb|EFG31443.1| ribosomal protein S6 [Simonsiella muelleri ATCC 29453]
          Length = 127

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVNAMVERYKTMITEAGGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MNI + PA + E++   R ++ VLR LT+   S     +  ++     
Sbjct: 60  VLMNIEATPATVDELETAFRFNDAVLRHLTIQTKSAITEASPMMREEKSK 109


>gi|149191591|ref|ZP_01869836.1| 30S ribosomal protein S6 [Vibrio shilonii AK1]
 gi|148834549|gb|EDL51541.1| 30S ribosomal protein S6 [Vibrio shilonii AK1]
          Length = 126

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 63/127 (49%), Gaps = 1/127 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E  G V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEANGTVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P  AI E++   R ++ VLR++ +   +    P++ +++ +          + 
Sbjct: 60  VLMNVEAPQEAIDELETAFRFNDAVLRNMIMRTKAAITEPSIMLKQKEERAPRREERTEA 119

Query: 121 NVDRKQH 127
             +    
Sbjct: 120 KPEAAAE 126


>gi|59801012|ref|YP_207724.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae FA 1090]
 gi|239999183|ref|ZP_04719107.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae 35/02]
 gi|240016351|ref|ZP_04722891.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae FA6140]
 gi|240115918|ref|ZP_04729980.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae PID18]
 gi|240118216|ref|ZP_04732278.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae PID1]
 gi|240123764|ref|ZP_04736720.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae PID332]
 gi|240125955|ref|ZP_04738841.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae SK-92-679]
 gi|254493954|ref|ZP_05107125.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae 1291]
 gi|260440267|ref|ZP_05794083.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae DGI2]
 gi|268595013|ref|ZP_06129180.1| ribosomal protein S6 [Neisseria gonorrhoeae 35/02]
 gi|268601588|ref|ZP_06135755.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae PID18]
 gi|268603927|ref|ZP_06138094.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae PID1]
 gi|268682390|ref|ZP_06149252.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae PID332]
 gi|268684548|ref|ZP_06151410.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae SK-92-679]
 gi|291043561|ref|ZP_06569277.1| ribosomal protein S6 [Neisseria gonorrhoeae DGI2]
 gi|3122818|sp|O07813|RS6_NEIGO RecName: Full=30S ribosomal protein S6
 gi|75432531|sp|Q5F925|RS6_NEIG1 RecName: Full=30S ribosomal protein S6
 gi|2196757|gb|AAB61228.1| ribosomal protein S6 [Neisseria gonorrhoeae]
 gi|59717907|gb|AAW89312.1| putative 30S ribosomal protein S6 [Neisseria gonorrhoeae FA 1090]
 gi|226512994|gb|EEH62339.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae 1291]
 gi|268548402|gb|EEZ43820.1| ribosomal protein S6 [Neisseria gonorrhoeae 35/02]
 gi|268585719|gb|EEZ50395.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae PID18]
 gi|268588058|gb|EEZ52734.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae PID1]
 gi|268622674|gb|EEZ55074.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae PID332]
 gi|268624832|gb|EEZ57232.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae SK-92-679]
 gi|291012024|gb|EFE04013.1| ribosomal protein S6 [Neisseria gonorrhoeae DGI2]
          Length = 122

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVGELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|15640393|ref|NP_230020.1| 30S ribosomal protein S6 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121590972|ref|ZP_01678292.1| ribosomal protein S6 [Vibrio cholerae 2740-80]
 gi|121730195|ref|ZP_01682585.1| ribosomal protein S6 [Vibrio cholerae V52]
 gi|147675449|ref|YP_001218635.1| 30S ribosomal protein S6 [Vibrio cholerae O395]
 gi|153216649|ref|ZP_01950556.1| ribosomal protein S6 [Vibrio cholerae 1587]
 gi|153820255|ref|ZP_01972922.1| ribosomal protein S6 [Vibrio cholerae NCTC 8457]
 gi|153827636|ref|ZP_01980303.1| ribosomal protein S6 [Vibrio cholerae MZO-2]
 gi|153830466|ref|ZP_01983133.1| ribosomal protein S6 [Vibrio cholerae 623-39]
 gi|227080578|ref|YP_002809129.1| ribosomal protein S6 [Vibrio cholerae M66-2]
 gi|229504949|ref|ZP_04394460.1| SSU ribosomal protein S6p [Vibrio cholerae BX 330286]
 gi|229508613|ref|ZP_04398109.1| SSU ribosomal protein S6p [Vibrio cholerae B33]
 gi|229512614|ref|ZP_04402084.1| SSU ribosomal protein S6p [Vibrio cholerae TMA 21]
 gi|229516025|ref|ZP_04405476.1| SSU ribosomal protein S6p [Vibrio cholerae RC9]
 gi|229519927|ref|ZP_04409358.1| SSU ribosomal protein S6p [Vibrio cholerae TM 11079-80]
 gi|229525060|ref|ZP_04414465.1| SSU ribosomal protein S6p [Vibrio cholerae bv. albensis VL426]
 gi|229526941|ref|ZP_04416338.1| SSU ribosomal protein S6p [Vibrio cholerae 12129(1)]
 gi|229606353|ref|YP_002877001.1| 30S ribosomal protein S6 [Vibrio cholerae MJ-1236]
 gi|254286210|ref|ZP_04961169.1| ribosomal protein S6 [Vibrio cholerae AM-19226]
 gi|254851677|ref|ZP_05241027.1| 30S ribosomal protein S6 [Vibrio cholerae MO10]
 gi|255747164|ref|ZP_05421107.1| SSU ribosomal protein S6p [Vibrio cholera CIRS 101]
 gi|262166876|ref|ZP_06034598.1| SSU ribosomal protein S6p [Vibrio cholerae RC27]
 gi|297582250|ref|ZP_06944165.1| ribosomal protein S6 [Vibrio cholerae RC385]
 gi|298501263|ref|ZP_07011061.1| ribosomal protein S6 [Vibrio cholerae MAK 757]
 gi|13959535|sp|Q9KUZ2|RS6_VIBCH RecName: Full=30S ribosomal protein S6
 gi|189045594|sp|A5F3K3|RS6_VIBC3 RecName: Full=30S ribosomal protein S6
 gi|254765463|sp|C3LR98|RS6_VIBCM RecName: Full=30S ribosomal protein S6
 gi|9654783|gb|AAF93539.1| ribosomal protein S6 [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121547198|gb|EAX57325.1| ribosomal protein S6 [Vibrio cholerae 2740-80]
 gi|121628053|gb|EAX60598.1| ribosomal protein S6 [Vibrio cholerae V52]
 gi|124114160|gb|EAY32980.1| ribosomal protein S6 [Vibrio cholerae 1587]
 gi|126509206|gb|EAZ71800.1| ribosomal protein S6 [Vibrio cholerae NCTC 8457]
 gi|146317332|gb|ABQ21871.1| ribosomal protein S6 [Vibrio cholerae O395]
 gi|148874068|gb|EDL72203.1| ribosomal protein S6 [Vibrio cholerae 623-39]
 gi|149737886|gb|EDM52791.1| ribosomal protein S6 [Vibrio cholerae MZO-2]
 gi|150423625|gb|EDN15567.1| ribosomal protein S6 [Vibrio cholerae AM-19226]
 gi|227008466|gb|ACP04678.1| ribosomal protein S6 [Vibrio cholerae M66-2]
 gi|227012222|gb|ACP08432.1| ribosomal protein S6 [Vibrio cholerae O395]
 gi|229335553|gb|EEO01033.1| SSU ribosomal protein S6p [Vibrio cholerae 12129(1)]
 gi|229338641|gb|EEO03658.1| SSU ribosomal protein S6p [Vibrio cholerae bv. albensis VL426]
 gi|229343055|gb|EEO08042.1| SSU ribosomal protein S6p [Vibrio cholerae TM 11079-80]
 gi|229346928|gb|EEO11895.1| SSU ribosomal protein S6p [Vibrio cholerae RC9]
 gi|229350396|gb|EEO15346.1| SSU ribosomal protein S6p [Vibrio cholerae TMA 21]
 gi|229354381|gb|EEO19308.1| SSU ribosomal protein S6p [Vibrio cholerae B33]
 gi|229358007|gb|EEO22923.1| SSU ribosomal protein S6p [Vibrio cholerae BX 330286]
 gi|229369008|gb|ACQ59431.1| SSU ribosomal protein S6p [Vibrio cholerae MJ-1236]
 gi|254847382|gb|EET25796.1| 30S ribosomal protein S6 [Vibrio cholerae MO10]
 gi|255735213|gb|EET90615.1| SSU ribosomal protein S6p [Vibrio cholera CIRS 101]
 gi|262024706|gb|EEY43385.1| SSU ribosomal protein S6p [Vibrio cholerae RC27]
 gi|297533508|gb|EFH72354.1| ribosomal protein S6 [Vibrio cholerae RC385]
 gi|297540017|gb|EFH76080.1| ribosomal protein S6 [Vibrio cholerae MAK 757]
          Length = 122

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 67/123 (54%), Gaps = 1/123 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +  A + E++   R ++ VLR++ +   +    P++ ++  +   + D    D 
Sbjct: 60  VLMNVEADQAVVDELETAFRFNDAVLRNMIMRTKAAITEPSIMLKAREERVKRDEMKFDA 119

Query: 121 NVD 123
           +V+
Sbjct: 120 DVE 122


>gi|85058323|ref|YP_454025.1| 30S ribosomal protein S6 [Sodalis glossinidius str. 'morsitans']
 gi|123520151|sp|Q2NW55|RS6_SODGM RecName: Full=30S ribosomal protein S6
 gi|84778843|dbj|BAE73620.1| 30S ribosomal protein S6 [Sodalis glossinidius str. 'morsitans']
          Length = 131

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F++  D  S+Q+   I +Y +LI    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIIFMVHPD-QSEQVAGMIERYSALITGAEGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P   I E++   R ++ V+RS+ + V       +  ++ + +R +R + F  +
Sbjct: 60  VLLNVEAPQEVIDELETVFRFNDAVIRSMIMRVKHAVTEASPMVKAKDERRERREDFATE 119

Query: 120 RNVDRKQHVSEE 131
            N D     SEE
Sbjct: 120 TNEDSDAGDSEE 131


>gi|83749659|ref|ZP_00946640.1| SSU ribosomal protein S6P [Ralstonia solanacearum UW551]
 gi|187928271|ref|YP_001898758.1| 30S ribosomal protein S6 [Ralstonia pickettii 12J]
 gi|207723261|ref|YP_002253660.1| 30s ribosomal protein s6 [Ralstonia solanacearum MolK2]
 gi|207743344|ref|YP_002259736.1| 30s ribosomal protein s6 [Ralstonia solanacearum IPO1609]
 gi|241662844|ref|YP_002981204.1| 30S ribosomal protein S6 [Ralstonia pickettii 12D]
 gi|309782230|ref|ZP_07676959.1| ribosomal protein S6 [Ralstonia sp. 5_7_47FAA]
 gi|226695118|sp|B2UAG4|RS6_RALPJ RecName: Full=30S ribosomal protein S6
 gi|83723661|gb|EAP70858.1| SSU ribosomal protein S6P [Ralstonia solanacearum UW551]
 gi|187725161|gb|ACD26326.1| ribosomal protein S6 [Ralstonia pickettii 12J]
 gi|206588459|emb|CAQ35422.1| 30s ribosomal protein s6 [Ralstonia solanacearum MolK2]
 gi|206594741|emb|CAQ61668.1| 30s ribosomal protein s6 [Ralstonia solanacearum IPO1609]
 gi|240864871|gb|ACS62532.1| ribosomal protein S6 [Ralstonia pickettii 12D]
 gi|308919001|gb|EFP64669.1| ribosomal protein S6 [Ralstonia sp. 5_7_47FAA]
          Length = 122

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/106 (32%), Positives = 59/106 (55%), Gaps = 1/106 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+S +   GG+V  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKSTVTSQGGQVHRVEDWGRRQLAYMIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI      + E++   + ++ VLR L +     E +P+  ++ 
Sbjct: 60  VCLNIECGKETLAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKE 105


>gi|257093838|ref|YP_003167479.1| 30S ribosomal protein S6 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257046362|gb|ACV35550.1| ribosomal protein S6 [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
          Length = 128

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 58/110 (52%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V ++  D  S+Q+   I +Y++LI    G++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVLIVHPD-QSEQVPAMIDRYKTLIASRAGQIHRLEDWGRRQLAYPIQKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V +NI      + E++   + ++ +LR LT+       +P+  ++     
Sbjct: 60  VLLNIECDNTTLAELEHGFKFNDAILRHLTIKTKRAVTTPSPMMKDEKSK 109


>gi|329119368|ref|ZP_08248054.1| 30S ribosomal protein S6 [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464513|gb|EGF10812.1| 30S ribosomal protein S6 [Neisseria bacilliformis ATCC BAA-1200]
          Length = 122

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 61/111 (54%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y++L+ EN G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKALVTENNGVIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + PA I E++   R ++ VLR LT+         +  ++     +
Sbjct: 60  VLMNIETTPAVIEELETGFRFNDAVLRHLTIQTKHAVTEASPMMKEEKSKN 110


>gi|251788411|ref|YP_003003132.1| 30S ribosomal protein S6 [Dickeya zeae Ech1591]
 gi|271501891|ref|YP_003334917.1| 30S ribosomal protein S6 [Dickeya dadantii Ech586]
 gi|247537032|gb|ACT05653.1| ribosomal protein S6 [Dickeya zeae Ech1591]
 gi|270345446|gb|ACZ78211.1| ribosomal protein S6 [Dickeya dadantii Ech586]
          Length = 130

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 64/131 (48%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITAAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P   I E++   R ++ V+RS+ + V       +  ++  D          + 
Sbjct: 60  VLLNVEAPQEVIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERRDEYAEA 119

Query: 121 NVDRKQHVSEE 131
           + D +   SEE
Sbjct: 120 DDDAEVGDSEE 130


>gi|222085436|ref|YP_002543966.1| ribosomal protein S6 [Agrobacterium radiobacter K84]
 gi|254765215|sp|B9JCB9|RS6_AGRRK RecName: Full=30S ribosomal protein S6
 gi|221722884|gb|ACM26040.1| ribosomal protein S6 [Agrobacterium radiobacter K84]
          Length = 150

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 54/106 (50%), Positives = 81/106 (76%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDIS+QQ+   + QY+ +I+ NGG+V  +   G++++ YRI+KNRKA+Y
Sbjct: 1   MALYEHVFLARQDISAQQVDALVEQYKGVIEANGGKVGRIENWGLKSLTYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             M+I +P AA+HEM+R+MRI E+VLR +T+ V+ HE+ P+  +Q+
Sbjct: 61  ALMDIDAPAAAVHEMERQMRISEDVLRYMTIAVEKHEEGPSAMMQK 106


>gi|319407055|emb|CBI80692.1| 30S ribosomal protein S6 [Bartonella sp. 1-1C]
          Length = 135

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 81/110 (73%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+FL RQDI+ QQI + +  Y+ +I+ NGG+V  +   G+R++AYRIRKNRKAYY
Sbjct: 1   MALYEHIFLARQDIAPQQIDELLETYKGVIEANGGKVGRIENWGLRSLAYRIRKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V +NI +P + I E++R+MRI+E++LR +T+ V+ HE+  +  +   +RD
Sbjct: 61  VLVNIDAPASTIAELERQMRINEDILRYMTVRVEKHEKEQSTALSSLNRD 110


>gi|15964891|ref|NP_385244.1| 30S ribosomal protein S6 [Sinorhizobium meliloti 1021]
 gi|307300962|ref|ZP_07580731.1| ribosomal protein S6 [Sinorhizobium meliloti BL225C]
 gi|307322232|ref|ZP_07601600.1| ribosomal protein S6 [Sinorhizobium meliloti AK83]
 gi|24212320|sp|Q92QZ7|RS6_RHIME RecName: Full=30S ribosomal protein S6
 gi|15074070|emb|CAC45717.1| Putative 30S ribosomal protein S6 [Sinorhizobium meliloti 1021]
 gi|306892119|gb|EFN22937.1| ribosomal protein S6 [Sinorhizobium meliloti AK83]
 gi|306903917|gb|EFN34503.1| ribosomal protein S6 [Sinorhizobium meliloti BL225C]
          Length = 149

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 53/106 (50%), Positives = 80/106 (75%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDI+ QQ+   + QY+ +I+ NGG+V  V   G++++ YRI+KNRKA+Y
Sbjct: 1   MALYEHVFLARQDITPQQVDALVEQYKGVIEANGGKVGRVENWGLKSLTYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V M+I +P  A+HE++R+MRI+E+VLR +T+ V  HE+ P+  +Q+
Sbjct: 61  VLMDIDAPAPAVHEVERQMRINEDVLRYMTIAVGKHEEGPSAMMQK 106


>gi|260773679|ref|ZP_05882595.1| SSU ribosomal protein S6p [Vibrio metschnikovii CIP 69.14]
 gi|260612818|gb|EEX38021.1| SSU ribosomal protein S6p [Vibrio metschnikovii CIP 69.14]
          Length = 122

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 65/123 (52%), Gaps = 1/123 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGTVHRLEDWGRRQMAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +  A I E++   R ++ VLR++ +   +    P++ ++  D   + +    + 
Sbjct: 60  VLMNVEADQAVIDELETAFRFNDAVLRNMIMRTKAAITEPSIMLKARDERSKREEVKFEA 119

Query: 121 NVD 123
           + +
Sbjct: 120 DAE 122


>gi|198284527|ref|YP_002220848.1| 30S ribosomal protein S6 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666120|ref|YP_002427194.1| ribosomal protein S6 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226703409|sp|B7J917|RS6_ACIF2 RecName: Full=30S ribosomal protein S6
 gi|226703410|sp|B5EPA0|RS6_ACIF5 RecName: Full=30S ribosomal protein S6
 gi|198249048|gb|ACH84641.1| ribosomal protein S6 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518333|gb|ACK78919.1| ribosomal protein S6 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 134

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 69/134 (51%), Gaps = 3/134 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y+ +I+ +GG    + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPQMIERYRGMIESDGGHFHRLEDWGRRQLAYPIKKAHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI     A+ E++   R ++ VLR L L  D    SP+   +  D  DR +R     
Sbjct: 60  VLMNIECSSVALAELEDAFRFNDAVLRHLILARDEAVTSPSFLAR--DETDRRERSEETA 117

Query: 121 NVDRKQHVSEEKPL 134
             + +   S  + +
Sbjct: 118 EGEGEPDHSANEAV 131


>gi|152997468|ref|YP_001342303.1| 30S ribosomal protein S6 [Marinomonas sp. MWYL1]
 gi|189045475|sp|A6W0Y9|RS6_MARMS RecName: Full=30S ribosomal protein S6
 gi|150838392|gb|ABR72368.1| ribosomal protein S6 [Marinomonas sp. MWYL1]
          Length = 134

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 44/132 (33%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y +LI E+GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPAMVERYTNLITEDGGQVHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPR-D 119
           V MNI    + + E+    R ++ ++R+L +         +       R+DR     R +
Sbjct: 60  VLMNIECSDSVLSELNDTFRYNDAIIRNLVIRRKEAVTDVSPIKASEGREDRRSAPQREE 119

Query: 120 RNVDRKQHVSEE 131
           RN D    VSEE
Sbjct: 120 RNHDNSDEVSEE 131


>gi|209750014|gb|ACI73314.1| 30S ribosomal subunit protein S6 [Escherichia coli]
          Length = 131

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTRHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D +   SEE
Sbjct: 120 TADDAEAGDSEE 131


>gi|240080470|ref|ZP_04725013.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae FA19]
 gi|268596607|ref|ZP_06130774.1| ribosomal protein S6 [Neisseria gonorrhoeae FA19]
 gi|268550395|gb|EEZ45414.1| ribosomal protein S6 [Neisseria gonorrhoeae FA19]
          Length = 122

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 58/104 (55%), Gaps = 1/104 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
           V MNI + P  + E++   R ++ VLR LT+         +  +
Sbjct: 60  VLMNIETTPEVVGELETAFRFNDAVLRHLTIKTKHAVTEASPML 103


>gi|27364781|ref|NP_760309.1| 30S ribosomal protein S6 [Vibrio vulnificus CMCP6]
 gi|161486597|ref|NP_935777.2| 30S ribosomal protein S6 [Vibrio vulnificus YJ016]
 gi|320155175|ref|YP_004187554.1| 30S ribosomal protein S6p [Vibrio vulnificus MO6-24/O]
 gi|31340389|sp|Q8DCL6|RS6_VIBVU RecName: Full=30S ribosomal protein S6
 gi|61216263|sp|Q7MH88|RS6_VIBVY RecName: Full=30S ribosomal protein S6
 gi|27360926|gb|AAO09836.1| ribosomal protein S6 [Vibrio vulnificus CMCP6]
 gi|319930487|gb|ADV85351.1| SSU ribosomal protein S6p [Vibrio vulnificus MO6-24/O]
          Length = 123

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MN+ +  A I E++   R ++ VLR++ +   +    P++ +++ +  
Sbjct: 60  VLMNVEADQAVIDELETAFRYNDAVLRNMIMRTKAAITEPSIMLKQKEER 109


>gi|16125915|ref|NP_420479.1| 30S ribosomal protein S6 [Caulobacter crescentus CB15]
 gi|221234678|ref|YP_002517114.1| 30S ribosomal protein S6 [Caulobacter crescentus NA1000]
 gi|24212335|sp|Q9A7Q1|RS6_CAUCR RecName: Full=30S ribosomal protein S6
 gi|254765228|sp|B8GVN6|RS6_CAUCN RecName: Full=30S ribosomal protein S6
 gi|13423077|gb|AAK23647.1| ribosomal protein S6 [Caulobacter crescentus CB15]
 gi|220963850|gb|ACL95206.1| SSU ribosomal protein S6P [Caulobacter crescentus NA1000]
          Length = 126

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 49/119 (41%), Positives = 75/119 (63%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YEHV + RQDIS QQ +    Q ++LI+ENGG +  +   G+R + YRI+KNRK +Y
Sbjct: 1   MAFYEHVVIARQDISPQQAEALNEQLKALIEENGGHIAKIEYWGLRNLTYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
             + I +P  A+ EM+R++ I+E+VLR +T+ V+  +   +  + R DR DR +R   D
Sbjct: 61  SLLAIDAPAPAVKEMERQLLINEDVLRFMTIRVEELDLELSPVLARRDRGDRPERPRED 119


>gi|113868255|ref|YP_726744.1| 30S ribosomal protein S6 [Ralstonia eutropha H16]
 gi|194289923|ref|YP_002005830.1| 30S ribosomal protein s6 [Cupriavidus taiwanensis LMG 19424]
 gi|123032891|sp|Q0K9E5|RS6_RALEH RecName: Full=30S ribosomal protein S6
 gi|226703447|sp|B3R2P7|RS6_CUPTR RecName: Full=30S ribosomal protein S6
 gi|113527031|emb|CAJ93376.1| SSU ribosomal protein S6 [Ralstonia eutropha H16]
 gi|193223758|emb|CAQ69765.1| 30S ribosomal subunit protein S6 [Cupriavidus taiwanensis LMG
           19424]
          Length = 124

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+ L+    G V  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKQLVTSQNGNVHRVEDWGRRQMAYMIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI      + E++   + ++ VLR L +     E +P+  ++   R++         
Sbjct: 60  VCLNIECGKETLAELEHAFKFNDAVLRHLIVQTKKAETAPSPMMKEVQREEARKAAQTTT 119

Query: 121 NVDRK 125
                
Sbjct: 120 EGQAA 124


>gi|34499095|ref|NP_903310.1| 30S ribosomal protein S6 [Chromobacterium violaceum ATCC 12472]
 gi|61215686|sp|Q7NRY7|RS6_CHRVO RecName: Full=30S ribosomal protein S6
 gi|34104946|gb|AAQ61302.1| 30S ribosomal protein S6 [Chromobacterium violaceum ATCC 12472]
          Length = 124

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 61/120 (50%), Gaps = 1/120 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+ ++    G++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYKGMVLAAEGKIHRLEDWGRRQLAYPIQKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+      + E++   + ++ VLR LT+ +D      +  ++     +  D  P   
Sbjct: 60  VLMNVECQAETLAEIEHAFKFNDAVLRHLTIKMDRAISDASPMMKDEKAKNLLDAQPAAE 119


>gi|294669618|ref|ZP_06734685.1| hypothetical protein NEIELOOT_01519 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308531|gb|EFE49774.1| hypothetical protein NEIELOOT_01519 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 121

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 62/111 (55%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y++L+ EN G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKALVTENNGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + PA I E++   R ++ VLR LT+         +  ++     +
Sbjct: 60  VLMNIEATPAVIEELETGFRFNDAVLRHLTIQTKHAVTDASPMMKEEKSKN 110


>gi|133976|sp|P02358|RS6_ECOLI RecName: Full=30S ribosomal protein S6; Contains: RecName: Full=30S
           ribosomal protein S6, fully modified isoform; Contains:
           RecName: Full=30S ribosomal protein S6, non-modified
           isoform
 gi|33357883|pdb|1P6G|F Chain F, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 gi|33357960|pdb|1P87|F Chain F, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 gi|83754044|pdb|2AVY|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|83754100|pdb|2AW7|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 gi|116666553|pdb|1VS5|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|116666605|pdb|1VS7|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|118138058|pdb|2I2P|F Chain F, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|118138129|pdb|2I2U|F Chain F, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 gi|157836028|pdb|2QOU|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The First 70s Ribosome,
           With Spectinomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|157836079|pdb|2QOW|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The Second 70s
           Ribosome, With Spectinomycin Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 gi|157836132|pdb|2QOY|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|157836183|pdb|2QP0|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 gi|158429703|pdb|2QAL|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429755|pdb|2QAN|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429813|pdb|2QB9|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 gi|158429865|pdb|2QBB|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429917|pdb|2QBD|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           First 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158429969|pdb|2QBF|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 gi|158430023|pdb|2QBH|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The First 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158430076|pdb|2QBJ|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The Second 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431376|pdb|2Z4K|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The First 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|158431429|pdb|2Z4M|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The Second 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 gi|168988793|pdb|2VHO|F Chain F, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 3 Of 4)
 gi|168988814|pdb|2VHP|F Chain F, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 4 Of 4)
 gi|197107283|pdb|3DF1|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|197107335|pdb|3DF3|F Chain F, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 gi|256032368|pdb|3E1A|T Chain T, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Pre-Accommodation State
 gi|256032425|pdb|3E1C|T Chain T, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Post-Accommodation State
 gi|257097327|pdb|3I1M|F Chain F, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097379|pdb|3I1O|F Chain F, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097431|pdb|3I1Q|F Chain F, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097485|pdb|3I1S|F Chain F, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097539|pdb|3I1Z|F Chain F, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|257097594|pdb|3I21|F Chain F, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 gi|290560312|pdb|3KC4|F Chain F, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
           Ribosomal Subnit. The 50s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kcr
 gi|308198692|pdb|3OR9|F Chain F, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The First
           70s Ribosome.
 gi|308198713|pdb|3ORA|F Chain F, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|326634284|pdb|3IZV|J Chain J, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
           Ef-Tu
 gi|326634309|pdb|3IZW|J Chain J, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding.This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A Cognate
           Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 gi|329665997|pdb|3J00|F Chain F, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
          Length = 135

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/130 (28%), Positives = 67/130 (51%), Gaps = 2/130 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVDRKQHVS 129
              D +   S
Sbjct: 120 TADDAEAGDS 129


>gi|227821460|ref|YP_002825430.1| 30S ribosomal protein S6 [Sinorhizobium fredii NGR234]
 gi|254765448|sp|C3M9B1|RS6_RHISN RecName: Full=30S ribosomal protein S6
 gi|227340459|gb|ACP24677.1| 30S ribosomal protein S6 [Sinorhizobium fredii NGR234]
          Length = 149

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 81/106 (76%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDI+ QQ+   + QY+ +++ NGG+V  V   G++++ YRI+KNRKA+Y
Sbjct: 1   MALYEHVFLARQDITPQQVDALVEQYKGVLEANGGKVGRVENWGLKSLTYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V M+I +P  A+HE++R+MRI+E++LR +T+ V+ HE+ P+  +Q+
Sbjct: 61  VLMDIDAPAPAVHEVERQMRINEDILRYMTIAVEKHEEGPSAMMQK 106


>gi|212633589|ref|YP_002310114.1| 30S ribosomal protein S6 [Shewanella piezotolerans WP3]
 gi|226695131|sp|B8CIQ1|RS6_SHEPW RecName: Full=30S ribosomal protein S6
 gi|212555073|gb|ACJ27527.1| Ribosomal protein S6 [Shewanella piezotolerans WP3]
          Length = 137

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 68/134 (50%), Gaps = 2/134 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y  ++ + GG++  + + G R +AY I +  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPGMIERYTGILTQAGGQIHRLEDWGRRQLAYPIIELHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +   ++ E++   R ++ VLRS+ +   +     +   + + +RD R     R 
Sbjct: 60  VLMNVETTAESVEELETAFRFNDAVLRSMVMRTKAAITEASPMAKAKDERDTRRSSEERA 119

Query: 120 RNVDRKQHVSEEKP 133
              +  + V E   
Sbjct: 120 PRAEATEEVKESAE 133


>gi|163797516|ref|ZP_02191467.1| Ribosomal protein S6 [alpha proteobacterium BAL199]
 gi|159177265|gb|EDP61824.1| Ribosomal protein S6 [alpha proteobacterium BAL199]
          Length = 158

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 75/108 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+ RQDISS Q++  I Q+  ++   GGEV+     G+R++AYRI+KNRK +Y
Sbjct: 1   MSYYESVFIARQDISSTQVEQLIEQFAEIVATGGGEVKKREYWGLRSLAYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
           V  N+ +P AA+ EM+R MR++E++LR LT+ VD+ E+ P++ +Q   
Sbjct: 61  VLFNLDAPAAAVSEMERLMRLNEDILRYLTVKVDALEEGPSVMMQAKS 108


>gi|149926826|ref|ZP_01915085.1| 30S ribosomal protein S6 [Limnobacter sp. MED105]
 gi|149824378|gb|EDM83596.1| 30S ribosomal protein S6 [Limnobacter sp. MED105]
          Length = 134

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/114 (29%), Positives = 62/114 (54%), Gaps = 1/114 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE  F++  D  S+Q+   + +Y+  I+ NGG+V    + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIAFIVHPD-QSEQVPAMVEKYRGTIEANGGKVHRHEDWGRRQLAYPIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
           V +NI      + E++   + ++ VLR LT+ +   E +P+  ++   R+    
Sbjct: 60  VLLNIECSQEVLEELETAFKFNDAVLRHLTVKMKKAETAPSPMMKEVQREQERK 113


>gi|148653437|ref|YP_001280530.1| 30S ribosomal protein S6 [Psychrobacter sp. PRwf-1]
 gi|189045489|sp|A5WFY9|RS6_PSYWF RecName: Full=30S ribosomal protein S6
 gi|148572521|gb|ABQ94580.1| SSU ribosomal protein S6P [Psychrobacter sp. PRwf-1]
          Length = 134

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 2/121 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V ++  D  S Q+   + +Y  L+Q+N G V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEVVLIVHPD-QSDQVVGMVERYIKLVQDNNGMVHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V  NI    A + E++   R ++ ++RSL +  D     P+   +  D + R  + PR  
Sbjct: 60  VLFNIECDGATLEELEELFRYNDAIIRSLVVRRDDAITEPSQLAKSAD-EKRARKAPRSE 118

Query: 121 N 121
           N
Sbjct: 119 N 119


>gi|241760375|ref|ZP_04758470.1| ribosomal protein S6 [Neisseria flavescens SK114]
 gi|319637635|ref|ZP_07992401.1| 30S ribosomal protein S6 [Neisseria mucosa C102]
 gi|241319253|gb|EER55731.1| ribosomal protein S6 [Neisseria flavescens SK114]
 gi|317400790|gb|EFV81445.1| 30S ribosomal protein S6 [Neisseria mucosa C102]
          Length = 123

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMITEASGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|260775636|ref|ZP_05884533.1| SSU ribosomal protein S6p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608817|gb|EEX34982.1| SSU ribosomal protein S6p [Vibrio coralliilyticus ATCC BAA-450]
          Length = 126

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 1/127 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +  A I E++   R ++ VLR++ +   +     ++ +++ +          + 
Sbjct: 60  VLMNVEADQAVIDELETAFRFNDAVLRNMIMRTKAAITEQSIMLKQKEERAPRREERTEA 119

Query: 121 NVDRKQH 127
             +    
Sbjct: 120 KPEAAAE 126


>gi|239831325|ref|ZP_04679654.1| ribosomal protein S6 [Ochrobactrum intermedium LMG 3301]
 gi|239823592|gb|EEQ95160.1| ribosomal protein S6 [Ochrobactrum intermedium LMG 3301]
          Length = 160

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 54/104 (51%), Positives = 75/104 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV L RQDIS QQ+   + QY+ +++ NGG+V  V   G+R + YRI+KNRKAYY
Sbjct: 13  MALYEHVLLARQDISQQQVDALVEQYKGVLEANGGKVGKVESWGLRPLTYRIKKNRKAYY 72

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             +NI +P AA+ EM+R+MRI+E+VLR LT+ VD HE+  +  +
Sbjct: 73  TLVNIDAPAAAVAEMERQMRINEDVLRFLTVRVDEHEEGQSAML 116


>gi|261379684|ref|ZP_05984257.1| ribosomal protein S6 [Neisseria subflava NJ9703]
 gi|284797346|gb|EFC52693.1| ribosomal protein S6 [Neisseria subflava NJ9703]
          Length = 123

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|157963400|ref|YP_001503434.1| 30S ribosomal protein S6 [Shewanella pealeana ATCC 700345]
 gi|189045848|sp|A8H8L2|RS6_SHEPA RecName: Full=30S ribosomal protein S6
 gi|157848400|gb|ABV88899.1| ribosomal protein S6 [Shewanella pealeana ATCC 700345]
          Length = 137

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/118 (27%), Positives = 60/118 (50%), Gaps = 1/118 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y  ++ + GG++  + + G R +AY I +  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPGMIERYTGILTQAGGQIHRLEDWGRRQLAYPIIELHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPR 118
           V MN+ +   A+ E++   R ++ VLRS+ +   +     +   +  D  D       
Sbjct: 60  VLMNVETTAEAVEELETAFRFNDAVLRSMVMRTKAAITEASPMAKAKDERDTRRSSEE 117


>gi|83311202|ref|YP_421466.1| 30S ribosomal protein S6 [Magnetospirillum magneticum AMB-1]
 gi|123542046|sp|Q2W5G8|RS6_MAGMM RecName: Full=30S ribosomal protein S6
 gi|82946043|dbj|BAE50907.1| Ribosomal protein S6 [Magnetospirillum magneticum AMB-1]
          Length = 144

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 53/117 (45%), Positives = 78/117 (66%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE VF+ RQDIS+ Q++    +  ++I + GG V      G+R IAYR++KNRK +Y
Sbjct: 1   MSLYECVFIARQDISTPQVETLTEELSNIITQGGGSVSKKEYWGLRNIAYRVKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFP 117
           V +NI +P AA+ EM+R+M I+E+VLR+LT+ V+  E+ P+  +Q   RDDR  R  
Sbjct: 61  VLLNIDAPSAAVKEMERQMSINEDVLRTLTIRVEELEEGPSAMMQSKSRDDRPRRGE 117


>gi|126175838|ref|YP_001051987.1| 30S ribosomal protein S6 [Shewanella baltica OS155]
 gi|152999250|ref|YP_001364931.1| 30S ribosomal protein S6 [Shewanella baltica OS185]
 gi|160873863|ref|YP_001553179.1| 30S ribosomal protein S6 [Shewanella baltica OS195]
 gi|217971923|ref|YP_002356674.1| 30S ribosomal protein S6 [Shewanella baltica OS223]
 gi|304411186|ref|ZP_07392801.1| ribosomal protein S6 [Shewanella baltica OS183]
 gi|307306481|ref|ZP_07586224.1| ribosomal protein S6 [Shewanella baltica BA175]
 gi|166227381|sp|A3D8Q5|RS6_SHEB5 RecName: Full=30S ribosomal protein S6
 gi|166227382|sp|A6WJ79|RS6_SHEB8 RecName: Full=30S ribosomal protein S6
 gi|189045494|sp|A9L120|RS6_SHEB9 RecName: Full=30S ribosomal protein S6
 gi|254765452|sp|B8E9N6|RS6_SHEB2 RecName: Full=30S ribosomal protein S6
 gi|125999043|gb|ABN63118.1| SSU ribosomal protein S6P [Shewanella baltica OS155]
 gi|151363868|gb|ABS06868.1| ribosomal protein S6 [Shewanella baltica OS185]
 gi|160859385|gb|ABX47919.1| ribosomal protein S6 [Shewanella baltica OS195]
 gi|217497058|gb|ACK45251.1| ribosomal protein S6 [Shewanella baltica OS223]
 gi|304350379|gb|EFM14782.1| ribosomal protein S6 [Shewanella baltica OS183]
 gi|306910772|gb|EFN41200.1| ribosomal protein S6 [Shewanella baltica BA175]
 gi|315266090|gb|ADT92943.1| ribosomal protein S6 [Shewanella baltica OS678]
          Length = 131

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 59/129 (45%), Gaps = 1/129 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  +I E  G +  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGVITEANGTIHRLEDWGRRQLAYPILDLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +    I E++   R ++ VLR++ +         +   +  D  D       +R
Sbjct: 60  VLMNVEAKAETIEELETAFRFNDAVLRNMVMRTKVAVTEASPMAKARDERDSRRGPAGER 119

Query: 121 NVDRKQHVS 129
           + D      
Sbjct: 120 SYDEAHAEE 128


>gi|261379071|ref|ZP_05983644.1| ribosomal protein S6 [Neisseria cinerea ATCC 14685]
 gi|269144450|gb|EEZ70868.1| ribosomal protein S6 [Neisseria cinerea ATCC 14685]
          Length = 122

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|119947022|ref|YP_944702.1| ribosomal protein S6 [Psychromonas ingrahamii 37]
 gi|166227370|sp|A1T038|RS6_PSYIN RecName: Full=30S ribosomal protein S6
 gi|119865626|gb|ABM05103.1| SSU ribosomal protein S6P [Psychromonas ingrahamii 37]
          Length = 133

 Score =  128 bits (322), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 68/125 (54%), Gaps = 3/125 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I E GG V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVNGMIERYTASITEAGGTVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI +    I +++   R +++V+R++ +   +     ++  +   R++R +R PR  
Sbjct: 60  VLMNIEAGQNVIDDLENAFRFNDSVIRNMIMRTKTAVTEVSVVAKA--REERVERAPRAP 117

Query: 121 NVDRK 125
             + K
Sbjct: 118 RPEVK 122


>gi|295689695|ref|YP_003593388.1| 30S ribosomal protein S6 [Caulobacter segnis ATCC 21756]
 gi|295431598|gb|ADG10770.1| ribosomal protein S6 [Caulobacter segnis ATCC 21756]
          Length = 124

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 49/119 (41%), Positives = 75/119 (63%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YEHV + RQDIS QQ +    Q ++LI+ENGG +  +   G+R + YRI+KNRK +Y
Sbjct: 1   MAFYEHVVIARQDISPQQAEALNEQLKALIEENGGHIAKIEYWGLRNLTYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
             + I +P  A+ EM+R++ I+E+VLR +T+ V+  +   +  + R DR DR +R   D
Sbjct: 61  SLLAIDAPAPAVKEMERQLLINEDVLRFMTIRVEELDLELSPVLARRDRGDRPERPRED 119


>gi|167625581|ref|YP_001675875.1| 30S ribosomal protein S6 [Shewanella halifaxensis HAW-EB4]
 gi|189045495|sp|B0TUU9|RS6_SHEHH RecName: Full=30S ribosomal protein S6
 gi|167355603|gb|ABZ78216.1| ribosomal protein S6 [Shewanella halifaxensis HAW-EB4]
          Length = 137

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 60/116 (51%), Gaps = 1/116 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y  ++ + GG++  + + G R +AY I +  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPGMIERYTGILTQAGGQIHRLEDWGRRQLAYPIIELHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
           V +N+ +   A+ E++   R ++ VLRS+ +   +     +   +  D  D     
Sbjct: 60  VLLNVETTAEAVEELETAFRFNDAVLRSMVMRTKAAITEASPMAKAKDERDTRRSS 115


>gi|316933693|ref|YP_004108675.1| 30S ribosomal protein S6 [Rhodopseudomonas palustris DX-1]
 gi|315601407|gb|ADU43942.1| ribosomal protein S6 [Rhodopseudomonas palustris DX-1]
          Length = 158

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD S+QQ+++   Q   +I+  GG+V      G+R++ YR+ KNRKA++
Sbjct: 1   MPLYEHVFLARQDASAQQVEELTTQITGVIESLGGKVTKTESWGLRSLTYRMNKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI  P A + E++R+ RI+E+V+R LT+ VD HE+ P+  +++
Sbjct: 61  VLLNIDGPAAVVAEIERQERINEDVIRYLTVRVDEHEEGPSAMMRK 106


>gi|288958518|ref|YP_003448859.1| small subunit ribosomal protein S6 [Azospirillum sp. B510]
 gi|288910826|dbj|BAI72315.1| small subunit ribosomal protein S6 [Azospirillum sp. B510]
          Length = 146

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 48/124 (38%), Positives = 77/124 (62%), Gaps = 2/124 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE V + RQDIS+ Q +    Q+  ++++NGG +      G++T+ Y+I+KNRK +Y
Sbjct: 1   MALYECVLIARQDISAAQAEQLSEQFAQIVRDNGGTIAKSEYWGLKTLTYKIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
              NI +P AA+ EM+R M I E+VLR +T+ VD+ + +P+  +Q   R++R +R  R  
Sbjct: 61  TLFNIDAPAAAVAEMERNMSISEDVLRFMTVRVDALDANPSAMMQ--SRNERGERGERGD 118

Query: 121 NVDR 124
              R
Sbjct: 119 RGPR 122


>gi|323493031|ref|ZP_08098166.1| 30S ribosomal protein S6 [Vibrio brasiliensis LMG 20546]
 gi|323312729|gb|EGA65858.1| 30S ribosomal protein S6 [Vibrio brasiliensis LMG 20546]
          Length = 126

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 1/127 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +  A I E++   R ++ VLR++ +   +     ++ +++ +          + 
Sbjct: 60  VLMNVEADQAVIDELETAFRFNDAVLRNMIMRTKTAITEQSIMLKQKEERAPRREERAES 119

Query: 121 NVDRKQH 127
             +    
Sbjct: 120 KPEAAAE 126


>gi|121607969|ref|YP_995776.1| 30S ribosomal protein S6 [Verminephrobacter eiseniae EF01-2]
 gi|166227400|sp|A1WGK1|RS6_VEREI RecName: Full=30S ribosomal protein S6
 gi|121552609|gb|ABM56758.1| SSU ribosomal protein S6P [Verminephrobacter eiseniae EF01-2]
          Length = 141

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 62/111 (55%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + L+  D  S+Q+   + +Y+ +I   GG+V  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIILLIHPD-QSEQVPAMLERYKGMIAAGGGKVHRVEDWGRRQLAYLINKLSKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           + +NI +  A + E++   + ++ VLR LT+        P+  ++  +R++
Sbjct: 60  LCVNIEADQAVMAELEHAFKFNDAVLRHLTVHKKKAVTGPSAMMKTVEREE 110


>gi|332971479|gb|EGK10430.1| 30S ribosomal protein S6 [Psychrobacter sp. 1501(2011)]
          Length = 134

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 2/121 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V ++  D  S Q+   + +Y  L+Q+N G V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEVVLIVHPD-QSDQVVGMVERYIKLVQDNNGMVHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V  NI    A + E++   R ++ ++RSL +  D     P+   +  D + R  + PR  
Sbjct: 60  VLFNIECDGATLEELEELFRYNDAIIRSLVVRRDDAITEPSQLAKSAD-EKRARKAPRSE 118

Query: 121 N 121
           N
Sbjct: 119 N 119


>gi|220924505|ref|YP_002499807.1| 30S ribosomal protein S6 [Methylobacterium nodulans ORS 2060]
 gi|254765444|sp|B8IED2|RS6_METNO RecName: Full=30S ribosomal protein S6
 gi|219949112|gb|ACL59504.1| ribosomal protein S6 [Methylobacterium nodulans ORS 2060]
          Length = 134

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 83/110 (75%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD++SQQ++  I  Y+ +I+ NGG+V      G++++AYRI+KNRKA++
Sbjct: 1   MALYEHVFLARQDVTSQQVESMIDTYKGVIEANGGKVEKTEMWGVKSLAYRIKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
             +NI +PPAA+ EM+R+MRI E++LR LT+ V++ E  P+  +Q+ DRD
Sbjct: 61  TLLNIDAPPAALAEMERQMRISEDILRFLTIRVEALETEPSAMMQKRDRD 110


>gi|296314490|ref|ZP_06864431.1| ribosomal protein S6 [Neisseria polysaccharea ATCC 43768]
 gi|296838792|gb|EFH22730.1| ribosomal protein S6 [Neisseria polysaccharea ATCC 43768]
          Length = 122

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|262148953|ref|ZP_06028101.1| SSU ribosomal protein S6p [Vibrio cholerae INDRE 91/1]
 gi|262031264|gb|EEY49880.1| SSU ribosomal protein S6p [Vibrio cholerae INDRE 91/1]
          Length = 102

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 57/101 (56%), Gaps = 1/101 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPT 101
           V MN+ +  A + E++   R ++ VLR++ +   +    P+
Sbjct: 60  VLMNVEADQAVVDELETAFRFNDAVLRNMIMRTKAAITEPS 100


>gi|183600322|ref|ZP_02961815.1| hypothetical protein PROSTU_03884 [Providencia stuartii ATCC 25827]
 gi|188020112|gb|EDU58152.1| hypothetical protein PROSTU_03884 [Providencia stuartii ATCC 25827]
          Length = 131

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 36/132 (27%), Positives = 67/132 (50%), Gaps = 1/132 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAQGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P  AI E++   R ++ V+RS+ + V       +  ++  D     D     +
Sbjct: 60  VLMNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRSRDLADEYQ 119

Query: 121 NVDRKQHVSEEK 132
           + + ++    E+
Sbjct: 120 DEEAEEAGDSEE 131


>gi|325922528|ref|ZP_08184289.1| SSU ribosomal protein S6P [Xanthomonas gardneri ATCC 19865]
 gi|325546993|gb|EGD18086.1| SSU ribosomal protein S6P [Xanthomonas gardneri ATCC 19865]
          Length = 144

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 39/134 (29%), Positives = 68/134 (50%), Gaps = 3/134 (2%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VFL+  D  S+Q+   I +Y+SLI+   G +  + + G R +AY I+   KA+YV
Sbjct: 3   RHYEVVFLVHPD-QSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYV 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            +NI    A + E+    R ++ VLR L +  D  +   +L ++   +D++ D+  R   
Sbjct: 62  LLNIEVDQAVLSELVESFRFNDAVLRHLVVKRDGPDTEQSLIMK--SKDEKGDKPERSER 119

Query: 122 VDRKQHVSEEKPLS 135
             R     +  P +
Sbjct: 120 RRRDDDEGDAAPAA 133


>gi|212709962|ref|ZP_03318090.1| hypothetical protein PROVALCAL_01013 [Providencia alcalifaciens DSM
           30120]
 gi|212687371|gb|EEB46899.1| hypothetical protein PROVALCAL_01013 [Providencia alcalifaciens DSM
           30120]
          Length = 131

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 68/132 (51%), Gaps = 1/132 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y ++I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSAVITNAQGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P  AI E++   R ++ V+RS+ + +       +  ++  D     D     +
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRLKHAVTEASPMVKAKDERRGRDMSDDYQ 119

Query: 121 NVDRKQHVSEEK 132
           + + ++    E+
Sbjct: 120 DEEAEETGDSEE 131


>gi|329297943|ref|ZP_08255279.1| 30S ribosomal protein S6 [Plautia stali symbiont]
          Length = 131

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 66/132 (50%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++  D  S+Q+   I +Y   I    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MCHYEIVFMVHPD-QSEQVPGMIERYTGAITGAQGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P   I E++   R ++ V+RS+ + V       +  ++ + +R +R + F  +
Sbjct: 60  VLLNVEAPQEVIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERREDFANE 119

Query: 120 RNVDRKQHVSEE 131
              D     SEE
Sbjct: 120 SAEDSDAGDSEE 131


>gi|170740808|ref|YP_001769463.1| 30S ribosomal protein S6 [Methylobacterium sp. 4-46]
 gi|226703488|sp|B0UL29|RS6_METS4 RecName: Full=30S ribosomal protein S6
 gi|168195082|gb|ACA17029.1| ribosomal protein S6 [Methylobacterium sp. 4-46]
          Length = 134

 Score =  128 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 56/110 (50%), Positives = 83/110 (75%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD++SQQ++  I  Y+ +I+ NGG+V      G++++AYRI+KNRKA++
Sbjct: 1   MALYEHVFLARQDVTSQQVESMIEAYKGVIESNGGKVEKTEMWGVKSLAYRIKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
             +NI +PPAA+ EM+R+MRI E++LR LT+ VD+ E  P+  +Q+ DRD
Sbjct: 61  TLLNIDAPPAALAEMERQMRISEDILRFLTIRVDALEGEPSAMMQKRDRD 110


>gi|332527889|ref|ZP_08403926.1| 30S ribosomal protein S6 [Rubrivivax benzoatilyticus JA2]
 gi|332112466|gb|EGJ12259.1| 30S ribosomal protein S6 [Rubrivivax benzoatilyticus JA2]
          Length = 121

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 69/122 (56%), Gaps = 1/122 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S+Q+   + +Y++L+   GG+V  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVLLIHPD-QSEQVPAMLERYKTLVTAGGGKVHRVEDWGRRQLAYMIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + +NI      + E++   R ++ VLR LT+  +  E +P++ ++  +R++      ++ 
Sbjct: 60  LCLNIECDKPVLEELETGFRFNDAVLRHLTVRKEKAETTPSVMMKAVEREESRKASQQEA 119

Query: 121 NV 122
           + 
Sbjct: 120 SA 121


>gi|300721498|ref|YP_003710773.1| 30S ribosomal subunit protein S6 [Xenorhabdus nematophila ATCC
           19061]
 gi|297627990|emb|CBJ88539.1| 30S ribosomal subunit protein S6 [Xenorhabdus nematophila ATCC
           19061]
          Length = 132

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 65/133 (48%), Gaps = 1/133 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATITNAQGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P  AI E++   R ++ V+RS+ + V       +  ++  D     D    + 
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRSRDLVLEEG 119

Query: 121 NVDRKQHVSEEKP 133
            VD      + + 
Sbjct: 120 LVDDVDEAGDSEE 132


>gi|302879169|ref|YP_003847733.1| 30S ribosomal protein S6 [Gallionella capsiferriformans ES-2]
 gi|302581958|gb|ADL55969.1| ribosomal protein S6 [Gallionella capsiferriformans ES-2]
          Length = 126

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 37/130 (28%), Positives = 69/130 (53%), Gaps = 5/130 (3%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++L+   GG++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIERYRTLVTAKGGQIHRLEDWGRRQLAYAIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      + E++   R ++ VLR LT+   +    P+  ++    ++++     + 
Sbjct: 60  VLMNIECNQEILDELEHAFRFNDAVLRHLTVKTKAAVTVPSAMMK----EEKSRSVLSEE 115

Query: 121 NVDRKQHVSE 130
            V  K+   E
Sbjct: 116 VVQAKEESVE 125


>gi|240850219|ref|YP_002971612.1| 30S ribosomal protein S6 [Bartonella grahamii as4aup]
 gi|240267342|gb|ACS50930.1| 30S ribosomal protein S6 [Bartonella grahamii as4aup]
          Length = 135

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 57/135 (42%), Positives = 89/135 (65%), Gaps = 6/135 (4%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+FL RQDI+ QQ+ + +  Y+ +I+ +GG+V  +   G+R +AYRIRKNRKAYY
Sbjct: 1   MALYEHMFLARQDITPQQVDELLSLYKGVIEAHGGKVGRIENWGLRPLAYRIRKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR------DDRND 114
             +NI +P +AI E++R+MRI+E++LR +T+ V+ HE+  +  +   DR      D+   
Sbjct: 61  TLVNIDAPASAIAEVERQMRINEDILRYMTIRVEKHEKEKSAMLSHLDRNSHIGQDEERP 120

Query: 115 RFPRDRNVDRKQHVS 129
           RFPR +  +  + V 
Sbjct: 121 RFPRRQRENAIEGVE 135


>gi|261365212|ref|ZP_05978095.1| ribosomal protein S6 [Neisseria mucosa ATCC 25996]
 gi|288566474|gb|EFC88034.1| ribosomal protein S6 [Neisseria mucosa ATCC 25996]
          Length = 123

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKAMIAEASGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|298368601|ref|ZP_06979919.1| ribosomal protein S6 [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282604|gb|EFI24091.1| ribosomal protein S6 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 125

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKTKN 110


>gi|240013909|ref|ZP_04720822.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae DGI18]
 gi|240113162|ref|ZP_04727652.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae MS11]
 gi|240121478|ref|ZP_04734440.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae PID24-1]
 gi|240128467|ref|ZP_04741128.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae SK-93-1035]
 gi|268599241|ref|ZP_06133408.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae MS11]
 gi|268686858|ref|ZP_06153720.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae SK-93-1035]
 gi|293398875|ref|ZP_06643040.1| small subunit ribosomal protein S6 [Neisseria gonorrhoeae F62]
 gi|268583372|gb|EEZ48048.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae MS11]
 gi|268627142|gb|EEZ59542.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae SK-93-1035]
 gi|291610289|gb|EFF39399.1| small subunit ribosomal protein S6 [Neisseria gonorrhoeae F62]
          Length = 122

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 33/104 (31%), Positives = 58/104 (55%), Gaps = 1/104 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
           V MNI + P  + E++   R ++ VLR LT+         +  +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPML 103


>gi|163842735|ref|YP_001627139.1| 30S ribosomal protein S6 [Brucella suis ATCC 23445]
 gi|189045457|sp|B0CKD9|RS6_BRUSI RecName: Full=30S ribosomal protein S6
 gi|163673458|gb|ABY37569.1| ribosomal protein S6 [Brucella suis ATCC 23445]
          Length = 148

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 60/146 (41%), Positives = 84/146 (57%), Gaps = 19/146 (13%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV L RQDIS QQ+   + Q++ +++ NGG+   V   G+R + YRI+KNRKAYY
Sbjct: 1   MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH------------- 107
             +NI +P AA+ EM+R+MRI+E+VLR LT+ V+ HE+  +  + R              
Sbjct: 61  TLVNIDAPAAAVAEMERQMRINEDVLRFLTVRVEEHEEGQSAMLTRRDDRRERDGDDRPR 120

Query: 108 ------DRDDRNDRFPRDRNVDRKQH 127
                 DR DR DR PR    +    
Sbjct: 121 RREGGFDRGDRGDRSPRRPRDNEAGE 146


>gi|119471284|ref|ZP_01613787.1| 30S ribosomal protein S6 [Alteromonadales bacterium TW-7]
 gi|119445750|gb|EAW27033.1| 30S ribosomal protein S6 [Alteromonadales bacterium TW-7]
          Length = 113

 Score =  128 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGSIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MN+ +P   I E++   R ++ VLR+L +   S     +   +   ++
Sbjct: 60  VLMNVEAPTEVISELETTFRYNDAVLRNLVIRTKSAVTEASPLAREEKKE 109


>gi|294139214|ref|YP_003555192.1| 30S ribosomal protein S6 [Shewanella violacea DSS12]
 gi|293325683|dbj|BAJ00414.1| ribosomal protein S6 [Shewanella violacea DSS12]
          Length = 140

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 38/136 (27%), Positives = 71/136 (52%), Gaps = 2/136 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y  ++ + GG++  + + G R +AY I +  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPSMIERYTGILTQAGGQIHRLEDWGRRQLAYPIIELHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +   ++ E++   R ++ VLRS+ L   +     +   + + +RD R       
Sbjct: 60  VLMNVEASAESVEELETAFRFNDAVLRSMVLRTKAAITEASPMAKLKEERDSRRSTEGER 119

Query: 120 RNVDRKQHVSEEKPLS 135
           R+   ++ V E K  +
Sbjct: 120 RSAPAEKAVEEVKETA 135


>gi|21231017|ref|NP_636934.1| 30S ribosomal protein S6 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66768978|ref|YP_243740.1| 30S ribosomal protein S6 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|24212286|sp|Q8PAC2|RS6_XANCP RecName: Full=30S ribosomal protein S6
 gi|81305058|sp|Q4UTA3|RS6_XANC8 RecName: Full=30S ribosomal protein S6
 gi|21112641|gb|AAM40858.1| 30S ribosomal protein S6 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66574310|gb|AAY49720.1| 30S ribosomal protein S6 [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 144

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 39/134 (29%), Positives = 68/134 (50%), Gaps = 3/134 (2%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VFL+  D  S+Q+   I +Y+SLI+   G +  + + G R +AY I+   KA+YV
Sbjct: 3   RHYEVVFLVHPD-QSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYV 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            +NI    A + E+    R ++ VLR L +  D  +   +L ++   +D++ D+  R   
Sbjct: 62  LLNIEVDQAVLSELVESFRFNDAVLRHLVIKRDGPDTEQSLIMK--SKDEKGDKPERSER 119

Query: 122 VDRKQHVSEEKPLS 135
             R     +  P +
Sbjct: 120 RRRDDEEGDAAPAA 133


>gi|119383642|ref|YP_914698.1| 30S ribosomal protein S6 [Paracoccus denitrificans PD1222]
 gi|166227360|sp|A1B0F8|RS6_PARDP RecName: Full=30S ribosomal protein S6
 gi|119373409|gb|ABL69002.1| SSU ribosomal protein S6P [Paracoccus denitrificans PD1222]
          Length = 131

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + ++I +NGG+V      G+RT+AY+I KNRK +Y
Sbjct: 1   MPLYEHVLIARQDLSNAQAEGLIEHFSTVIADNGGKVVDNEYWGVRTLAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            ++   +P AA+ EM+R  R+ ++V+R LT+ VD H+  P++ +Q+
Sbjct: 61  AYLRSDAPSAAVQEMERLARLHDDVMRVLTVRVDEHKDGPSVQMQK 106


>gi|254500250|ref|ZP_05112401.1| ribosomal protein S6, putative [Labrenzia alexandrii DFL-11]
 gi|222436321|gb|EEE43000.1| ribosomal protein S6, putative [Labrenzia alexandrii DFL-11]
          Length = 154

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 77/106 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+FL RQD+S+QQ++  + QY+ LI+  GG +  V   G+RT+AYRI+KNRKA+Y
Sbjct: 1   MPLYEHIFLARQDVSAQQVETLVEQYKGLIEGAGGTIGKVENWGLRTLAYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             MNI +P AA+ EM+R+M + E+VLR +T  VD  ++ P+  +Q+
Sbjct: 61  TLMNITAPHAAVAEMERQMGLSEDVLRFMTFKVDELDEEPSAMMQK 106


>gi|306845084|ref|ZP_07477664.1| ribosomal protein S6 [Brucella sp. BO1]
 gi|306274499|gb|EFM56294.1| ribosomal protein S6 [Brucella sp. BO1]
          Length = 148

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 52/104 (50%), Positives = 74/104 (71%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV L RQDIS QQ+   + Q++ +++ NGG+   V   G+R + YRI+KNRKAYY
Sbjct: 1   MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             +NI +P AA+ EM+R+MRI+E+VLR LT+ VD HE+  +  +
Sbjct: 61  TLVNIDAPAAAVAEMERQMRINEDVLRFLTVRVDEHEEGQSAML 104


>gi|254507380|ref|ZP_05119515.1| ribosomal protein S6 [Vibrio parahaemolyticus 16]
 gi|323496052|ref|ZP_08101112.1| 30S ribosomal protein S6 [Vibrio sinaloensis DSM 21326]
 gi|219549636|gb|EED26626.1| ribosomal protein S6 [Vibrio parahaemolyticus 16]
 gi|323318796|gb|EGA71747.1| 30S ribosomal protein S6 [Vibrio sinaloensis DSM 21326]
          Length = 126

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH 107
           V MN+ +  A I E++   R ++ VLR++ +   +     ++ +++ 
Sbjct: 60  VLMNVEADQAVIDELETAFRFNDAVLRNMIMRTKTAITEQSIMLKQK 106


>gi|261345207|ref|ZP_05972851.1| ribosomal protein S6 [Providencia rustigianii DSM 4541]
 gi|282566900|gb|EFB72435.1| ribosomal protein S6 [Providencia rustigianii DSM 4541]
          Length = 131

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 68/132 (51%), Gaps = 1/132 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y ++I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSAVITNAQGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P  AI E++   R ++ V+RS+ + +       +  ++  D     D     +
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRLKHAVTEASPMVKAKDERRGRDLSDDYQ 119

Query: 121 NVDRKQHVSEEK 132
           + + ++    E+
Sbjct: 120 DEEVEEAGDSEE 131


>gi|54778759|gb|AAV39593.1| ribosomal protein S6 [synthetic construct]
          Length = 158

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 38/131 (29%), Positives = 68/131 (51%), Gaps = 2/131 (1%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+YV
Sbjct: 26  RHYEIVFMVHPD-QSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYV 84

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRDR 120
            MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  + 
Sbjct: 85  LMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANET 144

Query: 121 NVDRKQHVSEE 131
             D +   SEE
Sbjct: 145 ADDAEAGDSEE 155


>gi|326389002|ref|ZP_08210584.1| ribosomal protein S6 [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206602|gb|EGD57437.1| ribosomal protein S6 [Novosphingobium nitrogenifigens DSM 19370]
          Length = 120

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 72/108 (66%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S  Q+         +++ N G+V      G+R++AY+I+KNRKA++
Sbjct: 1   MPLYEHVFLARQDLSQSQVDALAATATEIVEANQGKVTKTETWGLRSLAYKIQKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
           V +NI +P   + E++R+  I+E+++R LT+ VD  E  P++ ++++D
Sbjct: 61  VLLNIEAPAGVVAELERQTSINEDIIRFLTVRVDELETGPSVMMRKND 108


>gi|260433336|ref|ZP_05787307.1| ribosomal protein S6 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417164|gb|EEX10423.1| ribosomal protein S6 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 139

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +NGG++      G++T+AY+I KNRK +Y
Sbjct: 23  MPLYEHVMIARQDLSNTQAEGLIEHFGTVLADNGGKLVDSEYWGVKTMAYKINKNRKGHY 82

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  A+ EM+R MR+ ++V+R LT+ VD H + P++ +Q+
Sbjct: 83  AFLKTDAPAGAVQEMERLMRLHDDVMRVLTIKVDEHAEGPSVQMQK 128


>gi|332970410|gb|EGK09402.1| 30S ribosomal protein S6 [Kingella kingae ATCC 23330]
          Length = 124

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 61/110 (55%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMITEASGKIHRLEDWGRRQLAYPINKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MNI + PA + E++   R ++ VLR LT+   +     +  ++     
Sbjct: 60  VLMNIEATPATVEELETAFRFNDAVLRHLTIQTKAAVTEASPMMREEKSK 109


>gi|226326634|ref|ZP_03802152.1| hypothetical protein PROPEN_00484 [Proteus penneri ATCC 35198]
 gi|225204855|gb|EEG87209.1| hypothetical protein PROPEN_00484 [Proteus penneri ATCC 35198]
          Length = 132

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 39/133 (29%), Positives = 66/133 (49%), Gaps = 3/133 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYKTAITNANGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR--NDRFPR 118
           V MN+ +P   I E++   R ++ VLR++ +         +  ++  D   R   D    
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVLRNMIMRTKHAVTEASPMVKAKDERRRDIADDLDG 119

Query: 119 DRNVDRKQHVSEE 131
           +  VD     SEE
Sbjct: 120 EEEVDDVAEDSEE 132


>gi|313668460|ref|YP_004048744.1| 30S ribosomal protein S6 [Neisseria lactamica ST-640]
 gi|309379252|emb|CBX22209.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313005922|emb|CBN87379.1| 30S ribosomal protein S6 [Neisseria lactamica 020-06]
          Length = 122

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|225075140|ref|ZP_03718339.1| hypothetical protein NEIFLAOT_00140 [Neisseria flavescens
           NRL30031/H210]
 gi|224953624|gb|EEG34833.1| hypothetical protein NEIFLAOT_00140 [Neisseria flavescens
           NRL30031/H210]
          Length = 123

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMIAEASGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|261401265|ref|ZP_05987390.1| ribosomal protein S6 [Neisseria lactamica ATCC 23970]
 gi|269208748|gb|EEZ75203.1| ribosomal protein S6 [Neisseria lactamica ATCC 23970]
 gi|325136174|gb|EGC58782.1| ribosomal protein S6 [Neisseria meningitidis M0579]
 gi|325201967|gb|ADY97421.1| ribosomal protein S6 [Neisseria meningitidis M01-240149]
 gi|325208282|gb|ADZ03734.1| ribosomal protein S6 [Neisseria meningitidis NZ-05/33]
          Length = 122

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|261254039|ref|ZP_05946612.1| SSU ribosomal protein S6p [Vibrio orientalis CIP 102891]
 gi|260937430|gb|EEX93419.1| SSU ribosomal protein S6p [Vibrio orientalis CIP 102891]
          Length = 126

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 59/107 (55%), Gaps = 1/107 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH 107
           V MN+ +  A I E++   R ++ VLR++ +   +     ++ +++ 
Sbjct: 60  VLMNVEAGQAVIDELETAFRFNDAVLRNMIMRTKAAITEQSIMLKQK 106


>gi|257465545|ref|ZP_05629916.1| 30S ribosomal protein S6 [Actinobacillus minor 202]
 gi|257451205|gb|EEV25248.1| 30S ribosomal protein S6 [Actinobacillus minor 202]
          Length = 123

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I++ GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMIERYTASIKDAGGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MN+ +P + I E++   R ++ VLR+L +   +     +  ++  +  
Sbjct: 60  VLMNVEAPQSVIDELETNFRYNDAVLRNLIVHTKAAVTEASPMVKAKESK 109


>gi|288941716|ref|YP_003443956.1| 30S ribosomal protein S6 [Allochromatium vinosum DSM 180]
 gi|288897088|gb|ADC62924.1| ribosomal protein S6 [Allochromatium vinosum DSM 180]
          Length = 130

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 56/105 (53%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+     S+Q+   I +YQ  +++ GG V    + G R +AY I K  KA+Y
Sbjct: 1   MRHYEVVFLVHPS-QSEQVPGMIERYQGSLEKRGGVVHRCEDWGRRPLAYPINKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V MN+     AI E+    R ++ VLR+L +  D+    P+   +
Sbjct: 60  VLMNVECDQEAIDELANAFRFNDVVLRNLIIQRDAAVTEPSPLAK 104


>gi|171463203|ref|YP_001797316.1| ribosomal protein S6 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|226695112|sp|B1XTM5|RS6_POLNS RecName: Full=30S ribosomal protein S6
 gi|171192741|gb|ACB43702.1| ribosomal protein S6 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 124

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 61/119 (51%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ +   GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMIDRYKATLAAVGGKIHRMEDWGRRQMAYMIDKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           V MNI      + E++   + ++ VLR L +     E  P++ ++    ++       D
Sbjct: 60  VCMNIECDQKTLEELEHAFKFNDAVLRHLIIKTKKAETEPSIMMKEVQHEEARKSAQSD 118


>gi|85713278|ref|ZP_01044301.1| 30S ribosomal protein S6 [Idiomarina baltica OS145]
 gi|85692896|gb|EAQ30871.1| 30S ribosomal protein S6 [Idiomarina baltica OS145]
          Length = 115

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 62/114 (54%), Gaps = 1/114 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I++ GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSETIKQGGGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
           V +NI +    + E++   R ++ VLR+L +        P+   ++ +R   ++
Sbjct: 60  VLLNIEANAEVVDELETAFRFNDAVLRNLVMRKKEAITEPSPLTKKEERKGDSE 113


>gi|310815619|ref|YP_003963583.1| 30S ribosomal protein S6 [Ketogulonicigenium vulgare Y25]
 gi|308754354|gb|ADO42283.1| 30S ribosomal protein S6 [Ketogulonicigenium vulgare Y25]
          Length = 128

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 48/115 (41%), Positives = 78/115 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +NGG V L    G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVLIARQDLSNAQAEGLIEHFSAVLADNGGAVVLSEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
            ++   +P AA+ EM+R  R+ ++V+R LT+ VD+HE  P++ +Q+ D  DR +R
Sbjct: 61  AYLRTDAPAAAVLEMERLARLHDDVMRVLTIKVDAHEDGPSVQMQKRDERDRGER 115


>gi|118588141|ref|ZP_01545551.1| 30S ribosomal protein S6 [Stappia aggregata IAM 12614]
 gi|118439763|gb|EAV46394.1| 30S ribosomal protein S6 [Stappia aggregata IAM 12614]
          Length = 148

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 77/106 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S+QQ++  + QY+ LI+  GG V  V   G+R++AYRI+KNRKA+Y
Sbjct: 1   MPLYEHVFLARQDVSAQQVEQLVEQYKGLIEGAGGTVGKVENWGLRSLAYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             MNI +P AA+ EM+R+M + E++LR +T  VD  ++ P+  +Q+
Sbjct: 61  TLMNINAPHAAVAEMERQMGLSEDILRFMTFKVDELDEEPSAMMQK 106


>gi|49475326|ref|YP_033367.1| 30S ribosomal protein S6 [Bartonella henselae str. Houston-1]
 gi|61215539|sp|Q6G446|RS6_BARHE RecName: Full=30S ribosomal protein S6
 gi|49238132|emb|CAF27340.1| 30S ribosomal protein s6 [Bartonella henselae str. Houston-1]
          Length = 135

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 58/129 (44%), Positives = 86/129 (66%), Gaps = 6/129 (4%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+FL RQDI+ QQ+ + +  Y+ +I+  GG+V  V   G+R +AYRIRKNRKAYY
Sbjct: 1   MALYEHMFLARQDIAPQQVDELLNIYKGVIETYGGKVGRVENWGLRPLAYRIRKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR------DDRND 114
           V +NI +P  AI E++R+MRI+E++LR +T+ V+ HE+  +    R DR      D+++ 
Sbjct: 61  VLVNIDAPATAIAEVERQMRINEDILRYMTIRVEKHEKEKSAMFSRLDRNGHIGHDEKHP 120

Query: 115 RFPRDRNVD 123
           R P  +  D
Sbjct: 121 RSPSRQRED 129


>gi|39936140|ref|NP_948416.1| 30S ribosomal protein S6 [Rhodopseudomonas palustris CGA009]
 gi|192291858|ref|YP_001992463.1| 30S ribosomal protein S6 [Rhodopseudomonas palustris TIE-1]
 gi|61216210|sp|Q6N5A4|RS6_RHOPA RecName: Full=30S ribosomal protein S6; AltName: Full=RRP-S6
 gi|226695122|sp|B3Q9T5|RS6_RHOPT RecName: Full=30S ribosomal protein S6
 gi|39649994|emb|CAE28518.1| possible 30S ribosomal protein S6 [Rhodopseudomonas palustris
           CGA009]
 gi|192285607|gb|ACF01988.1| ribosomal protein S6 [Rhodopseudomonas palustris TIE-1]
          Length = 158

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD S+QQ+++   Q   +I+  GG+V      G+R++ YR+ KNRKA++
Sbjct: 1   MPLYEHVFLARQDASAQQVEELTTQITGVIEGLGGKVTKTESWGLRSLTYRMNKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI  P A + E++R+ RI+E+V+R LT+ VD HE+ P+  +++
Sbjct: 61  VLLNIDGPAAVVSEIERQERINEDVIRYLTVRVDEHEEGPSAMMRK 106


>gi|159044729|ref|YP_001533523.1| 30S ribosomal protein S6 [Dinoroseobacter shibae DFL 12]
 gi|189045465|sp|A8LQQ5|RS6_DINSH RecName: Full=30S ribosomal protein S6
 gi|157912489|gb|ABV93922.1| 30S ribosomal protein S6 [Dinoroseobacter shibae DFL 12]
          Length = 117

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 73/106 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  +  + S++ +NGG+V      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVFISRQDLSNAQAESLVEHFGSVLADNGGKVVDSEYWGLKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  A+ EM+R MR+ ++V+R +T+ VD H + P++ +Q+
Sbjct: 61  AFLKTDAPAPAVQEMERLMRLHDDVMRVMTIKVDEHPEGPSIQMQK 106


>gi|90414464|ref|ZP_01222440.1| 30S ribosomal protein S6 [Photobacterium profundum 3TCK]
 gi|90324469|gb|EAS41028.1| 30S ribosomal protein S6 [Photobacterium profundum 3TCK]
          Length = 141

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 68/126 (53%), Gaps = 3/126 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I+++GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSIKDSGGQIHRLEDWGRRQMAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD--DRNDRFPR 118
           V MNI +  + + E++   R ++ V+R++ +   +    P+  ++  +     R+DR  R
Sbjct: 60  VLMNIEAEQSVVDELETTFRFNDAVIRNMIMRAKNAVTEPSPMMKAKEERFTKRDDREER 119

Query: 119 DRNVDR 124
               + 
Sbjct: 120 SDRSEA 125


>gi|54310419|ref|YP_131439.1| 30S ribosomal protein S6 [Photobacterium profundum SS9]
 gi|61216203|sp|Q6LM41|RS6_PHOPR RecName: Full=30S ribosomal protein S6
 gi|46914860|emb|CAG21637.1| putative ribosomal protein S6 [Photobacterium profundum SS9]
          Length = 147

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 68/126 (53%), Gaps = 3/126 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I+++GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSIKDSGGQIHRLEDWGRRQMAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD--DRNDRFPR 118
           V MNI +  + + E++   R ++ V+R++ +   +    P+  ++  +     R+DR  R
Sbjct: 60  VLMNIEAEQSVVDELESTFRFNDAVIRNMIMRAKNAVTEPSPMMKAKEERFTKRDDREER 119

Query: 119 DRNVDR 124
               + 
Sbjct: 120 SDRSEA 125


>gi|268592872|ref|ZP_06127093.1| ribosomal protein S6 [Providencia rettgeri DSM 1131]
 gi|291311661|gb|EFE52114.1| ribosomal protein S6 [Providencia rettgeri DSM 1131]
          Length = 131

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 68/132 (51%), Gaps = 1/132 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y ++I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSAVITNAQGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N+ +P  AI E++   R ++ V+RS+ + +       +  ++  D     D     +
Sbjct: 60  VLLNVEAPQEAIDELETNFRFNDAVIRSMVMRLKHAVTEASPMVKAKDERRGRDMSDEYQ 119

Query: 121 NVDRKQHVSEEK 132
           + + ++    E+
Sbjct: 120 DEEVEETGDSEE 131


>gi|163803109|ref|ZP_02196993.1| 30S ribosomal protein S6 [Vibrio sp. AND4]
 gi|312881935|ref|ZP_07741692.1| 30S ribosomal protein S6 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|159173101|gb|EDP57933.1| 30S ribosomal protein S6 [Vibrio sp. AND4]
 gi|309370371|gb|EFP97866.1| 30S ribosomal protein S6 [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 126

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/107 (30%), Positives = 60/107 (56%), Gaps = 1/107 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH 107
           V MN+ +  A I E++   R ++ VLR++ +   +     ++ +++ 
Sbjct: 60  VLMNVEADQAVIDELETAFRFNDAVLRNMIMRTKAAITEQSIMLKQK 106


>gi|37199919|dbj|BAC95748.1| ribosomal protein S6 [Vibrio vulnificus YJ016]
          Length = 134

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG++  + + G R +AY I K  KA+Y
Sbjct: 12  MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHY 70

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MN+ +  A I E++   R ++ VLR++ +   +    P++ +++ +  
Sbjct: 71  VLMNVEADQAVIDELETAFRYNDAVLRNMIMRTKAAITEPSIMLKQKEER 120


>gi|114762811|ref|ZP_01442243.1| ribosomal protein S6 [Pelagibaca bermudensis HTCC2601]
 gi|114544421|gb|EAU47428.1| ribosomal protein S6 [Roseovarius sp. HTCC2601]
          Length = 118

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 73/106 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  +  + +++ +NGG+V      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVFIARQDLSNAQAEGLVEHFGTVLSDNGGKVVESEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  A+ EM+R MR+ ++V+R LT+ VD H + P++ +Q+
Sbjct: 61  AFLKTDAPATAVQEMERLMRLHDDVMRVLTIKVDEHAEGPSVQMQK 106


>gi|163749303|ref|ZP_02156552.1| 30S ribosomal protein S6 [Shewanella benthica KT99]
 gi|161331022|gb|EDQ01948.1| 30S ribosomal protein S6 [Shewanella benthica KT99]
          Length = 140

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 72/136 (52%), Gaps = 2/136 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y  ++ + GG+V  + + G R +AY I +  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPGMIERYTGILTQAGGQVHRLEDWGRRQLAYPIIELHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +   +I E++   R+++ VLRS+ +   +     +   + + +RD R       
Sbjct: 60  VLMNVETTAESIEELETVFRLNDAVLRSMVMRTKAAITEASPMAKLKEERDSRRSSEGER 119

Query: 120 RNVDRKQHVSEEKPLS 135
           R+   ++ V E K  +
Sbjct: 120 RSAPVEKAVEEVKETA 135


>gi|319792757|ref|YP_004154397.1| ribosomal protein s6 [Variovorax paradoxus EPS]
 gi|315595220|gb|ADU36286.1| ribosomal protein S6 [Variovorax paradoxus EPS]
          Length = 124

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 66/124 (53%), Gaps = 1/124 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + L+  D  S+Q+   + +Y+ LI   GG+V  V + G R +AY+I K  KA+Y
Sbjct: 1   MRHYEIILLIHPD-QSEQVPAMLERYKGLITAGGGKVHRVEDWGRRQLAYQINKLNKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + +NI +  A + E++   + ++ VLR LT+     E  P+  ++  +R++       + 
Sbjct: 60  LCVNIEAEQAVMGELEHAFKFNDAVLRHLTVQKKKAETGPSSMMKTVEREEARKAQQAEY 119

Query: 121 NVDR 124
             + 
Sbjct: 120 AANN 123


>gi|121635034|ref|YP_975279.1| 30S ribosomal protein S6 [Neisseria meningitidis FAM18]
 gi|161870198|ref|YP_001599368.1| 30S ribosomal protein S6 [Neisseria meningitidis 053442]
 gi|218768343|ref|YP_002342855.1| 30S ribosomal protein S6 [Neisseria meningitidis Z2491]
 gi|254805122|ref|YP_003083343.1| 30S ribosomal protein S6 [Neisseria meningitidis alpha14]
 gi|304387366|ref|ZP_07369558.1| 30S ribosomal protein S6 [Neisseria meningitidis ATCC 13091]
 gi|13959509|sp|Q9JU24|RS6_NEIMA RecName: Full=30S ribosomal protein S6
 gi|166227354|sp|A1KUF0|RS6_NEIMF RecName: Full=30S ribosomal protein S6
 gi|189045476|sp|A9LZQ3|RS6_NEIM0 RecName: Full=30S ribosomal protein S6
 gi|120866740|emb|CAM10493.1| 30S ribosomal protein S6 [Neisseria meningitidis FAM18]
 gi|121052351|emb|CAM08683.1| 30S ribosomal protein S6 [Neisseria meningitidis Z2491]
 gi|161595751|gb|ABX73411.1| 30S ribosomal protein S6 [Neisseria meningitidis 053442]
 gi|254668664|emb|CBA06348.1| 30S ribosomal protein S6 [Neisseria meningitidis alpha14]
 gi|254671746|emb|CBA09568.1| 30S ribosomal protein S6 [Neisseria meningitidis alpha153]
 gi|261392397|emb|CAX49939.1| 30S ribosomal protein S6 [Neisseria meningitidis 8013]
 gi|304338617|gb|EFM04735.1| 30S ribosomal protein S6 [Neisseria meningitidis ATCC 13091]
 gi|308389441|gb|ADO31761.1| 30S ribosomal protein S6 [Neisseria meningitidis alpha710]
 gi|316984125|gb|EFV63103.1| ribosomal protein S6 [Neisseria meningitidis H44/76]
 gi|319410589|emb|CBY90958.1| 30S ribosomal protein S6 [Neisseria meningitidis WUE 2594]
 gi|325128380|gb|EGC51263.1| ribosomal protein S6 [Neisseria meningitidis N1568]
 gi|325134437|gb|EGC57082.1| ribosomal protein S6 [Neisseria meningitidis M13399]
 gi|325138251|gb|EGC60820.1| ribosomal protein S6 [Neisseria meningitidis ES14902]
 gi|325140453|gb|EGC62974.1| ribosomal protein S6 [Neisseria meningitidis CU385]
 gi|325205905|gb|ADZ01358.1| ribosomal protein S6 [Neisseria meningitidis M04-240196]
          Length = 122

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|188992092|ref|YP_001904102.1| 30S ribosomal protein S6 [Xanthomonas campestris pv. campestris
           str. B100]
 gi|226705647|sp|B0RUY9|RS6_XANCB RecName: Full=30S ribosomal protein S6
 gi|167733852|emb|CAP52058.1| 30S ribosomal protein S6 [Xanthomonas campestris pv. campestris]
          Length = 144

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 39/134 (29%), Positives = 68/134 (50%), Gaps = 3/134 (2%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VFL+  D  S+Q+   I +Y+SLI+   G +  + + G R +AY I+   KA+YV
Sbjct: 3   RHYEVVFLVHPD-QSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYV 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            +NI    A + E+    R ++ VLR L +  D  +   +L ++   +D++ D+  R   
Sbjct: 62  LLNIEVDQAVLSELVESFRFNDAVLRHLVIKRDGPDTEQSLIMK--SKDEKGDKPERSER 119

Query: 122 VDRKQHVSEEKPLS 135
             R     +  P +
Sbjct: 120 RRRDDEEVDAAPAA 133


>gi|330445013|ref|ZP_08308667.1| ribosomal protein S6 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328493131|dbj|GAA03164.1| ribosomal protein S6 [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 128

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/129 (25%), Positives = 67/129 (51%), Gaps = 3/129 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I+++GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTAAIKDSGGQIHRLEDWGRRQMAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD--DRNDRFPR 118
           V MN+ +  + + E++   R ++ V+R++ +   +    P+  ++  +     R DR   
Sbjct: 60  VLMNVEAEQSVVDELESNFRFNDAVIRNMIMRTKNAVTEPSPMMKAKEERFTKREDRAEA 119

Query: 119 DRNVDRKQH 127
               +    
Sbjct: 120 QSEGEAAAE 128


>gi|319943301|ref|ZP_08017584.1| 30S ribosomal protein S6 [Lautropia mirabilis ATCC 51599]
 gi|319743843|gb|EFV96247.1| 30S ribosomal protein S6 [Lautropia mirabilis ATCC 51599]
          Length = 129

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 63/114 (55%), Gaps = 1/114 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+ +++   G++  V + G   +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMIDRYKQMVEGANGKMHRVEDWGRLQLAYPIQKIGKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
           V MN+      + E++   R ++ VLR L + +D  E  P++  +R  +++   
Sbjct: 60  VLMNVECDQHTLGEIENAFRFNDAVLRHLVVRMDKAETGPSVMSKRLQKEESRK 113


>gi|239814824|ref|YP_002943734.1| 30S ribosomal protein S6 [Variovorax paradoxus S110]
 gi|259495368|sp|C5CUP0|RS6_VARPS RecName: Full=30S ribosomal protein S6
 gi|239801401|gb|ACS18468.1| ribosomal protein S6 [Variovorax paradoxus S110]
          Length = 124

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 65/125 (52%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + L+  D  S+Q+   + +Y+ LI   GG+V  V + G R +AY+I K  KA+Y
Sbjct: 1   MRHYEIILLIHPD-QSEQVPAMLERYKGLITAGGGKVHRVEDWGRRQLAYQINKLSKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + +NI +    + E++   + ++ VLR LT+     E  P+  ++  +R++       + 
Sbjct: 60  LCVNIEAEQTVMGELEHAFKFNDAVLRHLTVQKKKAETGPSSMMKTVEREEARKAQQAEY 119

Query: 121 NVDRK 125
             +  
Sbjct: 120 AANNS 124


>gi|156972403|ref|YP_001443310.1| 30S ribosomal protein S6 [Vibrio harveyi ATCC BAA-1116]
 gi|269961472|ref|ZP_06175836.1| 30S ribosomal protein S6 [Vibrio harveyi 1DA3]
 gi|166227402|sp|A7MSX8|RS6_VIBHB RecName: Full=30S ribosomal protein S6
 gi|156523997|gb|ABU69083.1| hypothetical protein VIBHAR_00023 [Vibrio harveyi ATCC BAA-1116]
 gi|269833849|gb|EEZ87944.1| 30S ribosomal protein S6 [Vibrio harveyi 1DA3]
          Length = 129

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 36/118 (30%), Positives = 66/118 (55%), Gaps = 3/118 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPR 118
           V MN+ +    I E++   R ++ VLR++ +   +     ++ ++   +++R +R PR
Sbjct: 60  VLMNVEAGQEVIDELETAFRFNDAVLRNMIMRTKAAITEQSIMLK--QKEERAERAPR 115


>gi|260427680|ref|ZP_05781659.1| ribosomal protein S6 [Citreicella sp. SE45]
 gi|260422172|gb|EEX15423.1| ribosomal protein S6 [Citreicella sp. SE45]
          Length = 118

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  +  + +++ +NGG++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVFIARQDLSNAQAEGLVEHFGTVLSDNGGKIVDSEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P AA+ EM+R MR+ ++V+R LT+ V+ H + P++ +Q+
Sbjct: 61  AFLRTDAPAAAVQEMERLMRLHDDVMRVLTIKVEEHAEGPSVQMQK 106


>gi|237809239|ref|YP_002893679.1| 30S ribosomal protein S6 [Tolumonas auensis DSM 9187]
 gi|259495346|sp|C4LAB8|RS6_TOLAT RecName: Full=30S ribosomal protein S6
 gi|237501500|gb|ACQ94093.1| ribosomal protein S6 [Tolumonas auensis DSM 9187]
          Length = 124

 Score =  127 bits (319), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 59/114 (51%), Gaps = 1/114 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I+  GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAIKAAGGTIHRLEDWGRRQLAYPIDKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
           V MN+ +  + I E++   R ++ V+R++ +         +  ++  +   R +
Sbjct: 60  VLMNVEAEQSVIDELENNFRFNDAVIRNMIMRTKHAVTEASPMLKAREERPRRE 113


>gi|209964874|ref|YP_002297789.1| ribosomal protein S6 [Rhodospirillum centenum SW]
 gi|226695121|sp|B6IN79|RS6_RHOCS RecName: Full=30S ribosomal protein S6
 gi|209958340|gb|ACI98976.1| ribosomal protein S6 [Rhodospirillum centenum SW]
          Length = 163

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 47/116 (40%), Positives = 78/116 (67%), Gaps = 1/116 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE + + RQDI++ Q++     +  +++ENGGEV+ V + G++T+ YRI+KNRKA+Y
Sbjct: 1   MALYETILIARQDITASQVEGLTETFTGILKENGGEVKKVEQWGLKTLTYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH-DRDDRNDR 115
           V++   +P AA+ EM+R M I+E+VLR +T+ V+  E+  T  +    +R +R  R
Sbjct: 61  VYIGHEAPAAAVAEMERNMSINEDVLRFMTVKVEKIEEGQTAMLTNKGERSERGPR 116


>gi|226941618|ref|YP_002796692.1| 30S ribosomal protein S6 [Laribacter hongkongensis HLHK9]
 gi|254765441|sp|C1DCR4|RS6_LARHH RecName: Full=30S ribosomal protein S6
 gi|226716545|gb|ACO75683.1| RpsF [Laribacter hongkongensis HLHK9]
          Length = 125

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+ ++    G++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKGMVLGQNGKIHRLEDWGRRQLAYPIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI      + E++   + ++ VLR LT+ +D      +  ++     +
Sbjct: 60  VMMNIECGKETLEEIEHAFKFNDAVLRHLTIKMDRAVTEASPMMKEEKAKN 110


>gi|332535619|ref|ZP_08411385.1| 30S ribosomal protein S6 [Pseudoalteromonas haloplanktis ANT/505]
 gi|332034974|gb|EGI71496.1| 30S ribosomal protein S6 [Pseudoalteromonas haloplanktis ANT/505]
          Length = 113

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVTGMIERYTGSITEAGGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MN+ +P   I E++   R ++ VLR+L +   +     +   +   ++
Sbjct: 60  VLMNVEAPTEVISELETTFRYNDAVLRNLVMRTKNAVTEASPLAREEKKE 109


>gi|163868015|ref|YP_001609219.1| 30S ribosomal protein S6 [Bartonella tribocorum CIP 105476]
 gi|189045455|sp|A9IRU5|RS6_BART1 RecName: Full=30S ribosomal protein S6
 gi|161017666|emb|CAK01224.1| 30S ribosomal protein S6 [Bartonella tribocorum CIP 105476]
          Length = 135

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 89/135 (65%), Gaps = 6/135 (4%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+FL RQD++ QQ+ + +  Y+ +I+ +GG+V  V   G+R +AYRIRKNRKAYY
Sbjct: 1   MALYEHMFLARQDVAPQQVDELLSLYKGVIETHGGKVGRVENWGLRPLAYRIRKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR------DDRND 114
           V +NI +P AAI EM+R+MRI+E++LR +T+ V+ HE+  +  +   DR      D+   
Sbjct: 61  VLVNIDAPAAAIAEMERQMRINEDILRYMTIRVEKHEKEKSAMLSHLDRNAHAGQDEERS 120

Query: 115 RFPRDRNVDRKQHVS 129
           R PR +  +  + V 
Sbjct: 121 RSPRRQRENAIERVE 135


>gi|325132477|gb|EGC55170.1| ribosomal protein S6 [Neisseria meningitidis M6190]
          Length = 122

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|15677189|ref|NP_274342.1| 30S ribosomal protein S6 [Neisseria meningitidis MC58]
 gi|13959510|sp|Q9JZ29|RS6_NEIMB RecName: Full=30S ribosomal protein S6
 gi|7226565|gb|AAF41698.1| 30S ribosomal protein S6 [Neisseria meningitidis MC58]
          Length = 122

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ +LR LT+         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAILRHLTIKTKHAVTEASPMLGGEKAKN 110


>gi|126665194|ref|ZP_01736177.1| ribosomal protein S6 [Marinobacter sp. ELB17]
 gi|126630564|gb|EBA01179.1| ribosomal protein S6 [Marinobacter sp. ELB17]
          Length = 138

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 44/134 (32%), Positives = 66/134 (49%), Gaps = 3/134 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y SLI E+GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEVVFMVHPD-QSEQVPAMIERYTSLITEDGGQVDRLEDWGRRHLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI     A+ E+    R ++ ++R L L  D      +       R+DR  R   D 
Sbjct: 60  VLMNIQCSQTAMDELTHNFRFNDAIIRELILRRDEAVTDMSPMKSAESREDR--RPSGDD 117

Query: 121 NVDRKQHVSEEKPL 134
              R     E + +
Sbjct: 118 RPRRSAESDESQKV 131


>gi|148981038|ref|ZP_01816258.1| 30S ribosomal protein S6 [Vibrionales bacterium SWAT-3]
 gi|145961014|gb|EDK26337.1| 30S ribosomal protein S6 [Vibrionales bacterium SWAT-3]
          Length = 129

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 34/130 (26%), Positives = 64/130 (49%), Gaps = 1/130 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQMAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +    I E++   R ++ VLR++ +         ++ +++ +          +R
Sbjct: 60  VLMNVEAGQEVIDELETAFRFNDAVLRNMIMRTKGAVTEQSIMLKQKEERAERAPRREER 119

Query: 121 NVDRKQHVSE 130
              + +  +E
Sbjct: 120 TEAKPEAAAE 129


>gi|269103598|ref|ZP_06156295.1| SSU ribosomal protein S6p [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268163496|gb|EEZ41992.1| SSU ribosomal protein S6p [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 128

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 66/129 (51%), Gaps = 3/129 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I+++GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTAAIKDSGGQIHRLEDWGRRQMAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD--DRNDRFPR 118
           V MN+ +  A I E++   R ++ V+R++ +        P+  ++  +     R +R   
Sbjct: 60  VLMNVEAEQAVIDELESNFRFNDAVIRNMIMRTKGAITEPSPMMKAKEERFTKREERAEA 119

Query: 119 DRNVDRKQH 127
               +    
Sbjct: 120 QSEGEAAAE 128


>gi|119776196|ref|YP_928936.1| 30S ribosomal protein S6 [Shewanella amazonensis SB2B]
 gi|166227380|sp|A1SA60|RS6_SHEAM RecName: Full=30S ribosomal protein S6
 gi|119768696|gb|ABM01267.1| SSU ribosomal protein S6P [Shewanella amazonensis SB2B]
          Length = 135

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 32/135 (23%), Positives = 65/135 (48%), Gaps = 1/135 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  +I +  G++  + + G R +AY I+   KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGVITDANGKIHRLEDWGRRQLAYPIQDLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +   ++ E++   R ++ VLRS+ +         +   +  D  D       +R
Sbjct: 60  VLMNVEATAESVEELETAFRFNDAVLRSMVMRTKGAITEASPMAKAKDERDARRAAISER 119

Query: 121 NVDRKQHVSEEKPLS 135
           + +  +     +  +
Sbjct: 120 SSEADEVEENAEESA 134


>gi|85374299|ref|YP_458361.1| 30S ribosomal protein S6 [Erythrobacter litoralis HTCC2594]
 gi|84787382|gb|ABC63564.1| ribosomal protein S6 [Erythrobacter litoralis HTCC2594]
          Length = 126

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 46/121 (38%), Positives = 82/121 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+FL RQD+S  Q+         +I++N G+V      G++ +AY+I +NRKA++
Sbjct: 6   MALYEHIFLARQDLSQSQVDALAATATDIIEKNDGKVTKTETWGLKNLAYKIDRNRKAHF 65

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI  P + + E++R+ RI+E+V+R +T+ V+ HE+ P++ ++++DRD++  R   +R
Sbjct: 66  VMLNIEGPGSVVAELERQTRINEDVIRYMTIRVEEHEEGPSVMMRKNDRDNKKRRDREER 125

Query: 121 N 121
           N
Sbjct: 126 N 126


>gi|291614208|ref|YP_003524365.1| ribosomal protein S6 [Sideroxydans lithotrophicus ES-1]
 gi|291584320|gb|ADE11978.1| ribosomal protein S6 [Sideroxydans lithotrophicus ES-1]
          Length = 128

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 31/108 (28%), Positives = 59/108 (54%), Gaps = 1/108 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y++L+    G +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYRTLVTSKNGHIHRLEDWGRRQLAYPIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
           V MNI      + E++   + ++ VLR LT+   +   +P+  ++   
Sbjct: 60  VLMNIEVDQPTLDELEHAFKFNDAVLRHLTIKTKAAVVTPSAMMKEEK 107


>gi|329850895|ref|ZP_08265740.1| ribosomal protein S6 [Asticcacaulis biprosthecum C19]
 gi|328841210|gb|EGF90781.1| ribosomal protein S6 [Asticcacaulis biprosthecum C19]
          Length = 125

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 73/117 (62%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YEH  + RQDIS QQ +    Q + LI++NGG +  +   G+R + YR++KNRK +Y
Sbjct: 1   MPFYEHTVIARQDISPQQAEALNDQLKHLIEDNGGHIAKIEYWGLRNLTYRVKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFP 117
             + I +P AA+ EM+R++ I+E+V+R LT+ V+  +   +  + R DR +R +R  
Sbjct: 61  SLLAIDAPAAAVKEMERQLGINEDVIRFLTVRVEELDLELSPILSRRDRPERAERTE 117


>gi|127514212|ref|YP_001095409.1| 30S ribosomal protein S6 [Shewanella loihica PV-4]
 gi|166227383|sp|A3QI52|RS6_SHELP RecName: Full=30S ribosomal protein S6
 gi|126639507|gb|ABO25150.1| SSU ribosomal protein S6P [Shewanella loihica PV-4]
          Length = 135

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 1/118 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y  ++ + GG++  + + G R +AY I +  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPGMIERYTGILTQAGGQIHRLEDWGRRQLAYPIIELHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPR 118
           V MN+ +   ++ E++   R ++ VLRS+ +         +   +  D  +       
Sbjct: 60  VLMNVEATAESVEELETAFRFNDAVLRSMVMRTKGAITEASPMAKAKDEREARRSSEE 117


>gi|319763796|ref|YP_004127733.1| ribosomal protein s6 [Alicycliphilus denitrificans BC]
 gi|330823940|ref|YP_004387243.1| 30S ribosomal protein S6 [Alicycliphilus denitrificans K601]
 gi|317118357|gb|ADV00846.1| ribosomal protein S6 [Alicycliphilus denitrificans BC]
 gi|329309312|gb|AEB83727.1| ribosomal protein S6 [Alicycliphilus denitrificans K601]
          Length = 124

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 64/119 (53%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + L+  D  S+Q+   + +Y+ +I   GG+V  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIILLIHPD-QSEQVPAMLERYKGMITAGGGQVHRVEDWGRRQLAYLINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           + +NI +  A + E++   + ++ VLR LT+     E  P+  ++  +R++       +
Sbjct: 60  LCLNIEADQAVMAELEHAFKFNDAVLRHLTVQKKKAETGPSSMMKTVEREEARKASQAE 118


>gi|89075974|ref|ZP_01162346.1| 30S ribosomal protein S6 [Photobacterium sp. SKA34]
 gi|89048323|gb|EAR53902.1| 30S ribosomal protein S6 [Photobacterium sp. SKA34]
          Length = 129

 Score =  126 bits (318), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 68/132 (51%), Gaps = 5/132 (3%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I+++GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTAAIKDSGGQIHRLEDWGRRQMAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +  + + E++   R ++ V+R++ +   +    P+  ++  +         R+ 
Sbjct: 60  VLMNVEAEQSVVDELESSFRFNDAVIRNMIMRTKNAVTEPSPMMKAKEER----FTKRED 115

Query: 121 NVDRKQHVSEEK 132
             +  Q   E  
Sbjct: 116 RAETAQSEGEAA 127


>gi|315125712|ref|YP_004067715.1| 30S ribosomal protein S6 [Pseudoalteromonas sp. SM9913]
 gi|315014226|gb|ADT67564.1| 30S ribosomal protein S6 [Pseudoalteromonas sp. SM9913]
          Length = 113

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVSGMIERYTGSITEAGGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MN+ +P   I E++   R ++ VLR+L +   +     +  ++   ++
Sbjct: 60  VLMNVEAPTEVISELETTFRYNDAVLRNLVMRTKNAVTEASPLVREEKKE 109


>gi|294634470|ref|ZP_06713005.1| ribosomal protein S6 [Edwardsiella tarda ATCC 23685]
 gi|291091984|gb|EFE24545.1| ribosomal protein S6 [Edwardsiella tarda ATCC 23685]
          Length = 131

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 69/132 (52%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R + F  +
Sbjct: 60  VLMNVEAPQEVIDELETNFRYNDAVIRSMVMRTKHAVTEASPMVKAKDERRERREDFANE 119

Query: 120 RNVDRKQHVSEE 131
            + + +   SEE
Sbjct: 120 TSEETEAGDSEE 131


>gi|90581366|ref|ZP_01237162.1| 30S ribosomal protein S6 [Vibrio angustum S14]
 gi|90437476|gb|EAS62671.1| 30S ribosomal protein S6 [Vibrio angustum S14]
          Length = 129

 Score =  126 bits (317), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 68/132 (51%), Gaps = 5/132 (3%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I+++GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTAAIKDSGGQIHRLEDWGRRQMAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +  + + E++   R ++ V+R++ +   +    P+  ++  +         R+ 
Sbjct: 60  VLMNVEAEQSVVDELESNFRFNDAVIRNMIMRTKNAVTEPSPMMKAKEER----FTKRED 115

Query: 121 NVDRKQHVSEEK 132
             +  Q   E  
Sbjct: 116 RAETAQSEGEAA 127


>gi|114319743|ref|YP_741426.1| 30S ribosomal protein S6 [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312363|sp|Q0AB51|RS6_ALHEH RecName: Full=30S ribosomal protein S6
 gi|114226137|gb|ABI55936.1| SSU ribosomal protein S6P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 119

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 62/113 (54%), Gaps = 1/113 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  +++ NGG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPSMIERYTGIVESNGGKVHRLEDWGRRQLAYPINKLIKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
           V MN+      + E++   R ++ V+R++ L  D     P+   +  ++D+  
Sbjct: 60  VLMNVECGKDELDELESLFRFNDAVIRNMVLGRDEAVTEPSPLARSQEKDEEE 112


>gi|49474088|ref|YP_032130.1| 30S ribosomal protein S6 [Bartonella quintana str. Toulouse]
 gi|61215537|sp|Q6G060|RS6_BARQU RecName: Full=30S ribosomal protein S6
 gi|49239592|emb|CAF25949.1| 30s ribosomal protein s6 [Bartonella quintana str. Toulouse]
          Length = 136

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 80/110 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+FL RQDI+ QQ+ + +  Y+S+I+ +GG+V  V   G+R +AYRIRKNRKAYY
Sbjct: 1   MALYEHIFLARQDIAPQQVDELLSLYKSVIEAHGGKVGRVENWGLRPLAYRIRKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V +NI +P  AI E++R+M I+E++LR +T+ V+ HE+  +    R DR+
Sbjct: 61  VLINIDAPATAIAEVERQMHINEDILRYMTVRVEKHEKEKSAMFSRLDRN 110


>gi|104783860|ref|YP_610358.1| 30S ribosomal protein S6 [Pseudomonas entomophila L48]
 gi|122401638|sp|Q1I461|RS6_PSEE4 RecName: Full=30S ribosomal protein S6
 gi|95112847|emb|CAK17575.1| 30S ribosomal protein S6 [Pseudomonas entomophila L48]
          Length = 141

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  D     P+  ++
Sbjct: 60  VMLNVECTGKALAELEDNFRYNDAVIRNLVIRRDEAVTGPSEMLK 104


>gi|241764687|ref|ZP_04762699.1| ribosomal protein S6 [Acidovorax delafieldii 2AN]
 gi|241365857|gb|EER60506.1| ribosomal protein S6 [Acidovorax delafieldii 2AN]
          Length = 125

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 64/119 (53%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + L+  D  S+Q+   + +Y+ +I   GG+V  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIILLIHPD-QSEQVPAMLERYKGMITAGGGKVHRVEDWGRRQLAYLINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           + +NI +  A + E++   + ++ VLR LT+     E  P+  ++  +R++       +
Sbjct: 60  LCVNIEADQAVMAELEHAFKFNDAVLRHLTVQKKKAETGPSSMMKTVEREEARKVSQAE 118


>gi|171059511|ref|YP_001791860.1| 30S ribosomal protein S6 [Leptothrix cholodnii SP-6]
 gi|226703484|sp|B1XXH5|RS6_LEPCP RecName: Full=30S ribosomal protein S6
 gi|170776956|gb|ACB35095.1| ribosomal protein S6 [Leptothrix cholodnii SP-6]
          Length = 121

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 64/122 (52%), Gaps = 1/122 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S+Q+   + +Y++L+    G+V  V + G   +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSEQVPAMLERYKTLVTAANGKVHRVEDWGRFQLAYMINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + +NI      + E++   R ++ VLR LT+  D  E  P+  ++R ++++      ++ 
Sbjct: 60  LCLNIECSKETLAEIETGFRFNDAVLRHLTVKRDKAETGPSAVMKRVEKEEARKSSQQET 119

Query: 121 NV 122
             
Sbjct: 120 AA 121


>gi|160900661|ref|YP_001566243.1| 30S ribosomal protein S6 [Delftia acidovorans SPH-1]
 gi|226703450|sp|A9BNG3|RS6_DELAS RecName: Full=30S ribosomal protein S6
 gi|160366245|gb|ABX37858.1| ribosomal protein S6 [Delftia acidovorans SPH-1]
          Length = 120

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 65/121 (53%), Gaps = 1/121 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S+Q+   + +Y+ +I   GG+V    + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLIHPD-QSEQVPAMLERYKGMITAGGGKVHREEDWGRRQLAYMINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + +NI +  A + E++   + ++ VLR LT+     + +P+  ++  +R++       ++
Sbjct: 60  LCLNIEADQAVMAELEHAFKFNDAVLRHLTVQKKKADTAPSSMMKTVEREEARKASQTEQ 119

Query: 121 N 121
            
Sbjct: 120 A 120


>gi|149913882|ref|ZP_01902414.1| 30S ribosomal protein S6 [Roseobacter sp. AzwK-3b]
 gi|149812166|gb|EDM71997.1| 30S ribosomal protein S6 [Roseobacter sp. AzwK-3b]
          Length = 126

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 73/106 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  I  + +++ +NGG++      G++T+AY+I KNRK +Y
Sbjct: 10  MPLYEHVFIARQDLSNAQAEGLIEHFGTVLSDNGGKIVDSEYWGVKTMAYKINKNRKGHY 69

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  A+ EM+R MR+ ++V+R +T+ VD H + P++ +Q+
Sbjct: 70  SFLRTDAPAPAVQEMERLMRLHDDVMRVMTIKVDEHAEGPSVQMQK 115


>gi|124266719|ref|YP_001020723.1| 30S ribosomal protein S6 [Methylibium petroleiphilum PM1]
 gi|166227339|sp|A2SFZ9|RS6_METPP RecName: Full=30S ribosomal protein S6
 gi|124259494|gb|ABM94488.1| SSU ribosomal protein S6P [Methylibium petroleiphilum PM1]
          Length = 122

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 64/122 (52%), Gaps = 1/122 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S+Q+   + +Y+ L+   GG+V  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLIHPD-QSEQVPAMLERYKGLVTAAGGKVHRVEDWGRRQLAYLINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + +NI      + E++   + ++ VLR LT++    E +P++ ++  +R++         
Sbjct: 60  LCLNIECSKETLLELETGFKFNDAVLRHLTVVKSKAETAPSIMMKAVEREESRKAPQPQE 119

Query: 121 NV 122
             
Sbjct: 120 AA 121


>gi|289663136|ref|ZP_06484717.1| 30S ribosomal protein S6 [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289669572|ref|ZP_06490647.1| 30S ribosomal protein S6 [Xanthomonas campestris pv. musacearum
           NCPPB4381]
 gi|325915474|ref|ZP_08177788.1| SSU ribosomal protein S6P [Xanthomonas vesicatoria ATCC 35937]
 gi|325917962|ref|ZP_08180131.1| SSU ribosomal protein S6P [Xanthomonas vesicatoria ATCC 35937]
 gi|325535819|gb|EGD07646.1| SSU ribosomal protein S6P [Xanthomonas vesicatoria ATCC 35937]
 gi|325538356|gb|EGD10038.1| SSU ribosomal protein S6P [Xanthomonas vesicatoria ATCC 35937]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 1/113 (0%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VFL+  D  S+Q+   I +Y+SLI+   G +  + + G R +AY I+   KA+YV
Sbjct: 3   RHYEVVFLVHPD-QSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYV 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
            +NI    A + E+    R ++ VLR L +  D  +   +L ++  D      
Sbjct: 62  LLNIEVDQAVLSELVESFRFNDAVLRHLVVKRDGPDTEQSLIMKSKDEKGDKP 114


>gi|312113717|ref|YP_004011313.1| ribosomal protein S6 [Rhodomicrobium vannielii ATCC 17100]
 gi|311218846|gb|ADP70214.1| ribosomal protein S6 [Rhodomicrobium vannielii ATCC 17100]
          Length = 174

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 76/107 (71%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH FL RQD+++QQ+   +  Y+++I+E+GG+V      G+++ AY+I+KNR+A+Y
Sbjct: 1   MPLYEHTFLARQDVTAQQVTGLMNTYKAVIEEHGGKVSKTEYWGLKSTAYKIKKNRRAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH 107
            F NI +P  A+ EM+R+M I  +VLR LT+ V+  ++ P++ +++ 
Sbjct: 61  AFFNIDAPHQAVLEMERQMGISTDVLRFLTVRVEELDEKPSIQMRKQ 107


>gi|154253798|ref|YP_001414622.1| 30S ribosomal protein S6 [Parvibaculum lavamentivorans DS-1]
 gi|189045484|sp|A7HYI2|RS6_PARL1 RecName: Full=30S ribosomal protein S6
 gi|154157748|gb|ABS64965.1| ribosomal protein S6 [Parvibaculum lavamentivorans DS-1]
          Length = 155

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+F+ RQD+S QQ++    Q+ ++I+E GG+V      G+R +A++++KNRK +Y
Sbjct: 1   MALYEHIFIARQDVSQQQVEALTEQFSNIIKEQGGQVGKTEYWGLRNLAFKVKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             +NI +P AA+ EM+R+M I E+VLR +T+ V+ HE  P+  +Q 
Sbjct: 61  TLVNIDAPHAAVAEMERQMGISEDVLRFITVRVEEHETEPSAMMQS 106


>gi|84393176|ref|ZP_00991940.1| 30S ribosomal protein S6 [Vibrio splendidus 12B01]
 gi|86148224|ref|ZP_01066521.1| 30S ribosomal protein S6 [Vibrio sp. MED222]
 gi|218708333|ref|YP_002415954.1| 30S ribosomal protein S6 [Vibrio splendidus LGP32]
 gi|254765464|sp|B7VI65|RS6_VIBSL RecName: Full=30S ribosomal protein S6
 gi|84376228|gb|EAP93112.1| 30S ribosomal protein S6 [Vibrio splendidus 12B01]
 gi|85833994|gb|EAQ52155.1| 30S ribosomal protein S6 [Vibrio sp. MED222]
 gi|218321352|emb|CAV17302.1| ribosomal protein S6 [Vibrio splendidus LGP32]
          Length = 137

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQMAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +    + E++   R ++ VLR++ +         ++ ++   +++R +R PR  
Sbjct: 60  VLMNVEAGQEVMDELETAFRFNDAVLRNMIMRTKGAVTEQSIMLK--QKEERAERAPRRD 117

Query: 121 N 121
           +
Sbjct: 118 D 118


>gi|294677547|ref|YP_003578162.1| 30S ribosomal protein S6 [Rhodobacter capsulatus SB 1003]
 gi|7388214|sp|O68126|RS6_RHOCA RecName: Full=30S ribosomal protein S6
 gi|3128364|gb|AAC16216.1| potential 30S ribosomal protein S6 [Rhodobacter capsulatus SB 1003]
 gi|294476367|gb|ADE85755.1| 30S ribosomal protein S6 [Rhodobacter capsulatus SB 1003]
          Length = 144

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 73/106 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + ++I +NGG+V      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVLIARQDLSNAQAEGLIEHFSTVIGDNGGKVLGTEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P AA+ EM+R  R+ ++V+R LT+ VD H++ P++ +Q+
Sbjct: 61  GFLRTDAPSAAVQEMERLARLHDDVMRVLTIKVDGHDEGPSVQMQK 106


>gi|254294299|ref|YP_003060322.1| ribosomal protein S6 [Hirschia baltica ATCC 49814]
 gi|254042830|gb|ACT59625.1| ribosomal protein S6 [Hirschia baltica ATCC 49814]
          Length = 134

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 68/104 (65%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YEHV + R D+S QQ++  + +  +++ E  G V      G+R +AY I K+RK +Y
Sbjct: 1   MAFYEHVVISRPDVSPQQVETLVEELTAIVTEKEGTVAKTEYWGLRNLAYPINKSRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             +NI +PPAAIHE++R++RI+E+V+R LT+ V+   + P+  +
Sbjct: 61  SLLNIDAPPAAIHEIERRLRINEDVIRFLTIKVEELSEEPSPVL 104


>gi|58038781|ref|YP_190745.1| 30S ribosomal protein S6 [Gluconobacter oxydans 621H]
 gi|81352549|sp|Q5FU57|RS6_GLUOX RecName: Full=30S ribosomal protein S6
 gi|58001195|gb|AAW60089.1| SSU ribosomal protein S6P [Gluconobacter oxydans 621H]
          Length = 160

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 76/115 (66%), Gaps = 1/115 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE V + R D+S  Q++  +   ++L+++NGG ++     G+R++AYRI+KNRK +Y
Sbjct: 1   MPLYESVLIARNDVSQAQVETLVETIETLLKDNGGSIQKREFWGLRSLAYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
           V + +   P  + E++R++ ++E+VLR LTL VD  +++P+  + R   DDR DR
Sbjct: 61  VLLGLDCTPDTLRELERQLGLNEDVLRVLTLRVDEIDENPSSVLARKS-DDRGDR 114


>gi|83949660|ref|ZP_00958393.1| ribosomal protein S6 [Roseovarius nubinhibens ISM]
 gi|83837559|gb|EAP76855.1| ribosomal protein S6 [Roseovarius nubinhibens ISM]
          Length = 118

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  +  + +++ +NGG+V      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVFISRQDLSNTQAEGLVEHFGTVLSDNGGKVVESEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P AA+ EM+R MR+ ++V+R LT+ VD H + P++ +Q+
Sbjct: 61  AFLKSDAPAAAVQEMERLMRLHDDVMRVLTIKVDEHAEGPSVQMQK 106


>gi|77463710|ref|YP_353214.1| 30S ribosomal protein S6 [Rhodobacter sphaeroides 2.4.1]
 gi|91207787|sp|Q3J1M1|RS6_RHOS4 RecName: Full=30S ribosomal protein S6
 gi|77388128|gb|ABA79313.1| SSU ribosomal protein S6P [Rhodobacter sphaeroides 2.4.1]
          Length = 132

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 76/111 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  I  + +++ +NGG+V      G++T+AY+I KNRK +Y
Sbjct: 1   MSLYEHVFIARQDLSNAQAEGLIEHFSTVLADNGGKVVDREYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
            F+   +P AA+ EM+R MR+ ++V+R LT+ VD H + P++ +Q+ D  +
Sbjct: 61  AFLKSDAPSAAVQEMERLMRLHDDVMRVLTIKVDKHAEGPSIQMQKRDERE 111


>gi|126462539|ref|YP_001043653.1| 30S ribosomal protein S6 [Rhodobacter sphaeroides ATCC 17029]
 gi|221639576|ref|YP_002525838.1| 30S ribosomal protein S6 [Rhodobacter sphaeroides KD131]
 gi|332558561|ref|ZP_08412883.1| 30S ribosomal protein S6 [Rhodobacter sphaeroides WS8N]
 gi|166227373|sp|A3PKL5|RS6_RHOS1 RecName: Full=30S ribosomal protein S6
 gi|254765450|sp|B9KJP0|RS6_RHOSK RecName: Full=30S ribosomal protein S6
 gi|126104203|gb|ABN76881.1| SSU ribosomal protein S6P [Rhodobacter sphaeroides ATCC 17029]
 gi|221160357|gb|ACM01337.1| 30S ribosomal protein S6 [Rhodobacter sphaeroides KD131]
 gi|332276273|gb|EGJ21588.1| 30S ribosomal protein S6 [Rhodobacter sphaeroides WS8N]
          Length = 135

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 76/111 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  I  + +++ +NGG+V      G++T+AY+I KNRK +Y
Sbjct: 1   MSLYEHVFIARQDLSNAQAEGLIEHFSTVLADNGGKVVDREYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
            F+   +P AA+ EM+R MR+ ++V+R LT+ VD H + P++ +Q+ D  +
Sbjct: 61  AFLKSDAPSAAVQEMERLMRLHDDVMRVLTIKVDKHAEGPSIQMQKRDERE 111


>gi|56552121|ref|YP_162960.1| 30S ribosomal protein S6 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762067|ref|ZP_04760151.1| ribosomal protein S6 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|260752354|ref|YP_003225247.1| 30S ribosomal protein S6 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|61216127|sp|Q5NN61|RS6_ZYMMO RecName: Full=30S ribosomal protein S6
 gi|56543695|gb|AAV89849.1| ribosomal protein S6 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373533|gb|EER63120.1| ribosomal protein S6 [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|258551717|gb|ACV74663.1| ribosomal protein S6 [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 124

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 73/106 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD++  Q+        S+I+E  G+V      G+R +AYRI+KNRKAYY
Sbjct: 1   MPLYEHVFLARQDLAQTQVDGLAATATSIIEEKSGKVVKTEIWGLRNLAYRIQKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           + + I +P  AI E++R+M ++E+V+R +T+ VD+HEQ P+  ++R
Sbjct: 61  IMLEIDAPADAIQELERQMALNEDVIRYMTVRVDAHEQGPSAMMRR 106


>gi|166711572|ref|ZP_02242779.1| 30S ribosomal protein S6 [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 143

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 1/113 (0%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VFL+  D  S+Q+   I +Y+SLI+   G +  + + G R +AY I+   KA+YV
Sbjct: 3   RHYEVVFLVHPD-QSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYV 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
            +NI    A + E+    R ++ VLR L +  D  +   +L ++  D      
Sbjct: 62  LLNIEVDQAVLSELVESFRFNDAVLRHLVVKRDGPDTEQSLIMKSKDEKGDKP 114


>gi|289810179|ref|ZP_06540808.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
          Length = 123

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 65/124 (52%), Gaps = 2/124 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +P   I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119

Query: 120 RNVD 123
              D
Sbjct: 120 TADD 123


>gi|77361359|ref|YP_340934.1| 30S ribosomal protein S6 [Pseudoalteromonas haloplanktis TAC125]
 gi|91207933|sp|Q3IIA2|RS6_PSEHT RecName: Full=30S ribosomal protein S6
 gi|76876270|emb|CAI87492.1| 30S ribosomal subunit protein S6 [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 113

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVTGMIERYTGSITEAGGVIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MN+ +P   I E++   R ++ VLR+L +   +     +  ++   ++
Sbjct: 60  VLMNVEAPTEVISELETTFRYNDAVLRNLVMRTKNAVTEASPLVREEKKE 109


>gi|262275144|ref|ZP_06052955.1| SSU ribosomal protein S6p [Grimontia hollisae CIP 101886]
 gi|262221707|gb|EEY73021.1| SSU ribosomal protein S6p [Grimontia hollisae CIP 101886]
          Length = 131

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 69/132 (52%), Gaps = 1/132 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I+E+GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSIKESGGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +  + I E++   R ++ V+R++ +        P++ ++  +          + 
Sbjct: 60  VLMNVEAEQSVIDELETAFRFNDAVIRNMIMRTKGAITEPSVMMKAKEERAPRREERAEV 119

Query: 121 NVDRKQHVSEEK 132
           +V  ++  +  +
Sbjct: 120 SVQSEEDEAAAE 131


>gi|209696172|ref|YP_002264102.1| 30S ribosomal protein S6 [Aliivibrio salmonicida LFI1238]
 gi|226703414|sp|B6EMP6|RS6_ALISL RecName: Full=30S ribosomal protein S6
 gi|208010125|emb|CAQ80450.1| 30S ribosomal protein S6 [Aliivibrio salmonicida LFI1238]
          Length = 126

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 61/113 (53%), Gaps = 1/113 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQMAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
           V MN+ S  AAI E++   R ++ VLR++ +   +    P++ ++  +     
Sbjct: 60  VLMNVESEQAAIDELETAFRYNDAVLRNMIMRTKAAITEPSVMMKAKEERTAK 112


>gi|167855347|ref|ZP_02478114.1| 30S ribosomal protein S6 [Haemophilus parasuis 29755]
 gi|219871262|ref|YP_002475637.1| 30S ribosomal protein S6 [Haemophilus parasuis SH0165]
 gi|254765440|sp|B8F5T7|RS6_HAEPS RecName: Full=30S ribosomal protein S6
 gi|167853495|gb|EDS24742.1| 30S ribosomal protein S6 [Haemophilus parasuis 29755]
 gi|219691466|gb|ACL32689.1| 30S ribosomal protein S6 [Haemophilus parasuis SH0165]
          Length = 126

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 61/111 (54%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + ++E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTASVKEAGGQVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MN+ +P   I E++   R ++ VLRSL L   +     +  ++  D   
Sbjct: 60  VLMNVEAPQNVIDELETNFRYNDAVLRSLVLHTKAAVTEASPMLKAKDERK 110


>gi|87119508|ref|ZP_01075405.1| 30S ribosomal protein S6 [Marinomonas sp. MED121]
 gi|86164984|gb|EAQ66252.1| 30S ribosomal protein S6 [Marinomonas sp. MED121]
          Length = 135

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y +LI E+GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPAMVERYTNLITEDGGQVHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN-DRFPRD 119
           V MNI +  A + E+    R ++ ++R+L +         +       R+DR   R  R 
Sbjct: 60  VLMNIEASEAVMSELNDTFRYNDAIIRNLVIRRKGAVTEVSPIKAAESREDRRAPREERQ 119

Query: 120 RNVDRKQHVSEE 131
              +  +  +EE
Sbjct: 120 ERTEAAETPAEE 131


>gi|255262950|ref|ZP_05342292.1| ribosomal protein S6 [Thalassiobium sp. R2A62]
 gi|255105285|gb|EET47959.1| ribosomal protein S6 [Thalassiobium sp. R2A62]
          Length = 117

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  I  + +++ +NGG+V      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVFIARQDLSNTQAESLIEHFSTVLADNGGKVADSEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  A+ EM+R MR+ ++V+R LT+ VD HE+ P++ +Q+
Sbjct: 61  AFLRSDAPAPAVQEMERLMRLHDDVMRVLTIKVDEHEEGPSVQMQK 106


>gi|298291083|ref|YP_003693022.1| ribosomal protein S6 [Starkeya novella DSM 506]
 gi|296927594|gb|ADH88403.1| ribosomal protein S6 [Starkeya novella DSM 506]
          Length = 164

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 53/114 (46%), Positives = 84/114 (73%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+++QQ+++   +++ +I+ NGG V      G++T+ YRIRKNRKA++
Sbjct: 1   MALYEHVFLARQDVTAQQVEELTARFKGIIEANGGSVTKAEYWGVKTLTYRIRKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +N+ +P AAI E++R+ RIDE+VLR LT+ V+  E+  ++ +Q+ DRDDR +
Sbjct: 61  SLLNVDAPAAAIAELERQQRIDEDVLRFLTIRVEELEEGQSVMLQKRDRDDRGE 114


>gi|209885492|ref|YP_002289349.1| 30S ribosomal protein S6 (RRP-S6) [Oligotropha carboxidovorans OM5]
 gi|226695108|sp|B6JGN7|RS6_OLICO RecName: Full=30S ribosomal protein S6
 gi|209873688|gb|ACI93484.1| 30S ribosomal protein S6 (RRP-S6) [Oligotropha carboxidovorans OM5]
          Length = 144

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 53/144 (36%), Positives = 84/144 (58%), Gaps = 13/144 (9%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YEHVFL RQD S+QQ+++   Q   +I+  GG+V      G+R++ YRI+KNRKA++
Sbjct: 1   MPYYEHVFLARQDASAQQVEELTTQITGVIEGLGGKVTKTESWGVRSLTYRIQKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD--------- 111
           V +NI  P   + E++R+ RI+E+++R LT+ VD  E+ P+  +++ DRD          
Sbjct: 61  VLLNIDGPATIVAEVERQERINEDIIRYLTVRVDELEEGPSAMMRKADRDRERDERGGPR 120

Query: 112 ----RNDRFPRDRNVDRKQHVSEE 131
               R++R PR    +      EE
Sbjct: 121 EGGFRSERGPRRPREEETTASVEE 144


>gi|83644549|ref|YP_432984.1| 30S ribosomal protein S6 [Hahella chejuensis KCTC 2396]
 gi|123534100|sp|Q2SLB5|RS6_HAHCH RecName: Full=30S ribosomal protein S6
 gi|83632592|gb|ABC28559.1| ribosomal protein S6 [Hahella chejuensis KCTC 2396]
          Length = 142

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 1/117 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V ++  D  S+Q+   + +Y S +   GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVIMVHPD-QSEQVPAMVERYTSSVNAGGGKVHRLEDWGRRHMAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFP 117
           V MNI      I E+    R ++ +LR L +         +       R+ R  R  
Sbjct: 60  VLMNIECSQEVIDELMHNFRFNDAILRDLVIRRKDAVTEVSPIKAAESREQRAPRGE 116


>gi|269137724|ref|YP_003294424.1| 30S ribosomal protein S6 [Edwardsiella tarda EIB202]
 gi|267983384|gb|ACY83213.1| 30S ribosomal protein S6 [Edwardsiella tarda EIB202]
 gi|304557780|gb|ADM40444.1| SSU ribosomal protein S6p [Edwardsiella tarda FL6-60]
          Length = 131

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 36/132 (27%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +    I E++   R ++ V+RS+ +         +  ++ + +R +R + F  +
Sbjct: 60  VLMNVEASQEVIDELETNFRYNDAVIRSMVMRTKHAVTEASPMVKAKDERRERREDFANE 119

Query: 120 RNVDRKQHVSEE 131
            + + +   SEE
Sbjct: 120 TSEETEAGDSEE 131


>gi|296136560|ref|YP_003643802.1| ribosomal protein S6 [Thiomonas intermedia K12]
 gi|294340688|emb|CAZ89080.1| 30S ribosomal protein S6 [Thiomonas sp. 3As]
 gi|295796682|gb|ADG31472.1| ribosomal protein S6 [Thiomonas intermedia K12]
          Length = 120

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 35/118 (29%), Positives = 63/118 (53%), Gaps = 1/118 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V +   D  S+Q+   I +Y+S +    G++  V + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVLIFHPD-QSEQVPAMIERYKSAVTAKAGQIHRVEDWGRRQLAYPIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPR 118
             MNI      + E++   + ++ VLRSL +  D  E +P++ +++ +RD+       
Sbjct: 60  ACMNIECDLETLRELEHSFKFNDAVLRSLVIKTDKAETAPSIMMKQVERDEARKAQQE 117


>gi|89068232|ref|ZP_01155642.1| Ribosomal protein S6 [Oceanicola granulosus HTCC2516]
 gi|89046149|gb|EAR52207.1| Ribosomal protein S6 [Oceanicola granulosus HTCC2516]
          Length = 118

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  I  +  ++ +N G+V      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVFIARQDLSNAQAEGLIEHFSQVLADNDGKVVDTEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  A+ EM+R MR+ ++V+R LT+ VD HE+ P++ +Q+
Sbjct: 61  AFLKTDAPAPAVQEMERLMRLHDDVMRVLTIRVDEHEEGPSIQMQK 106


>gi|319405480|emb|CBI79099.1| 30S ribosomal protein S6 [Bartonella sp. AR 15-3]
          Length = 135

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 58/128 (45%), Positives = 88/128 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+FL+RQDI+ QQI + +  Y+ +I+ +GG+V  +   G+R++AYRIRKNRKAYY
Sbjct: 1   MALYEHIFLVRQDIAPQQIDELLETYKGVIEAHGGKVGRIENWGLRSLAYRIRKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI +P  AI E++R+MRI+E++LR +T+ V  HE+  + T+ R +RD    +     
Sbjct: 61  VLINIDAPAQAIAELERQMRINEDILRYMTIHVKKHEKEQSTTLSRFNRDSLPAQNEEKA 120

Query: 121 NVDRKQHV 128
              R+QH 
Sbjct: 121 QNLRRQHE 128


>gi|296532306|ref|ZP_06895045.1| 30S ribosomal protein S6 [Roseomonas cervicalis ATCC 49957]
 gi|296267382|gb|EFH13268.1| 30S ribosomal protein S6 [Roseomonas cervicalis ATCC 49957]
          Length = 171

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/129 (34%), Positives = 76/129 (58%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE V + R D++  Q++    Q  S+I E GGEV+     G+R +AYRI+KNRKA+Y
Sbjct: 16  MPLYETVLIARNDLTQAQVEAIADQVTSVITEAGGEVKKREYWGLRGLAYRIKKNRKAHY 75

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + + +  P AA  E+ R++ ++E+VLR +TL +++ +++P+  + +   D   DR  R  
Sbjct: 76  MLLGLDCPAAAEQEVARQLGLNEDVLRHMTLRIEAIDEAPSAILAKRGDDRERDRGFRGP 135

Query: 121 NVDRKQHVS 129
                +  S
Sbjct: 136 RPAAGRFSS 144


>gi|258546024|ref|ZP_05706258.1| 30S ribosomal protein S6 [Cardiobacterium hominis ATCC 15826]
 gi|258518753|gb|EEV87612.1| 30S ribosomal protein S6 [Cardiobacterium hominis ATCC 15826]
          Length = 110

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 56/110 (50%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+     +Y+ +++   G+V    + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVNAMSERYRGIVEAAKGKVHRFEDWGRRVLAYPINKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MNI    A + E++   R ++ +LR LT+  D      +       ++
Sbjct: 60  VMMNIECDAATLAELENNFRFNDAILRHLTIRRDEAVTEASPMADSKKKE 109


>gi|325144537|gb|EGC66836.1| ribosomal protein S6 [Neisseria meningitidis M01-240013]
          Length = 122

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   + +Y+++I E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI + P  + E++   R ++ VLR L +         +  +      +
Sbjct: 60  VLMNIETTPEVVEELETAFRFNDAVLRHLAIKTKHAVTEASPMLGGEKAKN 110


>gi|153007914|ref|YP_001369129.1| 30S ribosomal protein S6 [Ochrobactrum anthropi ATCC 49188]
 gi|166227357|sp|A6WWE6|RS6_OCHA4 RecName: Full=30S ribosomal protein S6
 gi|151559802|gb|ABS13300.1| ribosomal protein S6 [Ochrobactrum anthropi ATCC 49188]
          Length = 151

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 53/104 (50%), Positives = 75/104 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV L RQDIS QQ+   + QY+ +++ NGG+V  V   G+R + YRI+KNRKAYY
Sbjct: 1   MALYEHVLLARQDISQQQVDALVEQYKGVLEANGGKVGKVESWGLRPLTYRIKKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             +NI +P AA+ EM+R+MRI+E+VLR LT+ V+ HE+  +  +
Sbjct: 61  TLVNIDAPAAAVAEMERQMRINEDVLRFLTVRVEEHEEGQSAML 104


>gi|89900977|ref|YP_523448.1| 30S ribosomal protein S6 [Rhodoferax ferrireducens T118]
 gi|123278761|sp|Q21WD6|RS6_RHOFD RecName: Full=30S ribosomal protein S6
 gi|89345714|gb|ABD69917.1| SSU ribosomal protein S6P [Rhodoferax ferrireducens T118]
          Length = 121

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 64/119 (53%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + ++  D  S+Q+   + +Y+ +I   GG+V  V + G R + Y I K  KA+Y
Sbjct: 1   MRHYEIILMIHPD-QSEQVPAMLERYKGMITAGGGKVHRVEDWGRRQLVYMINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           + +NI +  A + E++   + ++ VLR LT+L    +  P+  ++  +R+D       +
Sbjct: 60  LCVNIEADQAVMAELEHAFKFNDAVLRHLTVLKKKADTGPSSMMKTVEREDARKTQQAE 118


>gi|323142970|ref|ZP_08077678.1| ribosomal protein S6 [Succinatimonas hippei YIT 12066]
 gi|322417243|gb|EFY07869.1| ribosomal protein S6 [Succinatimonas hippei YIT 12066]
          Length = 139

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 70/127 (55%), Gaps = 6/127 (4%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S Q+   I +Y+  I++ GG++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSDQVPGMIERYKGEIEKTGGKIHRLEDWGRRQLAYPIQKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +   AI  ++   R ++ V+R+L +  +      +  ++      R +R  R+ 
Sbjct: 60  VLMNVEAEQEAIDSIENNFRFNDAVIRNLVIRTNGPVTEQSPMMKA-----REERRARED 114

Query: 121 NVDRKQH 127
           + +++QH
Sbjct: 115 DGEQRQH 121


>gi|170751791|ref|YP_001758051.1| ribosomal protein S6 [Methylobacterium radiotolerans JCM 2831]
 gi|226703487|sp|B1LYI4|RS6_METRJ RecName: Full=30S ribosomal protein S6
 gi|170658313|gb|ACB27368.1| ribosomal protein S6 [Methylobacterium radiotolerans JCM 2831]
          Length = 154

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 49/105 (46%), Positives = 78/105 (74%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV L RQD++SQQ++  I  Y+ +I++NGG +  +   G++++AYRI+KNRKA++
Sbjct: 1   MPLYEHVLLARQDVTSQQVETMIDTYKGVIEQNGGRLEKIEMWGVKSLAYRIKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
             +NI +PPAAI EM+R+M+I E+VLR +T+ V+  +  P+  +Q
Sbjct: 61  ALLNIDAPPAAIAEMERQMQISEDVLRFMTIRVEELDSEPSAMMQ 105


>gi|59712919|ref|YP_205695.1| 30S ribosomal protein S6 [Vibrio fischeri ES114]
 gi|197336125|ref|YP_002157108.1| ribosomal protein S6 [Vibrio fischeri MJ11]
 gi|75353318|sp|Q5E2D9|RS6_VIBF1 RecName: Full=30S ribosomal protein S6
 gi|226705646|sp|B5FBQ3|RS6_VIBFM RecName: Full=30S ribosomal protein S6
 gi|59481020|gb|AAW86807.1| 30S ribosomal subunit protein S6 [Vibrio fischeri ES114]
 gi|197317615|gb|ACH67062.1| ribosomal protein S6 [Vibrio fischeri MJ11]
          Length = 126

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 60/113 (53%), Gaps = 1/113 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGTIHRLEDWGRRQMAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
           V MN+ S  A I E++   R ++ VLR++ +   +    P++ ++  +     
Sbjct: 60  VLMNVESEQAVIDELETAFRYNDAVLRNMIMRTKAAITEPSVMMKAKEERSAK 112


>gi|145297776|ref|YP_001140617.1| 30S ribosomal protein S6 [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|166226796|sp|A4SIZ7|RS6_AERS4 RecName: Full=30S ribosomal protein S6
 gi|142850548|gb|ABO88869.1| ribosomal protein S6 [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 129

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 36/130 (27%), Positives = 63/130 (48%), Gaps = 2/130 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I   GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITTAGGTIHRMEDWGRRQLAYPIDKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +  A I E++   R ++ V+R++ +         +   + + +R  R D   R+
Sbjct: 60  VLMNVEAEQAVIDELETNFRFNDAVIRNMIMRTKHAVTEVSPMAKAKEERFVRRDDERRE 119

Query: 120 RNVDRKQHVS 129
             V+      
Sbjct: 120 DTVEAASSEE 129


>gi|307946730|ref|ZP_07662065.1| 30S ribosomal protein S6 [Roseibium sp. TrichSKD4]
 gi|307770394|gb|EFO29620.1| 30S ribosomal protein S6 [Roseibium sp. TrichSKD4]
          Length = 136

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 78/106 (73%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S+QQ++  + QY+ +++  GG V  +   G+R++AYRI+KNRKA+Y
Sbjct: 1   MPLYEHVFLARQDVSAQQVEQLVEQYKGVLEAGGGSVGKIENWGLRSLAYRIKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             MNI +P AA+ EM+R+M + E++LR +T  V+ HE+ P+  +Q+
Sbjct: 61  TLMNITAPHAAVAEMERQMGLSEDILRFMTFKVEEHEEEPSAMMQK 106


>gi|126725406|ref|ZP_01741248.1| ribosomal protein S6 [Rhodobacterales bacterium HTCC2150]
 gi|126704610|gb|EBA03701.1| ribosomal protein S6 [Rhodobacterales bacterium HTCC2150]
          Length = 118

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 75/106 (70%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  I  + +++ +NGG+V      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVFISRQDLSNTQAEGLIEHFTAVLADNGGKVVENEYWGIKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  AI EM+R MR+ ++V+R LT+ VD+H++ P++ +Q+
Sbjct: 61  AFLKTDAPATAIQEMERLMRLHDDVMRILTIKVDAHDEGPSVQMQK 106


>gi|226942912|ref|YP_002797985.1| 30S ribosomal protein S6 [Azotobacter vinelandii DJ]
 gi|259495325|sp|C1DLR2|RS6_AZOVD RecName: Full=30S ribosomal protein S6
 gi|226717839|gb|ACO77010.1| 30S ribosomal protein S6 [Azotobacter vinelandii DJ]
          Length = 136

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  D      +  ++
Sbjct: 60  VLINVECSGKALSELEDNFRYNDAVIRNLVIRRDEAITGQSEMLK 104


>gi|304319742|ref|YP_003853385.1| 30S ribosomal protein S6 [Parvularcula bermudensis HTCC2503]
 gi|303298645|gb|ADM08244.1| ribosomal protein S6 [Parvularcula bermudensis HTCC2503]
          Length = 110

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 76/110 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQDIS  Q++    + Q++I+ENGGE+R     G+R + Y+I KNRK +Y
Sbjct: 1   MPLYEHVFVARQDISPAQVEALTDELQTIIRENGGEIRKSEYWGLRNLQYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
             MNI SP  AI E++R+MRI E++LR +TL V+ H+  P+  + R DRD
Sbjct: 61  SLMNIDSPSEAIVELERQMRIKEDILRFMTLKVEEHDDEPSPVMSRRDRD 110


>gi|117617863|ref|YP_855252.1| 30S ribosomal protein S6 [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|330831138|ref|YP_004394090.1| 30S ribosomal protein S6 [Aeromonas veronii B565]
 gi|166226795|sp|A0KG67|RS6_AERHH RecName: Full=30S ribosomal protein S6
 gi|117559270|gb|ABK36218.1| ribosomal protein S6 [Aeromonas hydrophila subsp. hydrophila ATCC
           7966]
 gi|328806274|gb|AEB51473.1| 30S ribosomal protein S6 [Aeromonas veronii B565]
          Length = 128

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 1/118 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I  +GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITTSGGTIHRLEDWGRRQLAYPIDKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPR 118
           V MN+ +  A I E++   R ++ V+R++ +         +   +  +         R
Sbjct: 60  VLMNVEAEQAVIDELETNFRFNDAVIRNMIMRTKHAVTEVSPMAKAKEERFTRRDDER 117


>gi|21242370|ref|NP_641952.1| 30S ribosomal protein S6 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|78047217|ref|YP_363392.1| 30S ribosomal protein S6 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|294626363|ref|ZP_06704965.1| 30S ribosomal protein S6 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294665955|ref|ZP_06731219.1| 30S ribosomal protein S6 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325928162|ref|ZP_08189371.1| SSU ribosomal protein S6P [Xanthomonas perforans 91-118]
 gi|24212288|sp|Q8PM14|RS6_XANAC RecName: Full=30S ribosomal protein S6
 gi|91207801|sp|Q3BV21|RS6_XANC5 RecName: Full=30S ribosomal protein S6
 gi|21107807|gb|AAM36488.1| 30S ribosomal protein S6 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|78035647|emb|CAJ23338.1| 30S ribosomal protein S6 [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|292599364|gb|EFF43499.1| 30S ribosomal protein S6 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292604258|gb|EFF47645.1| 30S ribosomal protein S6 [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325541458|gb|EGD12991.1| SSU ribosomal protein S6P [Xanthomonas perforans 91-118]
          Length = 143

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 58/113 (51%), Gaps = 1/113 (0%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VFL+  D  S+Q+   I +Y+SLI+   G +  + + G R +AY I+   KA+YV
Sbjct: 3   RHYEVVFLVHPD-QSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYV 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
            +NI    A + E+    R ++ VLR L +  D  +   +L ++  D      
Sbjct: 62  LLNIEVDQAVLSELVESFRFNDAVLRHLVVKRDGADTEQSLIMKSKDEKGDKP 114


>gi|58582039|ref|YP_201055.1| 30S ribosomal protein S6 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84623951|ref|YP_451323.1| 30S ribosomal protein S6 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188576348|ref|YP_001913277.1| 30S ribosomal protein S6 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|75435315|sp|Q5H051|RS6_XANOR RecName: Full=30S ribosomal protein S6
 gi|91207802|sp|Q2P328|RS6_XANOM RecName: Full=30S ribosomal protein S6
 gi|226705648|sp|B2SIV0|RS6_XANOP RecName: Full=30S ribosomal protein S6
 gi|58426633|gb|AAW75670.1| 30S ribosomal protein S6 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84367891|dbj|BAE69049.1| 30S ribosomal protein S6 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188520800|gb|ACD58745.1| 30S ribosomal protein S6 [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 143

 Score =  124 bits (312), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 1/109 (0%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VFL+  D  S+Q+   I +Y+SLI+   G +  + + G R +AY I+   KA+YV
Sbjct: 3   RHYEVVFLVHPD-QSEQVPAMIERYKSLIEGGNGTIHRLEDWGRRQLAYPIQNLVKAHYV 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
            +NI    A + E+    R ++ VLR L +  D  +   +L ++  D  
Sbjct: 62  LLNIEVDQAVLSELVESFRFNDAVLRHLVVKRDGPDTEQSLIMKSKDEK 110


>gi|319898718|ref|YP_004158811.1| 30S ribosomal protein S6 [Bartonella clarridgeiae 73]
 gi|319402682|emb|CBI76228.1| 30S ribosomal protein S6 [Bartonella clarridgeiae 73]
          Length = 135

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 58/119 (48%), Positives = 86/119 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDI+ Q+I + +  Y+ +I+ +GG+V  +   G+R++AYRIRKNRKAYY
Sbjct: 1   MALYEHVFLARQDIAPQRIDELLETYKGVIEAHGGKVGRIENWGLRSLAYRIRKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           V MNI +P AAI E++R+MRI+E++LR +T+ V+ HE+  + T+ R +RDD   +    
Sbjct: 61  VLMNIDAPAAAIVELERQMRINEDILRYMTIRVEKHEKEQSTTLSRLNRDDFPSKNEEK 119


>gi|56697142|ref|YP_167505.1| 30S ribosomal protein S6 [Ruegeria pomeroyi DSS-3]
 gi|81349630|sp|Q5LR50|RS6_SILPO RecName: Full=30S ribosomal protein S6
 gi|56678879|gb|AAV95545.1| ribosomal protein S6 [Ruegeria pomeroyi DSS-3]
          Length = 117

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +NGG +      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNTQAEGLIEHFGAVLSDNGGSLVDHEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P +A+ EM+R MR+ ++V+R LT+ VD H + P++ +Q+
Sbjct: 61  AFLRTDAPASAVQEMERLMRLHDDVMRVLTIKVDEHAEGPSVQMQK 106


>gi|319408307|emb|CBI81960.1| 30S ribosomal protein S6 [Bartonella schoenbuchensis R1]
          Length = 135

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 54/132 (40%), Positives = 87/132 (65%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQ ++ QQI + +  Y+++I+ +GG +  +   G+ T+AYRIRKNRKA+Y
Sbjct: 1   MALYEHVFLARQGVTPQQIDELLKIYKNVIEAHGGTIGRIENWGLCTLAYRIRKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI +P AA+ E++R+MRI+E+VLR +T+ V+ HE+  +  + R +++D   +     
Sbjct: 61  VLLNIDAPAAAMAEIERQMRINEDVLRYMTIRVEKHEKEQSAMLSRSNQEDSFSKNEERS 120

Query: 121 NVDRKQHVSEEK 132
              R QH    +
Sbjct: 121 RPTRHQHEDTTE 132


>gi|53729064|ref|ZP_00348308.1| COG0360: Ribosomal protein S6 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|165976599|ref|YP_001652192.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|190150499|ref|YP_001969024.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|254361767|ref|ZP_04977902.1| ribosomal protein S6 [Mannheimia haemolytica PHL213]
 gi|261494031|ref|ZP_05990534.1| 30S ribosomal protein S6 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261496209|ref|ZP_05992615.1| 30S ribosomal protein S6 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|303250079|ref|ZP_07336281.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|303253252|ref|ZP_07339401.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|307246087|ref|ZP_07528169.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|307248195|ref|ZP_07530223.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|307250427|ref|ZP_07532374.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|307252812|ref|ZP_07534702.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|307255068|ref|ZP_07536886.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|307257227|ref|ZP_07538998.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307259505|ref|ZP_07541230.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307261654|ref|ZP_07543321.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307263842|ref|ZP_07545447.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|322515406|ref|ZP_08068398.1| 30S ribosomal protein S6 [Actinobacillus ureae ATCC 25976]
 gi|226703411|sp|B3GY59|RS6_ACTP7 RecName: Full=30S ribosomal protein S6
 gi|226703412|sp|B0BQB3|RS6_ACTPJ RecName: Full=30S ribosomal protein S6
 gi|153093302|gb|EDN74298.1| ribosomal protein S6 [Mannheimia haemolytica PHL213]
 gi|165876700|gb|ABY69748.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 3
           str. JL03]
 gi|189915630|gb|ACE61882.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|261308161|gb|EEY09458.1| 30S ribosomal protein S6 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261310197|gb|EEY11397.1| 30S ribosomal protein S6 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|302647934|gb|EFL78141.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 2
           str. 4226]
 gi|302651142|gb|EFL81296.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306853022|gb|EFM85245.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 1
           str. 4074]
 gi|306855372|gb|EFM87547.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 2
           str. S1536]
 gi|306857556|gb|EFM89665.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 4
           str. M62]
 gi|306859711|gb|EFM91734.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 6
           str. Femo]
 gi|306861941|gb|EFM93917.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar 9
           str. CVJ13261]
 gi|306864269|gb|EFM96181.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306866441|gb|EFM98304.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306868646|gb|EFN00456.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306870831|gb|EFN02570.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|322118561|gb|EFX90793.1| 30S ribosomal protein S6 [Actinobacillus ureae ATCC 25976]
          Length = 124

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + ++E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMIERYTASVKEAGGQVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MN+ +P + I E++   R ++ VLR+L +   +     +  ++  +  
Sbjct: 60  VLMNVEAPQSVIDELETNFRYNDAVLRNLIVHTKAAVTEASPMVKAKESK 109


>gi|319941488|ref|ZP_08015816.1| 30S ribosomal protein S6 [Sutterella wadsworthensis 3_1_45B]
 gi|319805108|gb|EFW01938.1| 30S ribosomal protein S6 [Sutterella wadsworthensis 3_1_45B]
          Length = 128

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 61/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE   ++  D  S+Q+   I +Y++L+ E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEICIVVHPD-QSEQVPAMIERYKTLVAEQGGKIHRIEDWGRRPLAYPIEKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V +NI      I E++   R ++ VLR LT+     E +P+  ++  ++
Sbjct: 60  VLLNIECGHETILEIENGFRFNDAVLRHLTVKTKHAETAPSPMMKVIEK 108


>gi|240948274|ref|ZP_04752660.1| 30S ribosomal protein S6 [Actinobacillus minor NM305]
 gi|240297313|gb|EER47854.1| 30S ribosomal protein S6 [Actinobacillus minor NM305]
          Length = 122

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 65/123 (52%), Gaps = 1/123 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I++ GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMIERYTASIKDAGGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P + I E++   R ++ VLR+L +   +     +  ++  +    +     + 
Sbjct: 60  VLMNVEAPQSVIDELETNFRYNDAVLRNLIVHTKAAVTEASPMVKAKESKASDIVVEVEE 119

Query: 121 NVD 123
             +
Sbjct: 120 AGE 122


>gi|115525311|ref|YP_782222.1| 30S ribosomal protein S6 [Rhodopseudomonas palustris BisA53]
 gi|122295615|sp|Q07LE2|RS6_RHOP5 RecName: Full=30S ribosomal protein S6
 gi|115519258|gb|ABJ07242.1| SSU ribosomal protein S6P [Rhodopseudomonas palustris BisA53]
          Length = 157

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 75/106 (70%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD S+QQ+++   Q   +I+  GG+V  +   G+R++ YR+ KNRKA++
Sbjct: 1   MPLYEHVFLARQDASTQQVEELTTQITGVIEGLGGKVVKMEAWGVRSLTYRMNKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI  P A + E++R+ RI+E+V+R LT+ VD HE+ P+  +++
Sbjct: 61  VLLNIDGPSAVVAEVERQERINEDVIRYLTVRVDEHEEGPSAMMRK 106


>gi|251793278|ref|YP_003008006.1| 30S ribosomal protein S6 [Aggregatibacter aphrophilus NJ8700]
 gi|315633587|ref|ZP_07888877.1| 30S ribosomal protein S6 [Aggregatibacter segnis ATCC 33393]
 gi|247534673|gb|ACS97919.1| ribosomal protein S6 [Aggregatibacter aphrophilus NJ8700]
 gi|315477629|gb|EFU68371.1| 30S ribosomal protein S6 [Aggregatibacter segnis ATCC 33393]
          Length = 125

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 63/126 (50%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   ++E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGSVKEAGGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ VLRSL +         +  ++  D          + 
Sbjct: 60  VLMNVEAPQQVIDELETTFRYNDAVLRSLVIHTKHAVTEASPMVKAKDDRKALTEVESND 119

Query: 121 NVDRKQ 126
             D ++
Sbjct: 120 FEDAEE 125


>gi|254464513|ref|ZP_05077924.1| ribosomal protein S6 [Rhodobacterales bacterium Y4I]
 gi|206685421|gb|EDZ45903.1| ribosomal protein S6 [Rhodobacterales bacterium Y4I]
          Length = 117

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 73/106 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +NGG++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNSQAEGLIEHFGAVLSDNGGKLVDQEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P +A+ EM+R MR+ ++V+R LT+ VD H + P++ +Q+
Sbjct: 61  AFLRTDAPASAVQEMERLMRLHDDVMRVLTIKVDEHAEGPSVQMQK 106


>gi|167646474|ref|YP_001684137.1| 30S ribosomal protein S6 [Caulobacter sp. K31]
 gi|189045459|sp|B0SWL1|RS6_CAUSK RecName: Full=30S ribosomal protein S6
 gi|167348904|gb|ABZ71639.1| ribosomal protein S6 [Caulobacter sp. K31]
          Length = 126

 Score =  124 bits (311), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 78/122 (63%), Gaps = 1/122 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YEHV + RQDIS QQ +    Q ++L++ENGG +  +   G+R + YRI+KNRK +Y
Sbjct: 1   MAFYEHVVIARQDISPQQAEALNEQLKALLEENGGHIAKIEYWGLRNLTYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             + I +P AA+ EM+R++ I+E+VLR +T+ V+  +   +  + R DR +R +R  R R
Sbjct: 61  SLLAIDAPAAAVKEMERQLLINEDVLRFMTIRVEELDLELSPVLARRDR-ERGERSERPR 119

Query: 121 NV 122
           + 
Sbjct: 120 DD 121


>gi|120609915|ref|YP_969593.1| 30S ribosomal protein S6 [Acidovorax citrulli AAC00-1]
 gi|326316062|ref|YP_004233734.1| 30S ribosomal protein S6 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|166226789|sp|A1TLI1|RS6_ACIAC RecName: Full=30S ribosomal protein S6
 gi|120588379|gb|ABM31819.1| SSU ribosomal protein S6P [Acidovorax citrulli AAC00-1]
 gi|323372898|gb|ADX45167.1| 30S ribosomal protein S6 [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 125

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 66/126 (52%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + L+  D  S+Q+   + +Y+ +I   GG++  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIILLIHPD-QSEQVPAMLERYKGMITAGGGKIHRVEDWGRRQLAYMINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + +NI +  A + E++   + ++ VLR LT++    E   +  ++  +R++       + 
Sbjct: 60  LCVNIEADQAVMAELEHAFKFNDAVLRHLTVVKKKAETGASSMMKTVEREEARKASQAEF 119

Query: 121 NVDRKQ 126
               ++
Sbjct: 120 AAANER 125


>gi|110634266|ref|YP_674474.1| 30S ribosomal protein S6 [Mesorhizobium sp. BNC1]
 gi|123162195|sp|Q11H16|RS6_MESSB RecName: Full=30S ribosomal protein S6
 gi|110285250|gb|ABG63309.1| SSU ribosomal protein S6P [Chelativorans sp. BNC1]
          Length = 148

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 48/105 (45%), Positives = 78/105 (74%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S+QQ+   + QY+ +I+  GG+V  +   G++++AYRI+KNRKAY+
Sbjct: 1   MALYEHVFLARQDLSAQQVDALVEQYKGVIESGGGKVGRIENWGVKSLAYRIKKNRKAYF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
             M++ +P  A+ EM+R+M I E++LR +T+ V++HE+ P+  +Q
Sbjct: 61  TLMDLDAPAEAVKEMERQMGISEDILRFMTIRVEAHEEGPSAMLQ 105


>gi|90423799|ref|YP_532169.1| 30S ribosomal protein S6 [Rhodopseudomonas palustris BisB18]
 gi|122476387|sp|Q215T6|RS6_RHOPB RecName: Full=30S ribosomal protein S6
 gi|90105813|gb|ABD87850.1| SSU ribosomal protein S6P [Rhodopseudomonas palustris BisB18]
          Length = 168

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 75/106 (70%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD S+QQ+++   Q  S+I+  GG+V  +   G+R++ YR+ KNRKA++
Sbjct: 1   MPLYEHVFLARQDASTQQVEELTTQITSVIEGLGGKVVKMESWGVRSLTYRMHKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI  P A + E++R+ RI+E+V+R LT+ VD  E+ P+  +++
Sbjct: 61  VLLNIDGPSAVVAEVERQERINEDVIRYLTVRVDELEEGPSAMMRK 106


>gi|152978439|ref|YP_001344068.1| 30S ribosomal protein S6 [Actinobacillus succinogenes 130Z]
 gi|189045452|sp|A6VMD6|RS6_ACTSZ RecName: Full=30S ribosomal protein S6
 gi|150840162|gb|ABR74133.1| ribosomal protein S6 [Actinobacillus succinogenes 130Z]
          Length = 126

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 61/127 (48%), Gaps = 1/127 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   ++E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGSVKEAGGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ VLR++ +         +   +  D            
Sbjct: 60  VLMNVEAPQEVIDELETTFRYNDAVLRNVIIRTKHAVTEASPMAKAKDERKVAVAEVETN 119

Query: 121 NVDRKQH 127
           N +  + 
Sbjct: 120 NFEDAEE 126


>gi|254473348|ref|ZP_05086745.1| 30S ribosomal protein S6 [Pseudovibrio sp. JE062]
 gi|211957464|gb|EEA92667.1| 30S ribosomal protein S6 [Pseudovibrio sp. JE062]
          Length = 140

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 53/140 (37%), Positives = 87/140 (62%), Gaps = 14/140 (10%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDIS+QQ++  + Q++++++ENGG+V  +   G+RT+ YRI KNRKA+Y
Sbjct: 1   MALYEHVFLARQDISTQQVEALVEQFKTVLEENGGKVGKIESWGLRTLTYRINKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD------------ 108
           + MN+ +P AA+ EM+R+  ++E++LR +T+ V+  ++  +  +Q+ D            
Sbjct: 61  ILMNVDAPHAAVAEMERQQGLNEDILRFMTIRVEELDEEQSAMMQKRDRDDRRRGDRNDR 120

Query: 109 --RDDRNDRFPRDRNVDRKQ 126
             R DR  R  R       +
Sbjct: 121 GPRPDRGPRPDRRPEAPAAE 140


>gi|304413762|ref|ZP_07395206.1| 30S ribosomal subunit protein S6 [Candidatus Regiella insecticola
           LSR1]
 gi|304283853|gb|EFL92247.1| 30S ribosomal subunit protein S6 [Candidatus Regiella insecticola
           LSR1]
          Length = 133

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 37/129 (28%), Positives = 61/129 (47%), Gaps = 1/129 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+ D I +Y  +I    G++  + + G R +AY I K  KA+Y
Sbjct: 6   MRHYEIVFMVHPD-QSEQVPDMIERYSQIITNANGQIHRLEDWGRRQLAYPINKLHKAHY 64

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V  N+ +   AI E+++  R  E VLRSL +         +  ++  D       F  + 
Sbjct: 65  VLFNVEAAQEAIDELEKSFRFSEAVLRSLVMRSKGAVTEASPMVKAKDERRDRVEFVPEN 124

Query: 121 NVDRKQHVS 129
           + D      
Sbjct: 125 SSDTGDTEE 133


>gi|84684849|ref|ZP_01012749.1| Ribosomal protein S6 [Maritimibacter alkaliphilus HTCC2654]
 gi|84667184|gb|EAQ13654.1| Ribosomal protein S6 [Rhodobacterales bacterium HTCC2654]
          Length = 121

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  +  + +++ +NGG+V      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNAQAEGLVEHFSTVLSDNGGKVVDSEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  A+ EM+R MR+ ++V+R LT+ VD+HE+ P++ +++
Sbjct: 61  AFLKTDAPSTAVQEMERLMRLHDDVMRVLTIKVDAHEEGPSVQMKK 106


>gi|256821794|ref|YP_003145757.1| 30S ribosomal protein S6 [Kangiella koreensis DSM 16069]
 gi|256795333|gb|ACV25989.1| ribosomal protein S6 [Kangiella koreensis DSM 16069]
          Length = 134

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 62/122 (50%), Gaps = 2/122 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S Q+   I +Y  +I +  G V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSDQVPGMIERYTKMITDGAGTVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +    I E++   R ++ +LR++ +         +       +D+R+++  R+ 
Sbjct: 60  VLMNVETTGEIIEELEDAFRFNDAILRNMVMRRKEAVTEASPMAAAK-KDERDEKPRREA 118

Query: 121 NV 122
            V
Sbjct: 119 EV 120


>gi|23501356|ref|NP_697483.1| 30S ribosomal protein S6 [Brucella suis 1330]
 gi|161618426|ref|YP_001592313.1| 30S ribosomal protein S6 [Brucella canis ATCC 23365]
 gi|254703806|ref|ZP_05165634.1| 30S ribosomal protein S6 [Brucella suis bv. 3 str. 686]
 gi|260566941|ref|ZP_05837411.1| ribosomal protein S6 [Brucella suis bv. 4 str. 40]
 gi|261754453|ref|ZP_05998162.1| 30S ribosomal protein S6 [Brucella suis bv. 3 str. 686]
 gi|32171565|sp|Q8G274|RS6_BRUSU RecName: Full=30S ribosomal protein S6
 gi|189045456|sp|A9M8X8|RS6_BRUC2 RecName: Full=30S ribosomal protein S6
 gi|23347249|gb|AAN29398.1| ribosomal protein S6 [Brucella suis 1330]
 gi|161335237|gb|ABX61542.1| ribosomal protein S6 [Brucella canis ATCC 23365]
 gi|260156459|gb|EEW91539.1| ribosomal protein S6 [Brucella suis bv. 4 str. 40]
 gi|261744206|gb|EEY32132.1| 30S ribosomal protein S6 [Brucella suis bv. 3 str. 686]
          Length = 148

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 74/104 (71%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV L RQDIS QQ+   + Q++ +++ NGG+   V   G+R + YRI+KNRKAYY
Sbjct: 1   MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             +NI +P AA+ EM+R+MRI+E+VLR LT+ V+ HE+  +  +
Sbjct: 61  TLVNIDAPAAAVAEMERQMRINEDVLRFLTVRVEEHEEGQSAML 104


>gi|261867096|ref|YP_003255018.1| 30S ribosomal protein S6 [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|293390735|ref|ZP_06635069.1| ribosomal protein S6 [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|261412428|gb|ACX81799.1| ribosomal protein S6 [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290951269|gb|EFE01388.1| ribosomal protein S6 [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 125

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   ++E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGSVKEAGGQVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E+++  R ++ VLRSL +         +  ++  D          + 
Sbjct: 60  VLMNVEAPQQVIDELEKTFRYNDAVLRSLVIHTKHAVTEASPMVKAKDDRKALTEVESND 119

Query: 121 NVDRKQ 126
             D ++
Sbjct: 120 FEDAEE 125


>gi|197287186|ref|YP_002153058.1| 30S ribosomal protein S6 [Proteus mirabilis HI4320]
 gi|227357120|ref|ZP_03841489.1| 30S ribosomal protein S6 [Proteus mirabilis ATCC 29906]
 gi|226695115|sp|B4F275|RS6_PROMH RecName: Full=30S ribosomal protein S6
 gi|194684673|emb|CAR46616.1| 30S ribosomal protein S6 [Proteus mirabilis HI4320]
 gi|227162652|gb|EEI47619.1| 30S ribosomal protein S6 [Proteus mirabilis ATCC 29906]
          Length = 131

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 66/132 (50%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y++ I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYKTAITNANGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN-DRFPRD 119
           V MN+ +P   I E++   R ++ VLR++ +         +  ++  D   R+      +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVLRNMIMRTKHAVTEASPMVKAKDERRRDVAEDLDE 119

Query: 120 RNVDRKQHVSEE 131
             VD     SEE
Sbjct: 120 EEVDDVAEDSEE 131


>gi|261855981|ref|YP_003263264.1| ribosomal protein S6 [Halothiobacillus neapolitanus c2]
 gi|261836450|gb|ACX96217.1| ribosomal protein S6 [Halothiobacillus neapolitanus c2]
          Length = 142

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 45/142 (31%), Positives = 76/142 (53%), Gaps = 8/142 (5%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+ +I+ +GG V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMIERYRGIIETSGGTVHRLEDWGRRQLAYPINKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN------- 113
           V MN+ +  AA+ E++   R ++ VLR LT  ++  E  P++ ++  D + R        
Sbjct: 60  VMMNVEASQAAVAELEEAFRFNDAVLRHLTSRMEEAETEPSIIMRERDNERRPRRRDDEQ 119

Query: 114 DRFPRDRNVDRKQHVSEEKPLS 135
           D    DR+ D +    E+   S
Sbjct: 120 DSGRFDRDDDDQAEQEEQVEAS 141


>gi|52424524|ref|YP_087661.1| 30S ribosomal protein S6 [Mannheimia succiniciproducens MBEL55E]
 gi|61215479|sp|Q65VD4|RS6_MANSM RecName: Full=30S ribosomal protein S6
 gi|52306576|gb|AAU37076.1| RpsF protein [Mannheimia succiniciproducens MBEL55E]
          Length = 125

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 64/126 (50%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   ++E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGSVKEAGGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ VLR++ +         +  ++  D    +     + 
Sbjct: 60  VLMNVEAPQEVIDELETTFRYNDAVLRNVIIRTKHAVTEASPMVKAKDERRASAEVENND 119

Query: 121 NVDRKQ 126
             D ++
Sbjct: 120 FEDAEE 125


>gi|103487384|ref|YP_616945.1| 30S ribosomal protein S6 [Sphingopyxis alaskensis RB2256]
 gi|122984936|sp|Q1GRW0|RS6_SPHAL RecName: Full=30S ribosomal protein S6
 gi|98977461|gb|ABF53612.1| SSU ribosomal protein S6P [Sphingopyxis alaskensis RB2256]
          Length = 122

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 65/107 (60%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YEHVF+ RQD+S  Q+         +I E  G+V      G++ +AY+I+KNRK +Y
Sbjct: 1   MPFYEHVFIARQDLSQAQVDALAETVTGVIGEYKGQVHKTETWGLKQLAYKIQKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH 107
           V ++      AI E++R+  I+E+++R +T+ VD  E+ P++ +++ 
Sbjct: 61  VMLSAEVSGEAIAEIERQAAINEDIIRWMTIKVDELEKGPSVMMRKQ 107


>gi|158425932|ref|YP_001527224.1| 30S ribosomal protein S6 [Azorhizobium caulinodans ORS 571]
 gi|189045453|sp|A8HVF1|RS6_AZOC5 RecName: Full=30S ribosomal protein S6
 gi|158332821|dbj|BAF90306.1| ribosomal protein S6 [Azorhizobium caulinodans ORS 571]
          Length = 150

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 59/148 (39%), Positives = 90/148 (60%), Gaps = 19/148 (12%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL+RQD+++QQ+++   +++ +I+ NGG V  V   G++++ YRI+KNRKA++
Sbjct: 1   MSLYEHVFLVRQDVTAQQVEELAARFKGVIEANGGTVSKVEAWGVKSLTYRIKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD---------- 110
              NI +P AA+ EM+R+M IDE+VLR LT+ VD  E+ P+  +Q+ DRD          
Sbjct: 61  TLFNIDAPAAAVQEMERQMGIDEDVLRFLTIRVDELEEGPSAMLQKRDRDDRGERGERGF 120

Query: 111 ---------DRNDRFPRDRNVDRKQHVS 129
                    DR DR  R R+ +      
Sbjct: 121 GGGGFGGGRDREDRPRRGRDREEAATEE 148


>gi|84503440|ref|ZP_01001500.1| Ribosomal protein S6 [Oceanicola batsensis HTCC2597]
 gi|84388227|gb|EAQ01179.1| Ribosomal protein S6 [Oceanicola batsensis HTCC2597]
          Length = 118

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 73/107 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  I  + +++ +NGG++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVFIARQDLSNAQAEGLIEHFGTVLSDNGGKLVEQEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH 107
            F+   +P  A+ EM+R MR+ ++V+R LT+ V+ H + P++ +Q+ 
Sbjct: 61  AFLKSDAPAPAVQEMERLMRLHDDVMRVLTIRVEEHAEGPSIQMQKK 107


>gi|78485708|ref|YP_391633.1| ribosomal protein S6 [Thiomicrospira crunogena XCL-2]
 gi|91207798|sp|Q31FW4|RS6_THICR RecName: Full=30S ribosomal protein S6
 gi|78363994|gb|ABB41959.1| SSU ribosomal protein S6P [Thiomicrospira crunogena XCL-2]
          Length = 114

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 62/115 (53%), Gaps = 1/115 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y+ LI+ENGG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEVVFLVHPD-QSEQVPAMIERYRGLIEENGGAIHRLEDWGRRQLAYLINKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
           + MNI      + E++     ++ VLR + +  +     P++   + +   R D+
Sbjct: 60  ILMNIECDQETLKELENLFYYNDAVLRDMFIKRNEAVTEPSVMASQKEDKRRGDK 114


>gi|254525258|ref|ZP_05137313.1| 30S ribosomal protein S6 [Stenotrophomonas sp. SKA14]
 gi|219722849|gb|EED41374.1| 30S ribosomal protein S6 [Stenotrophomonas sp. SKA14]
          Length = 145

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 61/113 (53%), Gaps = 1/113 (0%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VF++  D  S+Q+   I +Y+SL++   G +  + + G R +AY I+   KA+YV
Sbjct: 3   RHYEIVFMVHPD-QSEQVPAMIERYKSLVENGNGTIHRLEDWGRRQLAYPIQNLVKAHYV 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
            MNI +  A ++E+    R ++ VLR+L +  D  +   +L ++  D      
Sbjct: 62  LMNIEADQAVLNELTESFRFNDAVLRNLVIKRDEADTEQSLIMKSKDEKGDKP 114


>gi|315499769|ref|YP_004088572.1| ribosomal protein s6 [Asticcacaulis excentricus CB 48]
 gi|315417781|gb|ADU14421.1| ribosomal protein S6 [Asticcacaulis excentricus CB 48]
          Length = 124

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 50/124 (40%), Positives = 78/124 (62%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV L RQDIS QQ +      ++LI+E GG V  +   G+R + YR++KNRKA+Y
Sbjct: 1   MALYEHVVLARQDISPQQAEGLNDTLKALIEELGGSVAKIEYWGLRNLTYRVKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             + I +P AA+ EM+R++ I+E+V+R LT+ V+  +   +  + R DR +R +R  R  
Sbjct: 61  SLLAIDAPAAAVKEMERQLSINEDVIRFLTVRVEELDLELSPVLSRRDRPERAERSERAE 120

Query: 121 NVDR 124
             ++
Sbjct: 121 FAEQ 124


>gi|326796492|ref|YP_004314312.1| 30S ribosomal protein S6 [Marinomonas mediterranea MMB-1]
 gi|326547256|gb|ADZ92476.1| 30S ribosomal protein S6 [Marinomonas mediterranea MMB-1]
          Length = 135

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 62/118 (52%), Gaps = 1/118 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y +LI E+GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPAMIERYTNLITEDGGQVHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPR 118
           V MNI +  A + E+    R ++ ++R++ +         +       R+DR  +   
Sbjct: 60  VLMNIEASEAVLAELNDTFRYNDAIIRNMVIRRKDAVTEVSPIKAAESREDRRPQREE 117


>gi|304392027|ref|ZP_07373969.1| ribosomal protein S6 [Ahrensia sp. R2A130]
 gi|303296256|gb|EFL90614.1| ribosomal protein S6 [Ahrensia sp. R2A130]
          Length = 121

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 77/106 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+F+ RQD+SSQQ+   +  ++ +++ NGG V  +   G++T+ YR++KNRKA+Y
Sbjct: 1   MALYEHIFMARQDVSSQQVDTLVEHFKGVLEANGGSVGKIENWGLKTLPYRVKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             +NI +P  A+ EM+R+MRI E+VLR +T+ V+ HE +P+  +++
Sbjct: 61  ALINIDAPSDAVAEMERQMRIHEDVLRYMTVKVEEHEDAPSAMLRK 106


>gi|62289440|ref|YP_221233.1| 30S ribosomal protein S6 [Brucella abortus bv. 1 str. 9-941]
 gi|82699366|ref|YP_413940.1| 30S ribosomal protein S6 [Brucella melitensis biovar Abortus 2308]
 gi|189023690|ref|YP_001934458.1| 30S ribosomal protein S6 [Brucella abortus S19]
 gi|225851991|ref|YP_002732224.1| 30S ribosomal protein S6 [Brucella melitensis ATCC 23457]
 gi|254688752|ref|ZP_05152006.1| 30S ribosomal protein S6 [Brucella abortus bv. 6 str. 870]
 gi|254693235|ref|ZP_05155063.1| 30S ribosomal protein S6 [Brucella abortus bv. 3 str. Tulya]
 gi|254696881|ref|ZP_05158709.1| 30S ribosomal protein S6 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701259|ref|ZP_05163087.1| 30S ribosomal protein S6 [Brucella suis bv. 5 str. 513]
 gi|254707816|ref|ZP_05169644.1| 30S ribosomal protein S6 [Brucella pinnipedialis M163/99/10]
 gi|254709602|ref|ZP_05171413.1| 30S ribosomal protein S6 [Brucella pinnipedialis B2/94]
 gi|254712982|ref|ZP_05174793.1| 30S ribosomal protein S6 [Brucella ceti M644/93/1]
 gi|254716664|ref|ZP_05178475.1| 30S ribosomal protein S6 [Brucella ceti M13/05/1]
 gi|254718631|ref|ZP_05180442.1| 30S ribosomal protein S6 [Brucella sp. 83/13]
 gi|254729785|ref|ZP_05188363.1| 30S ribosomal protein S6 [Brucella abortus bv. 4 str. 292]
 gi|256031094|ref|ZP_05444708.1| 30S ribosomal protein S6 [Brucella pinnipedialis M292/94/1]
 gi|256060588|ref|ZP_05450756.1| 30S ribosomal protein S6 [Brucella neotomae 5K33]
 gi|256112979|ref|ZP_05453882.1| 30S ribosomal protein S6 [Brucella melitensis bv. 3 str. Ether]
 gi|256159167|ref|ZP_05456980.1| 30S ribosomal protein S6 [Brucella ceti M490/95/1]
 gi|256254497|ref|ZP_05460033.1| 30S ribosomal protein S6 [Brucella ceti B1/94]
 gi|256256999|ref|ZP_05462535.1| 30S ribosomal protein S6 [Brucella abortus bv. 9 str. C68]
 gi|256264502|ref|ZP_05467034.1| ribosomal protein S6 [Brucella melitensis bv. 2 str. 63/9]
 gi|256368908|ref|YP_003106414.1| 30S ribosomal protein S6 [Brucella microti CCM 4915]
 gi|260168225|ref|ZP_05755036.1| 30S ribosomal protein S6 [Brucella sp. F5/99]
 gi|260545809|ref|ZP_05821550.1| ribosomal protein S6 [Brucella abortus NCTC 8038]
 gi|260754231|ref|ZP_05866579.1| 30S ribosomal protein S6 [Brucella abortus bv. 6 str. 870]
 gi|260757451|ref|ZP_05869799.1| 30S ribosomal protein S6 [Brucella abortus bv. 4 str. 292]
 gi|260761276|ref|ZP_05873619.1| 30S ribosomal protein S6 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883257|ref|ZP_05894871.1| 30S ribosomal protein S6 [Brucella abortus bv. 9 str. C68]
 gi|261213478|ref|ZP_05927759.1| 30S ribosomal protein S6 [Brucella abortus bv. 3 str. Tulya]
 gi|261218465|ref|ZP_05932746.1| 30S ribosomal protein S6 [Brucella ceti M13/05/1]
 gi|261221671|ref|ZP_05935952.1| 30S ribosomal protein S6 [Brucella ceti B1/94]
 gi|261315303|ref|ZP_05954500.1| 30S ribosomal protein S6 [Brucella pinnipedialis M163/99/10]
 gi|261317130|ref|ZP_05956327.1| 30S ribosomal protein S6 [Brucella pinnipedialis B2/94]
 gi|261320685|ref|ZP_05959882.1| 30S ribosomal protein S6 [Brucella ceti M644/93/1]
 gi|261324584|ref|ZP_05963781.1| 30S ribosomal protein S6 [Brucella neotomae 5K33]
 gi|261751798|ref|ZP_05995507.1| 30S ribosomal protein S6 [Brucella suis bv. 5 str. 513]
 gi|261757686|ref|ZP_06001395.1| ribosomal protein S6 [Brucella sp. F5/99]
 gi|265983610|ref|ZP_06096345.1| 30S ribosomal protein S6 [Brucella sp. 83/13]
 gi|265988168|ref|ZP_06100725.1| 30S ribosomal protein S6 [Brucella pinnipedialis M292/94/1]
 gi|265994414|ref|ZP_06106971.1| 30S ribosomal protein S6 [Brucella melitensis bv. 3 str. Ether]
 gi|265997634|ref|ZP_06110191.1| 30S ribosomal protein S6 [Brucella ceti M490/95/1]
 gi|294851833|ref|ZP_06792506.1| small subunit ribosomal protein S6 [Brucella sp. NVSL 07-0026]
 gi|297247852|ref|ZP_06931570.1| small subunit ribosomal protein S6 [Brucella abortus bv. 5 str.
           B3196]
 gi|306839849|ref|ZP_07472647.1| ribosomal protein S6 [Brucella sp. NF 2653]
 gi|306842260|ref|ZP_07474923.1| ribosomal protein S6 [Brucella sp. BO2]
 gi|75497231|sp|Q57ER2|RS6_BRUAB RecName: Full=30S ribosomal protein S6
 gi|91207903|sp|Q2YMG9|RS6_BRUA2 RecName: Full=30S ribosomal protein S6
 gi|226703429|sp|B2S9V4|RS6_BRUA1 RecName: Full=30S ribosomal protein S6
 gi|254765224|sp|C0RHG2|RS6_BRUMB RecName: Full=30S ribosomal protein S6
 gi|62195572|gb|AAX73872.1| RpsF, ribosomal protein S6 [Brucella abortus bv. 1 str. 9-941]
 gi|82615467|emb|CAJ10436.1| Ribosomal protein S6 [Brucella melitensis biovar Abortus 2308]
 gi|189019262|gb|ACD71984.1| Ribosomal protein S6 [Brucella abortus S19]
 gi|225640356|gb|ACO00270.1| ribosomal protein S6 [Brucella melitensis ATCC 23457]
 gi|255999066|gb|ACU47465.1| 30S ribosomal protein S6 [Brucella microti CCM 4915]
 gi|260097216|gb|EEW81091.1| ribosomal protein S6 [Brucella abortus NCTC 8038]
 gi|260667769|gb|EEX54709.1| 30S ribosomal protein S6 [Brucella abortus bv. 4 str. 292]
 gi|260671708|gb|EEX58529.1| 30S ribosomal protein S6 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674339|gb|EEX61160.1| 30S ribosomal protein S6 [Brucella abortus bv. 6 str. 870]
 gi|260872785|gb|EEX79854.1| 30S ribosomal protein S6 [Brucella abortus bv. 9 str. C68]
 gi|260915085|gb|EEX81946.1| 30S ribosomal protein S6 [Brucella abortus bv. 3 str. Tulya]
 gi|260920255|gb|EEX86908.1| 30S ribosomal protein S6 [Brucella ceti B1/94]
 gi|260923554|gb|EEX90122.1| 30S ribosomal protein S6 [Brucella ceti M13/05/1]
 gi|261293375|gb|EEX96871.1| 30S ribosomal protein S6 [Brucella ceti M644/93/1]
 gi|261296353|gb|EEX99849.1| 30S ribosomal protein S6 [Brucella pinnipedialis B2/94]
 gi|261300564|gb|EEY04061.1| 30S ribosomal protein S6 [Brucella neotomae 5K33]
 gi|261304329|gb|EEY07826.1| 30S ribosomal protein S6 [Brucella pinnipedialis M163/99/10]
 gi|261737670|gb|EEY25666.1| ribosomal protein S6 [Brucella sp. F5/99]
 gi|261741551|gb|EEY29477.1| 30S ribosomal protein S6 [Brucella suis bv. 5 str. 513]
 gi|262552102|gb|EEZ08092.1| 30S ribosomal protein S6 [Brucella ceti M490/95/1]
 gi|262765527|gb|EEZ11316.1| 30S ribosomal protein S6 [Brucella melitensis bv. 3 str. Ether]
 gi|263094835|gb|EEZ18573.1| ribosomal protein S6 [Brucella melitensis bv. 2 str. 63/9]
 gi|264660365|gb|EEZ30626.1| 30S ribosomal protein S6 [Brucella pinnipedialis M292/94/1]
 gi|264662202|gb|EEZ32463.1| 30S ribosomal protein S6 [Brucella sp. 83/13]
 gi|294820422|gb|EFG37421.1| small subunit ribosomal protein S6 [Brucella sp. NVSL 07-0026]
 gi|297175021|gb|EFH34368.1| small subunit ribosomal protein S6 [Brucella abortus bv. 5 str.
           B3196]
 gi|306287640|gb|EFM59087.1| ribosomal protein S6 [Brucella sp. BO2]
 gi|306405035|gb|EFM61316.1| ribosomal protein S6 [Brucella sp. NF 2653]
 gi|326408487|gb|ADZ65552.1| Ribosomal protein S6 [Brucella melitensis M28]
 gi|326538203|gb|ADZ86418.1| ribosomal protein S6 [Brucella melitensis M5-90]
          Length = 148

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 74/104 (71%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV L RQDIS QQ+   + Q++ +++ NGG+   V   G+R + YRI+KNRKAYY
Sbjct: 1   MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             +NI +P AA+ EM+R+MRI+E+VLR LT+ V+ HE+  +  +
Sbjct: 61  TLVNIDAPAAAVAEMERQMRINEDVLRFLTVRVEEHEEGQSAML 104


>gi|15603045|ref|NP_246117.1| 30S ribosomal protein S6 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|13959508|sp|Q9CLN8|RS6_PASMU RecName: Full=30S ribosomal protein S6
 gi|12721531|gb|AAK03264.1| RpS6 [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 125

 Score =  123 bits (309), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 63/126 (50%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   ++E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGSVKEAGGQVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ VLR++ +         +  ++  D          + 
Sbjct: 60  VLMNVEAPQEVIDELETTFRYNDAVLRNVIIRTKHAVTEASPMVKAKDDRKALAEVENND 119

Query: 121 NVDRKQ 126
             D ++
Sbjct: 120 FEDAEE 125


>gi|163759111|ref|ZP_02166197.1| 30S ribosomal protein S6 [Hoeflea phototrophica DFL-43]
 gi|162283515|gb|EDQ33800.1| 30S ribosomal protein S6 [Hoeflea phototrophica DFL-43]
          Length = 139

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 79/106 (74%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+SSQQ++  + QY+ +I+  GG+V  +   G++++ YRI KNRKA+Y
Sbjct: 1   MALYEHVFLARQDVSSQQVEALVEQYKGVIEGLGGKVGRIEHWGLKSLTYRINKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             M+I +P  A+ EM+R+MR +E++LR +T+ VD+HE+ P+  +Q+
Sbjct: 61  ALMDIDAPAPAVKEMERQMRFNEDILRFMTVSVDAHEEGPSAMLQK 106


>gi|121605294|ref|YP_982623.1| 30S ribosomal protein S6 [Polaromonas naphthalenivorans CJ2]
 gi|166227362|sp|A1VPX4|RS6_POLNA RecName: Full=30S ribosomal protein S6
 gi|120594263|gb|ABM37702.1| SSU ribosomal protein S6P [Polaromonas naphthalenivorans CJ2]
          Length = 121

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 66/119 (55%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S+Q+   + +Y+ +I   GG V  V + G R + Y I+K  KA+Y
Sbjct: 1   MRHYEIVLLIHPD-QSEQVPAMLERYKGMITAGGGTVHRVEDWGRRQLVYLIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           + +NI +  A + E++   + ++ VLR LT++    E  P+L ++  +R++      ++
Sbjct: 60  LCINIEASQAVMEEIEHAFKFNDAVLRHLTVVKKKAETGPSLMMRNVEREEARKTQQQE 118


>gi|114704792|ref|ZP_01437700.1| 30S ribosomal protein S6 [Fulvimarina pelagi HTCC2506]
 gi|114539577|gb|EAU42697.1| 30S ribosomal protein S6 [Fulvimarina pelagi HTCC2506]
          Length = 155

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 77/106 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S+ Q++  +   + +++  GG+V  V   G++T+AYR+ KNRKA+Y
Sbjct: 7   MALYEHVFLARQDVSNNQVEQLVENLRGILESGGGKVGKVENWGLKTLAYRMDKNRKAHY 66

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             MNI +P AA+HEM+R+MR +E++LR +T+ VD HE  P+  +Q+
Sbjct: 67  TLMNIDAPSAAVHEMERQMRFNEDILRFMTIRVDEHEDGPSAMMQK 112


>gi|77163755|ref|YP_342280.1| ribosomal protein S6 [Nitrosococcus oceani ATCC 19707]
 gi|254435448|ref|ZP_05048955.1| ribosomal protein S6, putative [Nitrosococcus oceani AFC27]
 gi|91207924|sp|Q3JEJ6|RS6_NITOC RecName: Full=30S ribosomal protein S6
 gi|76882069|gb|ABA56750.1| SSU ribosomal protein S6P [Nitrosococcus oceani ATCC 19707]
 gi|207088559|gb|EDZ65831.1| ribosomal protein S6, putative [Nitrosococcus oceani AFC27]
          Length = 156

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 63/126 (50%), Gaps = 2/126 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y+ +I+ +GG +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFLVHPD-QSEQLSAMMDRYRQIIETDGGCIHRLEDWGRRQLAYPIQKLYKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN-DRFPRD 119
           V MNI   P  I E+    R ++ VLR + +  +      +   +  +   R  D     
Sbjct: 60  VLMNIECTPRTIEELTSAFRFNDAVLRDMVIRREEAITETSPLAKGEESGGRGYDSARSG 119

Query: 120 RNVDRK 125
           R+ D  
Sbjct: 120 RDRDES 125


>gi|85708887|ref|ZP_01039953.1| ribosomal protein S6 [Erythrobacter sp. NAP1]
 gi|85690421|gb|EAQ30424.1| ribosomal protein S6 [Erythrobacter sp. NAP1]
          Length = 137

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 81/121 (66%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+FL RQD+S  Q+         +++ N G+V      G++++AY+I +NRKA++
Sbjct: 17  MALYEHIFLARQDLSQAQVDALAATATEIVEANEGKVTKTETWGLKSLAYKIDRNRKAHF 76

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI +P + + E++R+ RI+E+V+R +T+ V+ HE+ P++ +++++RD +      +R
Sbjct: 77  VMLNIDAPGSVVEELERQTRINEDVIRYMTIRVEEHEEGPSVMMRKNERDKKRRSDREER 136

Query: 121 N 121
           +
Sbjct: 137 D 137


>gi|182679259|ref|YP_001833405.1| 30S ribosomal protein S6 [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|226703422|sp|B2IHD1|RS6_BEII9 RecName: Full=30S ribosomal protein S6
 gi|182635142|gb|ACB95916.1| ribosomal protein S6 [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 151

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 54/111 (48%), Positives = 82/111 (73%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV+L RQDIS+QQ++    Q +S+I+   G+V  V   G++++AYRI+KNRKA++
Sbjct: 1   MALYEHVYLARQDISAQQVEALTEQLKSVIESFQGKVTKVEYWGVKSLAYRIKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
             +NI +P AA+ EM+R+M I+E+VLR +TL V+ HEQ P+  +++ D DD
Sbjct: 61  SLLNIEAPAAALTEMERQMGINEDVLRFMTLRVEEHEQGPSAMMRKRDDDD 111


>gi|285018510|ref|YP_003376221.1| 30s ribosomal subunit protein s6 [Xanthomonas albilineans GPE PC73]
 gi|283473728|emb|CBA16231.1| probable 30s ribosomal subunit protein s6 [Xanthomonas albilineans]
          Length = 144

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 59/113 (52%), Gaps = 1/113 (0%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VFL+  D  S+Q+   I +Y+SL++  GG +  + + G R +AY I+   KA+YV
Sbjct: 3   RHYEIVFLVHPD-QSEQVPAMIERYKSLVENGGGTIHRLEDWGRRQLAYPIQNLVKAHYV 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
            +NI    A + E+    R ++ VLR L +  D  +   +L ++  D      
Sbjct: 62  MLNIEVDQAVLSELVESFRFNDAVLRHLAIKRDGADTEQSLIMKSKDEKGDKP 114


>gi|332289562|ref|YP_004420414.1| 30S ribosomal protein S6 [Gallibacterium anatis UMN179]
 gi|330432458|gb|AEC17517.1| 30S ribosomal protein S6 [Gallibacterium anatis UMN179]
          Length = 125

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 63/126 (50%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   ++E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGSVKEAGGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ +LR++ +         +  ++  D          + 
Sbjct: 60  VLMNVEAPQEVIDELETTFRYNDAILRNVIIRTKHAVTEASPMVKAKDERKALADVDNND 119

Query: 121 NVDRKQ 126
             D ++
Sbjct: 120 YEDAEE 125


>gi|323136067|ref|ZP_08071150.1| ribosomal protein S6 [Methylocystis sp. ATCC 49242]
 gi|322399158|gb|EFY01677.1| ribosomal protein S6 [Methylocystis sp. ATCC 49242]
          Length = 139

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 77/106 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV+L RQDIS QQ++   GQ++++I   GG V      G++++AYRI+KNRKA++
Sbjct: 1   MPLYEHVYLARQDISPQQVEALTGQFKNIITSLGGTVGKTEYWGVKSLAYRIKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             +NI +PPAAI EM+R+  I+E+VLR LTL V+  E+ P+  +++
Sbjct: 61  TLLNIDAPPAAIAEMERQQSINEDVLRVLTLRVEELEEGPSAQLRK 106


>gi|240140757|ref|YP_002965237.1| 30S ribosomal protein S6 [Methylobacterium extorquens AM1]
 gi|240010734|gb|ACS41960.1| 30S ribosomal protein S6 [Methylobacterium extorquens AM1]
          Length = 148

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 79/106 (74%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+++QQ++  +  Y+ +I+  GG +  +   G++++AYRI+KNRKA++
Sbjct: 1   MPLYEHVFLARQDVTAQQVETMVETYKGVIETGGGTIEKIESWGVKSLAYRIKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             +NI++PPAA+ EM+R+M+I E+VLR +T+ V+  E  P+  +Q+
Sbjct: 61  TLLNISAPPAAVAEMERQMQISEDVLRFMTVRVEQLEAEPSAMMQK 106


>gi|163853341|ref|YP_001641384.1| ribosomal protein S6 [Methylobacterium extorquens PA1]
 gi|218532198|ref|YP_002423014.1| 30S ribosomal protein S6 [Methylobacterium chloromethanicum CM4]
 gi|254563267|ref|YP_003070362.1| 30S ribosomal protein S6 [Methylobacterium extorquens DM4]
 gi|226703485|sp|A9W8G4|RS6_METEP RecName: Full=30S ribosomal protein S6
 gi|254765443|sp|B7L2P2|RS6_METC4 RecName: Full=30S ribosomal protein S6
 gi|163664946|gb|ABY32313.1| ribosomal protein S6 [Methylobacterium extorquens PA1]
 gi|218524501|gb|ACK85086.1| ribosomal protein S6 [Methylobacterium chloromethanicum CM4]
 gi|254270545|emb|CAX26548.1| 30S ribosomal protein S6 [Methylobacterium extorquens DM4]
          Length = 151

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 79/106 (74%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+++QQ++  +  Y+ +I+  GG +  +   G++++AYRI+KNRKA++
Sbjct: 1   MPLYEHVFLARQDVTAQQVETMVETYKGVIETGGGTIEKIESWGVKSLAYRIKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             +NI++PPAA+ EM+R+M+I E+VLR +T+ V+  E  P+  +Q+
Sbjct: 61  TLLNISAPPAAVAEMERQMQISEDVLRFMTVRVEQLEAEPSAMMQK 106


>gi|56461040|ref|YP_156321.1| 30S ribosomal protein S6 [Idiomarina loihiensis L2TR]
 gi|61215392|sp|Q5QY01|RS6_IDILO RecName: Full=30S ribosomal protein S6
 gi|56180050|gb|AAV82772.1| Ribosomal protein S6 [Idiomarina loihiensis L2TR]
          Length = 116

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I++ GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSETIKQGGGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V +NI +    + E++   R ++ VLR++ +        P+   +  +   
Sbjct: 60  VLLNIEASAEVVEELETAFRYNDAVLRNMIMRKKESITEPSPLTKPKEDRK 110


>gi|89054113|ref|YP_509564.1| 30S ribosomal protein S6 [Jannaschia sp. CCS1]
 gi|122498966|sp|Q28RX3|RS6_JANSC RecName: Full=30S ribosomal protein S6
 gi|88863662|gb|ABD54539.1| SSU ribosomal protein S6P [Jannaschia sp. CCS1]
          Length = 117

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +     + +++ +NGG V      G++T+AY+I KNRK +Y
Sbjct: 1   MALYEHVMIARQDLSNAQAEALNEHFGAVLADNGGTVVDTEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            ++   +P  A+ EM+R MR+ ++V+R LT+ VD+H++ P++ +Q+
Sbjct: 61  SYLRTDAPSDAVQEMERLMRLHDDVMRVLTIKVDAHDEGPSVQMQK 106


>gi|26991557|ref|NP_746982.1| 30S ribosomal protein S6 [Pseudomonas putida KT2440]
 gi|148549960|ref|YP_001270062.1| 30S ribosomal protein S6 [Pseudomonas putida F1]
 gi|167035923|ref|YP_001671154.1| 30S ribosomal protein S6 [Pseudomonas putida GB-1]
 gi|170723829|ref|YP_001751517.1| 30S ribosomal protein S6 [Pseudomonas putida W619]
 gi|325271217|ref|ZP_08137762.1| 30S ribosomal protein S6 [Pseudomonas sp. TJI-51]
 gi|32171520|sp|Q88DE8|RS6_PSEPK RecName: Full=30S ribosomal protein S6
 gi|166227368|sp|A5W9R8|RS6_PSEP1 RecName: Full=30S ribosomal protein S6
 gi|189045488|sp|B0KKY3|RS6_PSEPG RecName: Full=30S ribosomal protein S6
 gi|226695117|sp|B1JAH1|RS6_PSEPW RecName: Full=30S ribosomal protein S6
 gi|24986642|gb|AAN70446.1|AE016685_11 ribosomal protein S6 [Pseudomonas putida KT2440]
 gi|148514018|gb|ABQ80878.1| SSU ribosomal protein S6P [Pseudomonas putida F1]
 gi|166862411|gb|ABZ00819.1| ribosomal protein S6 [Pseudomonas putida GB-1]
 gi|169761832|gb|ACA75148.1| ribosomal protein S6 [Pseudomonas putida W619]
 gi|313500861|gb|ADR62227.1| RpsF [Pseudomonas putida BIRD-1]
 gi|324103620|gb|EGC00922.1| 30S ribosomal protein S6 [Pseudomonas sp. TJI-51]
          Length = 141

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  D      +  ++
Sbjct: 60  VMLNVECTGKALAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLK 104


>gi|329890141|ref|ZP_08268484.1| ribosomal protein S6 [Brevundimonas diminuta ATCC 11568]
 gi|328845442|gb|EGF95006.1| ribosomal protein S6 [Brevundimonas diminuta ATCC 11568]
          Length = 125

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 47/125 (37%), Positives = 75/125 (60%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH  + RQDIS+QQ +      ++LI+ENGG V  +   G+R + YR++KNRKA+Y
Sbjct: 1   MALYEHTVMTRQDISAQQAEALNDTIKALIEENGGSVAKIEYWGLRNLTYRVKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             M +  PPAA+ E++R++ I+E+VLR LT+ V+  +   +  + R +R+        D 
Sbjct: 61  SLMAVDCPPAAMAEVERQLSINEDVLRWLTIRVEELDLELSPLLARRERERDRSAPRGDD 120

Query: 121 NVDRK 125
               +
Sbjct: 121 AAASE 125


>gi|238918384|ref|YP_002931898.1| 30S ribosomal protein S6 [Edwardsiella ictaluri 93-146]
 gi|259495333|sp|C5BF77|RS6_EDWI9 RecName: Full=30S ribosomal protein S6
 gi|238867952|gb|ACR67663.1| ribosomal protein S6, putative [Edwardsiella ictaluri 93-146]
          Length = 131

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/132 (27%), Positives = 68/132 (51%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGAITGAEGKIHRLEDWGRRQLAYSINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+ +    I E++   R ++ V+RS+ +         +  ++ + +R +R + F  +
Sbjct: 60  VLMNVEASQEVIDELETNFRYNDAVIRSMVMRTKHAVTEASPMVKAKDERRERREDFANE 119

Query: 120 RNVDRKQHVSEE 131
            + + +   SEE
Sbjct: 120 TSEETEAGDSEE 131


>gi|126208639|ref|YP_001053864.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae L20]
 gi|166226794|sp|A3N1H3|RS6_ACTP2 RecName: Full=30S ribosomal protein S6
 gi|126097431|gb|ABN74259.1| 30S ribosomal protein S6 [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
          Length = 124

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 61/110 (55%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + ++E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMIERYTASVKEAGGQVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V MN+ +P   I E++   R ++ VLR+L +   +     +  ++  +  
Sbjct: 60  VLMNVEAPQRVIDELETNFRYNDAVLRNLIVHTKAAVTEASPMVKAKESK 109


>gi|188583607|ref|YP_001927052.1| 30S ribosomal protein S6 [Methylobacterium populi BJ001]
 gi|226703486|sp|B1ZFQ8|RS6_METPB RecName: Full=30S ribosomal protein S6
 gi|179347105|gb|ACB82517.1| ribosomal protein S6 [Methylobacterium populi BJ001]
          Length = 151

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 79/106 (74%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+++QQ++  +  Y+ +I+  GG +  +   G++++AYRI+KNRKA++
Sbjct: 1   MPLYEHVFLARQDVTAQQVETMVETYKGVIETGGGTIEKIESWGVKSLAYRIKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             +NI++PPAA+ EM+R+M+I E+VLR +T+ V+  E  P+  +Q+
Sbjct: 61  TLLNISAPPAALAEMERQMQISEDVLRFMTVRVEQLEAEPSAMMQK 106


>gi|149377617|ref|ZP_01895355.1| ribosomal protein S6 [Marinobacter algicola DG893]
 gi|149358090|gb|EDM46574.1| ribosomal protein S6 [Marinobacter algicola DG893]
          Length = 138

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 65/134 (48%), Gaps = 1/134 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  +I E+GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMIERYTGVITEDGGKVHRLEDWGRRHLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI    AA+ E+    R ++ ++R + L  D  +   +       R+DR     R R
Sbjct: 60  VLMNIECSQAAMDELTHNFRFNDAIIRDMILRRDGADVDLSPMKASESREDRRGGDDRPR 119

Query: 121 NVDRKQHVSEEKPL 134
                    ++   
Sbjct: 120 RSAESDEPRQQAET 133


>gi|118594782|ref|ZP_01552129.1| 30S ribosomal protein S6 [Methylophilales bacterium HTCC2181]
 gi|118440560|gb|EAV47187.1| 30S ribosomal protein S6 [Methylophilales bacterium HTCC2181]
          Length = 141

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 36/132 (27%), Positives = 67/132 (50%), Gaps = 1/132 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I + Q+LI+ N G++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFVVHPD-QSEQVPAMIDRLQTLIKTNKGKIHRLEDWGRRQLAYPIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI      + E++   + ++ V+R L         +P+  ++           P++ 
Sbjct: 60  VLMNIECSLETLAELEHSFKFNDAVIRHLVFATKLAVTNPSAMMKEEKSKSLVGDKPKEE 119

Query: 121 NVDRKQHVSEEK 132
              + + V+E K
Sbjct: 120 APVKAEAVTETK 131


>gi|121997454|ref|YP_001002241.1| 30S ribosomal protein S6 [Halorhodospira halophila SL1]
 gi|166226971|sp|A1WUS7|RS6_HALHL RecName: Full=30S ribosomal protein S6
 gi|121588859|gb|ABM61439.1| SSU ribosomal protein S6P [Halorhodospira halophila SL1]
          Length = 119

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 63/120 (52%), Gaps = 2/120 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S Q+   + +Y+S+++ +GG V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSDQVPAMVERYRSIVESSGGTVHRLEDWGRRQLAYPINKLIKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V MN+      + E+    R ++ V+R++ L  D     P+   +    R+DR +    +
Sbjct: 60  VLMNVECGKDELDELTSAFRFNDAVIRNMVLSRDEAVTEPSPLAKGNEKREDRKESEDAE 119


>gi|91788897|ref|YP_549849.1| 30S ribosomal protein S6 [Polaromonas sp. JS666]
 gi|123164720|sp|Q128U1|RS6_POLSJ RecName: Full=30S ribosomal protein S6
 gi|91698122|gb|ABE44951.1| SSU ribosomal protein S6P [Polaromonas sp. JS666]
          Length = 121

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 67/119 (56%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S+Q+   + +Y+ +I   GG+V  V + G R + Y I+K  KA+Y
Sbjct: 1   MRHYEIVLLIHPD-QSEQVPAMLERYKGMITAGGGKVHRVEDWGRRQLVYLIQKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           + +NI +  A + E++   + ++ VLR LT++    E  P+L ++  +R++      ++
Sbjct: 60  LCINIEASQAVMEEIEHAFKFNDAVLRHLTVVKKKAETGPSLMMRNVEREEARKAQQQE 118


>gi|121595519|ref|YP_987415.1| 30S ribosomal protein S6 [Acidovorax sp. JS42]
 gi|222111740|ref|YP_002554004.1| 30S ribosomal protein s6 [Acidovorax ebreus TPSY]
 gi|166226793|sp|A1WAR4|RS6_ACISJ RecName: Full=30S ribosomal protein S6
 gi|254765435|sp|B9MDJ5|RS6_DIAST RecName: Full=30S ribosomal protein S6
 gi|120607599|gb|ABM43339.1| SSU ribosomal protein S6P [Acidovorax sp. JS42]
 gi|221731184|gb|ACM34004.1| ribosomal protein S6 [Acidovorax ebreus TPSY]
          Length = 125

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 65/126 (51%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + L+  D  S+Q+   + +Y+ +I   GG+V  V + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIILLIHPD-QSEQVPAMLERYKGMIVAGGGQVHRVEDWGRRQLAYLINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + +NI +  A + E++   + ++ VLR LT+     E   +  ++  +R++       + 
Sbjct: 60  LCLNIEADQAVMAELEHAFKFNDAVLRHLTVQKKKAETGASSMMKTVEREEARKASQAEF 119

Query: 121 NVDRKQ 126
               ++
Sbjct: 120 AASNER 125


>gi|71281997|ref|YP_267173.1| 30S ribosomal protein S6 [Colwellia psychrerythraea 34H]
 gi|91207909|sp|Q489U1|RS6_COLP3 RecName: Full=30S ribosomal protein S6
 gi|71147737|gb|AAZ28210.1| ribosomal protein S6 [Colwellia psychrerythraea 34H]
          Length = 143

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 67/134 (50%), Gaps = 2/134 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  LI    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVSGMIQRYTDLINAAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI +P   I E++   R ++ V+R++ +         +      + + R+DR    +
Sbjct: 60  VLMNIEAPQVVIDELETAFRYNDVVIRNMIMRTKDAVTEASPMAAAKE-ERRDDRREVKK 118

Query: 121 NVDRKQHVSEEKPL 134
           +V      ++E  +
Sbjct: 119 DVAAAPVEAKEDSV 132


>gi|254480819|ref|ZP_05094065.1| ribosomal protein S6, putative [marine gamma proteobacterium
           HTCC2148]
 gi|214038614|gb|EEB79275.1| ribosomal protein S6, putative [marine gamma proteobacterium
           HTCC2148]
          Length = 148

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 70/134 (52%), Gaps = 8/134 (5%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + IQ++GG V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYSATIQKDGGSVHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +   A+ E+    R ++ V+R+L +  D      +  ++        ++  R+R
Sbjct: 60  VLMNVEASNEALDELTTTFRFNDAVIRNLVIRRDESVTDESFIMK-------AEKESRER 112

Query: 121 NVDRKQHVSEEKPL 134
               ++  + E P+
Sbjct: 113 KTRYEERKAAEAPV 126


>gi|75675883|ref|YP_318304.1| 30S ribosomal protein S6 [Nitrobacter winogradskyi Nb-255]
 gi|91207925|sp|Q3SRY9|RS6_NITWN RecName: Full=30S ribosomal protein S6
 gi|74420753|gb|ABA04952.1| SSU ribosomal protein S6P [Nitrobacter winogradskyi Nb-255]
          Length = 139

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 55/135 (40%), Positives = 82/135 (60%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD SSQQ+++   Q   +I   GG+V      G+R++ YR++KNRKA++
Sbjct: 1   MPLYEHVFLARQDASSQQVEELTTQITGVITGLGGKVTKTENWGVRSLTYRMKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI  P   ++E++R+ RI E+V+R LT+ VD HE  P+  +++ DRD   D      
Sbjct: 61  VLLNIDGPATIVNEIERQERIHEDVIRYLTVRVDEHEDGPSAMMRKADRDRERDDRGGGF 120

Query: 121 NVDRKQHVSEEKPLS 135
             DR      E+P +
Sbjct: 121 RGDRGPRRPREEPAA 135


>gi|254477083|ref|ZP_05090469.1| ribosomal protein S6 [Ruegeria sp. R11]
 gi|214031326|gb|EEB72161.1| ribosomal protein S6 [Ruegeria sp. R11]
          Length = 117

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 73/106 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +NGG++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNSQAEGLIEHFGAVLSDNGGKLVDSEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +  AAI EM+R MR+ ++V+R LT+ VD+HE  P++ +Q+
Sbjct: 61  SFLKTDASAAAIQEMERLMRLHDDVMRVLTIKVDAHEDGPSVQMQK 106


>gi|86749584|ref|YP_486080.1| 30S ribosomal protein S6 [Rhodopseudomonas palustris HaA2]
 gi|123098719|sp|Q2IX91|RS6_RHOP2 RecName: Full=30S ribosomal protein S6
 gi|86572612|gb|ABD07169.1| SSU ribosomal protein S6P [Rhodopseudomonas palustris HaA2]
          Length = 159

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD S+QQ+++   Q   +I+  GG+V      G+R++ YR+ KNRKA++
Sbjct: 1   MPLYEHVFLARQDASTQQVEELTTQITGVIEGLGGKVTKTEAWGLRSLTYRMNKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI  P A + E++R+ RI+E+++R LT+ VD HE+ P+  +++
Sbjct: 61  VLLNIDGPSAVVSEIERQERINEDIVRYLTVRVDEHEEGPSAMMRK 106


>gi|163736680|ref|ZP_02144099.1| 30S ribosomal protein S6 [Phaeobacter gallaeciensis BS107]
 gi|163742693|ref|ZP_02150078.1| ribosomal protein S6 [Phaeobacter gallaeciensis 2.10]
 gi|161383948|gb|EDQ08332.1| ribosomal protein S6 [Phaeobacter gallaeciensis 2.10]
 gi|161390550|gb|EDQ14900.1| 30S ribosomal protein S6 [Phaeobacter gallaeciensis BS107]
          Length = 117

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/106 (41%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +NGG +      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNSQAEGLIEHFGAVLSDNGGSLVDSEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +  AAI EM+R MR+ ++V+R LT+ VD+HE  P++ +Q+
Sbjct: 61  SFLKTDASAAAIQEMERLMRLHDDVMRVLTIKVDAHEDGPSVQMQK 106


>gi|220934099|ref|YP_002512998.1| ribosomal protein S6 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254765462|sp|B8GNS2|RS6_THISH RecName: Full=30S ribosomal protein S6
 gi|219995409|gb|ACL72011.1| ribosomal protein S6 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 138

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 61/109 (55%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y+ LI+ +GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVSAMIERYRGLIEGDGGKIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           V MN+    AA+ E+    R ++ V+R + +L++      +   +  + 
Sbjct: 60  VLMNVECGEAALAELVSAFRFNDAVIRHMVMLMERAFTEASPLAKGREE 108


>gi|254439789|ref|ZP_05053283.1| ribosomal protein S6 [Octadecabacter antarcticus 307]
 gi|198255235|gb|EDY79549.1| ribosomal protein S6 [Octadecabacter antarcticus 307]
          Length = 128

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 75/106 (70%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  I  + +++ +N G+V +    G++T+AY+I KNRK +Y
Sbjct: 12  MPLYEHVFIARQDLSNTQAESLIEHFSTVLSDNDGKVVMSEYWGVKTMAYKINKNRKGHY 71

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            FM   +P  A+ EM+R MR+ E+V+R LT+ VD+HE+ P++ +Q+
Sbjct: 72  AFMRSDAPAPAVQEMERLMRLHEDVMRILTIKVDAHEEGPSVQMQK 117


>gi|28872047|ref|NP_794666.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|66043848|ref|YP_233689.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. syringae B728a]
 gi|71736652|ref|YP_272876.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|213967933|ref|ZP_03396079.1| ribosomal protein S6 [Pseudomonas syringae pv. tomato T1]
 gi|237798287|ref|ZP_04586748.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|257482399|ref|ZP_05636440.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289624606|ref|ZP_06457560.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289648618|ref|ZP_06479961.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|289672602|ref|ZP_06493492.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. syringae FF5]
 gi|298484906|ref|ZP_07003005.1| SSU ribosomal protein S6p [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|301383750|ref|ZP_07232168.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. tomato Max13]
 gi|302059275|ref|ZP_07250816.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. tomato K40]
 gi|302132343|ref|ZP_07258333.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|302185449|ref|ZP_07262122.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. syringae 642]
 gi|32171518|sp|Q87VK3|RS6_PSESM RecName: Full=30S ribosomal protein S6
 gi|75503617|sp|Q4ZYX1|RS6_PSEU2 RecName: Full=30S ribosomal protein S6
 gi|91207931|sp|Q48NZ3|RS6_PSE14 RecName: Full=30S ribosomal protein S6
 gi|28855300|gb|AAO58361.1| ribosomal protein S6 [Pseudomonas syringae pv. tomato str. DC3000]
 gi|63254555|gb|AAY35651.1| Ribosomal protein S6 [Pseudomonas syringae pv. syringae B728a]
 gi|71557205|gb|AAZ36416.1| ribosomal protein S6 [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|213927276|gb|EEB60825.1| ribosomal protein S6 [Pseudomonas syringae pv. tomato T1]
 gi|298160593|gb|EFI01615.1| SSU ribosomal protein S6p [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320321874|gb|EFW77970.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331021|gb|EFW86995.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330865904|gb|EGH00613.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330872263|gb|EGH06412.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330873776|gb|EGH07925.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330886611|gb|EGH20272.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. mori str.
           301020]
 gi|330899905|gb|EGH31324.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330939889|gb|EGH43111.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330951487|gb|EGH51747.1| 30S ribosomal protein S6 [Pseudomonas syringae Cit 7]
 gi|330960079|gb|EGH60339.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. maculicola str.
           ES4326]
 gi|330965991|gb|EGH66251.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|330971570|gb|EGH71636.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|331009771|gb|EGH89827.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331014620|gb|EGH94676.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
 gi|331021139|gb|EGI01196.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 141

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  D      +  ++
Sbjct: 60  VMLNVECTGKALAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLK 104


>gi|99080886|ref|YP_613040.1| 30S ribosomal protein S6 [Ruegeria sp. TM1040]
 gi|259418663|ref|ZP_05742580.1| ribosomal protein S6 [Silicibacter sp. TrichCH4B]
 gi|123252445|sp|Q1GHT8|RS6_SILST RecName: Full=30S ribosomal protein S6
 gi|99037166|gb|ABF63778.1| SSU ribosomal protein S6P [Ruegeria sp. TM1040]
 gi|259344885|gb|EEW56739.1| ribosomal protein S6 [Silicibacter sp. TrichCH4B]
          Length = 117

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 73/106 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +NGG++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNSQAEGLIEHFGAVLSDNGGKLVDQEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P +A+ EM+R MR+ ++V+R LT+ V+ H + P++ +Q+
Sbjct: 61  AFLRSDAPSSAVQEMERLMRLHDDVMRVLTIKVEEHAEGPSVQMQK 106


>gi|114768973|ref|ZP_01446599.1| Ribosomal protein S6 [alpha proteobacterium HTCC2255]
 gi|114549890|gb|EAU52771.1| Ribosomal protein S6 [alpha proteobacterium HTCC2255]
          Length = 119

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/108 (41%), Positives = 73/108 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  I  + +++ +N G+V      G++T+AY+I KNRK +Y
Sbjct: 1   MALYEHVFISRQDLSNAQAEGLIEHFSAVLSDNDGKVIDQEYWGLKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
            F+   +P +A+ EM+R MR+ E+V+R +T+ VD HE+ P++ IQ   
Sbjct: 61  AFLKSDAPSSAVQEMERLMRLHEDVMRVMTIRVDEHEEGPSVVIQAKS 108


>gi|194366362|ref|YP_002028972.1| 30S ribosomal protein S6 [Stenotrophomonas maltophilia R551-3]
 gi|226695133|sp|B4SP94|RS6_STRM5 RecName: Full=30S ribosomal protein S6
 gi|194349166|gb|ACF52289.1| ribosomal protein S6 [Stenotrophomonas maltophilia R551-3]
          Length = 145

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 61/113 (53%), Gaps = 1/113 (0%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VF++  D  S+Q+   I +Y+SL++   G +  + + G R +AY I+   KA+YV
Sbjct: 3   RHYEIVFMVHPD-QSEQVPAMIERYKSLVENGNGTIHRLEDWGRRQLAYPIQNLVKAHYV 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
            +NI +  A ++E+    R ++ VLR+L +  D  +   +L ++  D      
Sbjct: 62  LLNIEADQAVLNELTESFRFNDAVLRNLVIKRDEADTEQSLIMKSKDEKGDKP 114


>gi|77456762|ref|YP_346267.1| 30S ribosomal protein S6 [Pseudomonas fluorescens Pf0-1]
 gi|91207934|sp|Q3KIX8|RS6_PSEPF RecName: Full=30S ribosomal protein S6
 gi|77380765|gb|ABA72278.1| 30S ribosomal protein S6 [Pseudomonas fluorescens Pf0-1]
          Length = 142

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  D      +  ++
Sbjct: 60  VMLNVECTGKALAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLK 104


>gi|85707089|ref|ZP_01038177.1| ribosomal protein S6 [Roseovarius sp. 217]
 gi|85668375|gb|EAQ23248.1| ribosomal protein S6 [Roseovarius sp. 217]
          Length = 150

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 75/110 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+SS Q +  I  + +++ +NGG +      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSSAQAEGLIEHFGAVLTDNGGTLVEHEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
            F+   +P +A+ EM+R MR+ ++V+R LT+ VD+HE+ P++ +Q+ D  
Sbjct: 61  AFLKTDAPSSAVQEMERLMRLHDDVMRVLTIKVDAHEEGPSVQMQKRDER 110


>gi|260219662|emb|CBA26507.1| 30S ribosomal protein S6 [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 121

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 63/119 (52%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + ++  D  S+Q+   + +Y+ +I   GG+V  V + G R + Y I K  KA+Y
Sbjct: 1   MRHYEIILMIHPD-QSEQVPAMLERYKGMITAGGGKVHRVEDWGRRQMVYMINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           + +NI +  A + E++   + ++ VLR LT+     E  P+  ++  +R+D       +
Sbjct: 60  LCVNIEADQAVMSELEHAFKFNDAVLRHLTVSKKKAETGPSSMMKTVEREDARKAQQAE 118


>gi|88704451|ref|ZP_01102165.1| 30S ribosomal protein S6 [Congregibacter litoralis KT71]
 gi|88701502|gb|EAQ98607.1| 30S ribosomal protein S6 [Congregibacter litoralis KT71]
          Length = 150

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/131 (26%), Positives = 69/131 (52%), Gaps = 2/131 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I ++GG V  + + G R +A+ I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTNTITKDGGSVHRLEDWGRRQLAFPIAKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           + MN+ +   A+ E+    R ++ V+R+L +  D      +  ++   +  +R  R+   
Sbjct: 60  ILMNVEASNEAMDELTTTFRYNDAVIRNLVIRRDEPVLEESPIMKAEKESRERKSRYEDR 119

Query: 120 RNVDRKQHVSE 130
           +  ++ +  SE
Sbjct: 120 QGSEKPRRDSE 130


>gi|149907735|ref|ZP_01896482.1| 30S ribosomal protein S6 [Moritella sp. PE36]
 gi|149809405|gb|EDM69334.1| 30S ribosomal protein S6 [Moritella sp. PE36]
          Length = 124

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 56/111 (50%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y +++ E  G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVAGMIERYSAVVTEANGTIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           V MNI +    I E++   R ++ V+RS+ L         +   +  +   
Sbjct: 60  VLMNIEAGQDVIDELENNFRFNDAVIRSMFLRTKGVVTEASPMAKAKEERR 110


>gi|330984551|gb|EGH82654.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 141

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  D      +  ++
Sbjct: 60  VMLNVECAGKALAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLK 104


>gi|87199437|ref|YP_496694.1| 30S ribosomal protein S6 [Novosphingobium aromaticivorans DSM
           12444]
 gi|123489788|sp|Q2G8G3|RS6_NOVAD RecName: Full=30S ribosomal protein S6
 gi|87135118|gb|ABD25860.1| SSU ribosomal protein S6P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 120

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 74/108 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+S  Q+         +++ N G+V      G+R++AY+I+KNRKA++
Sbjct: 1   MPLYEHVFLARQDLSQAQVDALAAAATEIVESNEGKVTKTETWGLRSLAYKIQKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
           V +NI +  A I E++R+ +I+E+V+R +T+ VD HE  P++ ++++D
Sbjct: 61  VLLNIEASGATIAELERQTQINEDVIRYMTVRVDEHEAGPSVMMRKND 108


>gi|331007840|ref|ZP_08330939.1| SSU ribosomal protein S6p [gamma proteobacterium IMCC1989]
 gi|330418357|gb|EGG92924.1| SSU ribosomal protein S6p [gamma proteobacterium IMCC1989]
          Length = 144

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/138 (26%), Positives = 65/138 (47%), Gaps = 4/138 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y + I E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVAGMVERYTASINEEGGQVHRLEDWGRRHLAYSINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ---RHDRDDRNDRFP 117
           + MN+      ++E+    R ++ VLR + +  D      +  ++               
Sbjct: 60  ILMNVECSDTVLNELTTTFRYNDAVLRHMVIRTDEAVVEESPIMKAEKEGRERRTRREER 119

Query: 118 RDRNVDRKQHVSEEKPLS 135
            +   ++K+  SE  P S
Sbjct: 120 SEPAQEQKKESSEAAPAS 137


>gi|148559735|ref|YP_001258474.1| 30S ribosomal protein S6 [Brucella ovis ATCC 25840]
 gi|225626963|ref|ZP_03785002.1| ribosomal protein S6 [Brucella ceti str. Cudo]
 gi|237814928|ref|ZP_04593926.1| ribosomal protein S6 [Brucella abortus str. 2308 A]
 gi|148370992|gb|ABQ60971.1| 30S ribosomal protein S6 [Brucella ovis ATCC 25840]
 gi|225618620|gb|EEH15663.1| ribosomal protein S6 [Brucella ceti str. Cudo]
 gi|237789765|gb|EEP63975.1| ribosomal protein S6 [Brucella abortus str. 2308 A]
          Length = 156

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/104 (49%), Positives = 74/104 (71%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV L RQDIS QQ+   + Q++ +++ NGG+   V   G+R + YRI+KNRKAYY
Sbjct: 9   MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYY 68

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             +NI +P AA+ EM+R+MRI+E+VLR LT+ V+ HE+  +  +
Sbjct: 69  TLVNIDAPAAAVAEMERQMRINEDVLRFLTVRVEEHEEGQSAML 112


>gi|49076654|gb|AAT49585.1| PA4935 [synthetic construct]
          Length = 140

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 63/125 (50%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y   I+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVGGMVERYTKAIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+     A+ E++   R ++ V+R+L +  D      +  ++  +  +         
Sbjct: 60  VLMNVECSAKALAELEDNFRYNDAVIRNLVMRRDEAVTEQSEMLKAEESRNERRERRGRP 119

Query: 121 NVDRK 125
           N + +
Sbjct: 120 NDNAE 124


>gi|110680235|ref|YP_683242.1| 30S ribosomal protein S6 [Roseobacter denitrificans OCh 114]
 gi|123065437|sp|Q164N7|RS6_ROSDO RecName: Full=30S ribosomal protein S6
 gi|109456351|gb|ABG32556.1| ribosomal protein S6 [Roseobacter denitrificans OCh 114]
          Length = 117

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 73/106 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +NGG++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNTQAEGLIEHFGTVLSDNGGKLVDHEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  A+HEM+R MR+ ++V+R LT+ VD H + P++ +Q+
Sbjct: 61  AFLRSDAPAPAVHEMERLMRLHDDVMRVLTIKVDEHAELPSVQMQK 106


>gi|319404043|emb|CBI77631.1| 30S ribosomal protein S6 (fragment) [Bartonella rochalimae ATCC
          BAA-1498]
          Length = 96

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/95 (52%), Positives = 73/95 (76%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M LYEH+FL RQDI+ QQI + +  Y+ +I+ NGG+V  V   G+R++AYRIRKNRKAYY
Sbjct: 1  MALYEHIFLARQDIAPQQIDELLETYKGVIEANGGKVGRVENWGLRSLAYRIRKNRKAYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V +NI +P + I E++R+MRI+E++LR +T+ V+ 
Sbjct: 61 VLINIDAPASTIAELERQMRINEDILRYMTVRVEK 95


>gi|113461581|ref|YP_719650.1| 30S ribosomal protein S6 [Haemophilus somnus 129PT]
 gi|123132186|sp|Q0I4E5|RS6_HAES1 RecName: Full=30S ribosomal protein S6
 gi|112823624|gb|ABI25713.1| SSU ribosomal protein S6P [Haemophilus somnus 129PT]
          Length = 125

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 64/126 (50%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y S I+E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTSSIKEAGGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ VLR++ +         +  ++  +          + 
Sbjct: 60  VLMNVEAPQEVIDELETTFRYNDAVLRNVIIRTKHAVTEASPMVKAREERKPLTEVENND 119

Query: 121 NVDRKQ 126
             D ++
Sbjct: 120 FEDAEE 125


>gi|329114158|ref|ZP_08242920.1| 30S ribosomal protein S6 [Acetobacter pomorum DM001]
 gi|326696234|gb|EGE47913.1| 30S ribosomal protein S6 [Acetobacter pomorum DM001]
          Length = 160

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/115 (38%), Positives = 72/115 (62%), Gaps = 1/115 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE V + R DIS QQ+   +    + I+ +GG VR     G+R++AYRI+KNRK +Y
Sbjct: 8   MPLYETVLIARNDISQQQVDAILDGIAAQIEADGGAVRKREYWGLRSLAYRIKKNRKGHY 67

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
             + + +    + E++R++ ++E+VLR LTL V+  +++P+  + R   DDR DR
Sbjct: 68  ALLGLEARSELVKEIERQLALNEDVLRLLTLRVEEIDEAPSPVLSRKG-DDRGDR 121


>gi|170718757|ref|YP_001783942.1| 30S ribosomal protein S6 [Haemophilus somnus 2336]
 gi|189045472|sp|B0US43|RS6_HAES2 RecName: Full=30S ribosomal protein S6
 gi|168826886|gb|ACA32257.1| ribosomal protein S6 [Haemophilus somnus 2336]
          Length = 125

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 63/126 (50%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   ++E GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGSVKEAGGQIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ VLR++ +         +  ++  +          + 
Sbjct: 60  VLMNVEAPQEVIDELETTFRYNDAVLRNVIIRTKHAVTEASPMVKAREERKPLTEVENND 119

Query: 121 NVDRKQ 126
             D ++
Sbjct: 120 FEDAEE 125


>gi|146305680|ref|YP_001186145.1| 30S ribosomal protein S6 [Pseudomonas mendocina ymp]
 gi|330501634|ref|YP_004378503.1| 30S ribosomal protein S6 [Pseudomonas mendocina NK-01]
 gi|166227367|sp|A4XPZ7|RS6_PSEMY RecName: Full=30S ribosomal protein S6
 gi|145573881|gb|ABP83413.1| SSU ribosomal protein S6P [Pseudomonas mendocina ymp]
 gi|328915920|gb|AEB56751.1| 30S ribosomal protein S6 [Pseudomonas mendocina NK-01]
          Length = 140

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  D      +  ++
Sbjct: 60  VMLNVECTGKALAELEDNFRYNDAVIRNLVIRRDEAVTGQSEMLK 104


>gi|258542089|ref|YP_003187522.1| 30S ribosomal protein S6 [Acetobacter pasteurianus IFO 3283-01]
 gi|256633167|dbj|BAH99142.1| SSU ribosomal protein S6P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636224|dbj|BAI02193.1| SSU ribosomal protein S6P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639279|dbj|BAI05241.1| SSU ribosomal protein S6P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642333|dbj|BAI08288.1| SSU ribosomal protein S6P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645388|dbj|BAI11336.1| SSU ribosomal protein S6P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648443|dbj|BAI14384.1| SSU ribosomal protein S6P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651496|dbj|BAI17430.1| SSU ribosomal protein S6P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654487|dbj|BAI20414.1| SSU ribosomal protein S6P [Acetobacter pasteurianus IFO 3283-12]
          Length = 153

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 72/115 (62%), Gaps = 1/115 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE V + R DIS QQ+   +    + I+ +GG VR     G+R++AYRI+KNRK +Y
Sbjct: 1   MPLYETVLIARNDISQQQVDAILDGIAAQIEADGGAVRKREYWGLRSLAYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
             + + +    + E++R++ ++E+VLR +TL V+  +++P+  + R   DDR DR
Sbjct: 61  ALLGLEARSELVKEIERQLALNEDVLRLMTLRVEEIDETPSPVLSRKG-DDRGDR 114


>gi|144899045|emb|CAM75909.1| 30S ribosomal protein S6 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 144

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 54/141 (38%), Positives = 81/141 (57%), Gaps = 15/141 (10%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE V L RQ++S+ Q++  I +   ++ + GG V      G+R IAYR++KNRKA+Y
Sbjct: 1   MPFYECVILARQEVSAPQVETLIDEMAGVLAQGGGTVAKKEFWGLRNIAYRVKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH------------- 107
           V +N+ SP AA+ EM+R+M ++E+VLR LT+ VD  E+ P+  +Q               
Sbjct: 61  VLLNLDSPSAAVKEMERQMSLNEDVLRVLTVRVDELEEGPSAMMQAKNSRDERPRREDRG 120

Query: 108 --DRDDRNDRFPRDRNVDRKQ 126
             DR  R DR PR+    R +
Sbjct: 121 FGDRGPREDRGPREDRPRRSE 141


>gi|93005860|ref|YP_580297.1| 30S ribosomal protein S6 [Psychrobacter cryohalolentis K5]
 gi|122415535|sp|Q1QBZ0|RS6_PSYCK RecName: Full=30S ribosomal protein S6
 gi|92393538|gb|ABE74813.1| SSU ribosomal protein S6P [Psychrobacter cryohalolentis K5]
          Length = 131

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 59/122 (48%), Gaps = 3/122 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y  L+Q+N G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYELVLLVHPD-QSDQVVGMVERYIKLVQDNNGTIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V  NI +    + E++   R ++ ++RSL +  D      +   +    D++  R    R
Sbjct: 60  VLFNIETDGETLAELEELFRYNDAIIRSLVMRRDDAVTEESQLAKNA--DEKRARKATTR 117

Query: 121 NV 122
             
Sbjct: 118 RP 119


>gi|16272491|ref|NP_438705.1| 30S ribosomal protein S6 [Haemophilus influenzae Rd KW20]
 gi|68249144|ref|YP_248256.1| 30S ribosomal protein S6 [Haemophilus influenzae 86-028NP]
 gi|145628928|ref|ZP_01784728.1| 30S ribosomal protein S6 [Haemophilus influenzae 22.1-21]
 gi|145630272|ref|ZP_01786053.1| 30S ribosomal protein S6 [Haemophilus influenzae R3021]
 gi|145633501|ref|ZP_01789230.1| 30S ribosomal protein S6 [Haemophilus influenzae 3655]
 gi|145635372|ref|ZP_01791074.1| 30S ribosomal protein S6 [Haemophilus influenzae PittAA]
 gi|145637412|ref|ZP_01793071.1| 30S ribosomal protein S6 [Haemophilus influenzae PittHH]
 gi|145638543|ref|ZP_01794152.1| 30S ribosomal protein S6 [Haemophilus influenzae PittII]
 gi|145640520|ref|ZP_01796104.1| 30S ribosomal protein S6 [Haemophilus influenzae R3021]
 gi|148827738|ref|YP_001292491.1| 30S ribosomal protein S6 [Haemophilus influenzae PittGG]
 gi|229844294|ref|ZP_04464434.1| 30S ribosomal protein S6 [Haemophilus influenzae 6P18H1]
 gi|229846630|ref|ZP_04466738.1| 30S ribosomal protein S6 [Haemophilus influenzae 7P49H1]
 gi|260580994|ref|ZP_05848817.1| ribosomal protein S6 [Haemophilus influenzae RdAW]
 gi|260582749|ref|ZP_05850536.1| ribosomal protein S6 [Haemophilus influenzae NT127]
 gi|319775532|ref|YP_004138020.1| 30S ribosomal subunit protein S6 [Haemophilus influenzae F3047]
 gi|319897936|ref|YP_004136133.1| 30S ribosomal subunit protein s6 [Haemophilus influenzae F3031]
 gi|325579202|ref|ZP_08149158.1| 30S ribosomal protein S6 [Haemophilus parainfluenzae ATCC 33392]
 gi|329122425|ref|ZP_08251012.1| 30S ribosomal protein S6 [Haemophilus aegyptius ATCC 11116]
 gi|1173270|sp|P44375|RS6_HAEIN RecName: Full=30S ribosomal protein S6
 gi|81336449|sp|Q4QN01|RS6_HAEI8 RecName: Full=30S ribosomal protein S6
 gi|166226970|sp|A5UH52|RS6_HAEIG RecName: Full=30S ribosomal protein S6
 gi|1573532|gb|AAC22205.1| ribosomal protein S6 (rpS6) [Haemophilus influenzae Rd KW20]
 gi|68057343|gb|AAX87596.1| 30S ribosomal protein S6 [Haemophilus influenzae 86-028NP]
 gi|144979398|gb|EDJ89084.1| 30S ribosomal protein S6 [Haemophilus influenzae 22.1-21]
 gi|144984007|gb|EDJ91444.1| 30S ribosomal protein S6 [Haemophilus influenzae R3021]
 gi|144985870|gb|EDJ92478.1| 30S ribosomal protein S6 [Haemophilus influenzae 3655]
 gi|145267378|gb|EDK07380.1| 30S ribosomal protein S6 [Haemophilus influenzae PittAA]
 gi|145269358|gb|EDK09302.1| 30S ribosomal protein S6 [Haemophilus influenzae PittHH]
 gi|145272138|gb|EDK12046.1| 30S ribosomal protein S6 [Haemophilus influenzae PittII]
 gi|145275106|gb|EDK14968.1| 30S ribosomal protein S6 [Haemophilus influenzae 22.4-21]
 gi|148718980|gb|ABR00108.1| 30S ribosomal protein S6 [Haemophilus influenzae PittGG]
 gi|229810723|gb|EEP46441.1| 30S ribosomal protein S6 [Haemophilus influenzae 7P49H1]
 gi|229812543|gb|EEP48232.1| 30S ribosomal protein S6 [Haemophilus influenzae 6P18H1]
 gi|260092353|gb|EEW76293.1| ribosomal protein S6 [Haemophilus influenzae RdAW]
 gi|260094199|gb|EEW78100.1| ribosomal protein S6 [Haemophilus influenzae NT127]
 gi|301155577|emb|CBW15045.1| 30S ribosomal subunit protein S6 [Haemophilus parainfluenzae T3T1]
 gi|301169262|emb|CBW28859.1| 30S ribosomal subunit protein S6 [Haemophilus influenzae 10810]
 gi|309750047|gb|ADO80031.1| 30S ribosomal subunit protein S6 [Haemophilus influenzae R2866]
 gi|309972302|gb|ADO95503.1| 30S ribosomal subunit protein S6 [Haemophilus influenzae R2846]
 gi|317433442|emb|CBY81825.1| 30S ribosomal subunit protein S6 [Haemophilus influenzae F3031]
 gi|317450123|emb|CBY86337.1| 30S ribosomal subunit protein S6 [Haemophilus influenzae F3047]
 gi|325159437|gb|EGC71571.1| 30S ribosomal protein S6 [Haemophilus parainfluenzae ATCC 33392]
 gi|327473707|gb|EGF19126.1| 30S ribosomal protein S6 [Haemophilus aegyptius ATCC 11116]
          Length = 125

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   ++E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGSVKEAGGQVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P   I E++   R ++ VLRSL +         +      +          + 
Sbjct: 60  VLMNVEAPQQVIDELETTFRYNDAVLRSLVIHTKHAVTEASPMKAAKEERKPLAEVENND 119

Query: 121 NVDRKQ 126
             D ++
Sbjct: 120 FEDAEE 125


>gi|239946940|ref|ZP_04698693.1| 30S ribosomal protein S6 [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921216|gb|EER21240.1| 30S ribosomal protein S6 [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 145

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 64/112 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 25  MSFYESVFIIRQDVSLNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHY 84

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ +        E++RKM+++EN++R LT+  DS    P+  ++    ++ 
Sbjct: 85  YFLGLDITGNVKEELERKMKLNENIIRFLTIKADSISSEPSPILKNQSTENT 136


>gi|146329026|ref|YP_001210005.1| ribosomal protein S6 [Dichelobacter nodosus VCS1703A]
 gi|166226827|sp|A5EXN1|RS6_DICNV RecName: Full=30S ribosomal protein S6
 gi|146232496|gb|ABQ13474.1| ribosomal protein S6 [Dichelobacter nodosus VCS1703A]
          Length = 108

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 59/109 (54%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y++ I+   G+V  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVSAMVERYRAQIEAAQGKVHRLEDWGRRVLAYPIQKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           + MNI      + E++   R ++ +LR + +  D      ++ +Q   +
Sbjct: 60  ILMNIECDRQTLAELESNFRFNDAILRHMIIRRDEAVTEASMMMQEVKK 108


>gi|296444435|ref|ZP_06886400.1| ribosomal protein S6 [Methylosinus trichosporium OB3b]
 gi|296258082|gb|EFH05144.1| ribosomal protein S6 [Methylosinus trichosporium OB3b]
          Length = 146

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 48/106 (45%), Positives = 78/106 (73%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH++L RQDIS QQ++   GQ++++I   GG+V      G++++AYRI+KNRKA++
Sbjct: 1   MALYEHIYLARQDISPQQVEALTGQFKTIIASLGGKVSKTEYWGVKSLAYRIKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             +NI +PPAA+ E++R+  + E+VLR LTL VD+ E+ P+  +++
Sbjct: 61  TLLNIEAPPAALAEVERQQGLSEDVLRFLTLRVDALEEGPSAQLRK 106


>gi|126728810|ref|ZP_01744625.1| Ribosomal protein S6 [Sagittula stellata E-37]
 gi|126710740|gb|EBA09791.1| Ribosomal protein S6 [Sagittula stellata E-37]
          Length = 120

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 42/107 (39%), Positives = 76/107 (71%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVF+ RQD+S+ Q +  +  + +++++NGG V      G++T+A++I KNRK +Y
Sbjct: 1   MPLYEHVFISRQDLSNAQAEGLVEHFSTVLKDNGGNVIESEYWGVKTMAFKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH 107
            ++   +P +A+ EM+R MR+ ++V+R LT+ VD+HE+ P++ +Q+ 
Sbjct: 61  AYLRTDAPSSAVQEMERLMRLHDDVMRVLTIKVDAHEEGPSVQMQKK 107


>gi|89094157|ref|ZP_01167100.1| 30S ribosomal protein S6 [Oceanospirillum sp. MED92]
 gi|89081632|gb|EAR60861.1| 30S ribosomal protein S6 [Oceanospirillum sp. MED92]
          Length = 140

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 30/108 (27%), Positives = 52/108 (48%), Gaps = 1/108 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  +  S+Q+   + +Y SLI+   G +  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIVFLVHPN-QSEQVSAMVERYTSLIESAEGTIHRLEDWGRRQLAYPINNAHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
           V MNI      + E++   R ++ VLR++ +         +       
Sbjct: 60  VLMNIECGQETLDELENLFRYNDAVLRNMVIRRKEAITEISPIKAAES 107


>gi|84517317|ref|ZP_01004671.1| ribosomal protein S6 [Loktanella vestfoldensis SKA53]
 gi|84508797|gb|EAQ05260.1| ribosomal protein S6 [Loktanella vestfoldensis SKA53]
          Length = 133

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 74/109 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +NGG++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNTQAEALIEHFGTILADNGGKLLENEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
             +   +P  AI EM+R MR++E+V+R LT+ VD+HE  P++ +Q+ + 
Sbjct: 61  ALLRTDAPAPAIQEMERLMRLNEDVMRVLTIKVDAHEDGPSVQMQKREE 109


>gi|146283970|ref|YP_001174123.1| 30S ribosomal protein S6 [Pseudomonas stutzeri A1501]
 gi|166227369|sp|A4VQN0|RS6_PSEU5 RecName: Full=30S ribosomal protein S6
 gi|145572175|gb|ABP81281.1| ribosomal protein S6 [Pseudomonas stutzeri A1501]
 gi|327482298|gb|AEA85608.1| 30S ribosomal protein S6 [Pseudomonas stutzeri DSM 4166]
          Length = 138

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 31/105 (29%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  D      +  ++
Sbjct: 60  VMLNVECSGKALAELEDNFRYNDAVIRNLIIRRDEAVTEQSEMLK 104


>gi|221068654|ref|ZP_03544759.1| ribosomal protein S6 [Comamonas testosteroni KF-1]
 gi|220713677|gb|EED69045.1| ribosomal protein S6 [Comamonas testosteroni KF-1]
          Length = 120

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 63/119 (52%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + L+  D  S+Q+   + +Y+ +I   GG+V    + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIILLIHPD-QSEQVPAMLERYKGMIAAGGGKVHREEDWGRRQLAYMINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           + +NI +  A + E++   + ++ VLR LT+     + + +  ++  +R++       +
Sbjct: 60  LCLNIEADQAVMAELEHAFKFNDAVLRHLTVQKKKADTAASAMMKSVEREEARKANQAE 118


>gi|312958663|ref|ZP_07773183.1| 30S ribosomal protein S6 [Pseudomonas fluorescens WH6]
 gi|311287206|gb|EFQ65767.1| 30S ribosomal protein S6 [Pseudomonas fluorescens WH6]
          Length = 140

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  +      +  ++
Sbjct: 60  VMLNVECTGKALAELEDNFRYNDAVIRNLVIRREEAVTGQSEMLK 104


>gi|229588086|ref|YP_002870205.1| 30S ribosomal protein S6 [Pseudomonas fluorescens SBW25]
 gi|259495341|sp|C3KE67|RS6_PSEFS RecName: Full=30S ribosomal protein S6
 gi|229359952|emb|CAY46806.1| 30S ribosomal protein S6 [Pseudomonas fluorescens SBW25]
          Length = 140

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  +      +  ++
Sbjct: 60  VMLNVECTGKALAELEDNFRYNDAVIRNLVIRREEAVTGQSEMLK 104


>gi|119474661|ref|ZP_01615014.1| 30S ribosomal protein S6 [marine gamma proteobacterium HTCC2143]
 gi|119450864|gb|EAW32097.1| 30S ribosomal protein S6 [marine gamma proteobacterium HTCC2143]
          Length = 145

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 62/122 (50%), Gaps = 1/122 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y   I++NGG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVPGMVERYTQAIEKNGGKIHRLEDWGRRHLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             MN+ +   AI E+    R ++ VLR+L + +D    + +  ++             +R
Sbjct: 60  TLMNVEADQEAIDELTTNFRYNDAVLRNLVIKMDESVTAESPIMKAEKESRERRASRPER 119

Query: 121 NV 122
             
Sbjct: 120 RD 121


>gi|15600128|ref|NP_253622.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa PAO1]
 gi|107104034|ref|ZP_01367952.1| hypothetical protein PaerPA_01005107 [Pseudomonas aeruginosa PACS2]
 gi|116053084|ref|YP_793403.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152985524|ref|YP_001350983.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa PA7]
 gi|218894030|ref|YP_002442899.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa LESB58]
 gi|296391775|ref|ZP_06881250.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa PAb1]
 gi|313109937|ref|ZP_07795865.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa 39016]
 gi|13959534|sp|Q9HUM9|RS6_PSEAE RecName: Full=30S ribosomal protein S6
 gi|122256903|sp|Q02F83|RS6_PSEAB RecName: Full=30S ribosomal protein S6
 gi|166227366|sp|A6VD48|RS6_PSEA7 RecName: Full=30S ribosomal protein S6
 gi|226695116|sp|B7V1Z8|RS6_PSEA8 RecName: Full=30S ribosomal protein S6
 gi|9951214|gb|AAG08320.1|AE004906_8 30S ribosomal protein S6 [Pseudomonas aeruginosa PAO1]
 gi|115588305|gb|ABJ14320.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|150960682|gb|ABR82707.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa PA7]
 gi|218774258|emb|CAW30075.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa LESB58]
 gi|310882367|gb|EFQ40961.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa 39016]
          Length = 139

 Score =  121 bits (303), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 63/125 (50%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y   I+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVGGMVERYTKAIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+     A+ E++   R ++ V+R+L +  D      +  ++  +  +         
Sbjct: 60  VLMNVECSAKALAELEDNFRYNDAVIRNLVMRRDEAVTEQSEMLKAEESRNERRERRERP 119

Query: 121 NVDRK 125
           N + +
Sbjct: 120 NDNAE 124


>gi|163731327|ref|ZP_02138774.1| 30S ribosomal protein S6 [Roseobacter litoralis Och 149]
 gi|161394781|gb|EDQ19103.1| 30S ribosomal protein S6 [Roseobacter litoralis Och 149]
          Length = 117

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 43/106 (40%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +NGG +      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNTQAEGLIEHFGTVLSDNGGALVDHEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  A+HEM+R MR+ ++V+R LT+ VD H + P++ +Q+
Sbjct: 61  AFLRSDAPAPAVHEMERLMRLHDDVMRVLTIKVDEHAELPSVQMQK 106


>gi|86138736|ref|ZP_01057308.1| ribosomal protein S6 [Roseobacter sp. MED193]
 gi|85824383|gb|EAQ44586.1| ribosomal protein S6 [Roseobacter sp. MED193]
          Length = 117

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  +  + +++ +N G++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNSQAEGLVEHFGAVLADNEGKLVDSEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P AAI EM+R MR+ ++V+R LT+ VD H + P++ +Q+
Sbjct: 61  AFLRTDAPAAAIQEMERLMRLHDDVMRVLTIKVDEHAEGPSVQMQK 106


>gi|88800241|ref|ZP_01115808.1| 30S ribosomal protein S6 [Reinekea sp. MED297]
 gi|88776956|gb|EAR08164.1| 30S ribosomal protein S6 [Reinekea sp. MED297]
          Length = 139

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 59/132 (44%), Gaps = 1/132 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S+Q+   + +Y +++ + GG V    + G R +A+ I+   KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSEQVPAMVERYTTVVTDAGGTVHRNEDWGRRQLAFPIQDLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + +N+      I ++K   R ++ +LRSL +         +  ++  +     +      
Sbjct: 60  ILLNVEVSDETIDDLKTTFRFNDAILRSLIMRRKDAVTESSPMMKSVEAKKAKEEAQAAA 119

Query: 121 NVDRKQHVSEEK 132
              R +    E 
Sbjct: 120 RAPRTEEAETEA 131


>gi|94497410|ref|ZP_01303980.1| ribosomal protein S6 [Sphingomonas sp. SKA58]
 gi|94423041|gb|EAT08072.1| ribosomal protein S6 [Sphingomonas sp. SKA58]
          Length = 141

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 72/108 (66%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD++  Q+         ++++  G+V  V   G+R++AY+I KNRKA+Y
Sbjct: 1   MALYEHVFLARQDLAQAQVDALAETATKIVEDMDGKVTKVETWGLRSLAYKIAKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
           V +NI +P   + E++R+ +I+E+++R +T+ VD  E  P++ +++ +
Sbjct: 61  VMLNIDAPAGVVAELERQTQINEDIIRYMTVKVDELETGPSVMMRKQE 108


>gi|330807240|ref|YP_004351702.1| 30S ribosomal protein S6 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375348|gb|AEA66698.1| 30S ribosomal protein S6 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 142

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  +      +  ++
Sbjct: 60  VMLNVECTGKALAELEDNFRYNDAVIRNLVIRREEAVTGQSEMLK 104


>gi|119502818|ref|ZP_01624903.1| Na+/solute symporter [marine gamma proteobacterium HTCC2080]
 gi|119461164|gb|EAW42254.1| Na+/solute symporter [marine gamma proteobacterium HTCC2080]
          Length = 151

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 71/132 (53%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y ++I ++GG V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEVVFMVHPD-QSEQVPGMIERYSAVITKDGGTVHRLEDWGRRQLAYHINKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD-DRNDRFPRD 119
           + MN+ +   A+ E+    R ++ V+R+L +  D      +L ++    D +R  R+   
Sbjct: 60  ILMNVEASNEAMEELSTTFRYNDAVIRNLVIRRDELVAEESLIMKAEKEDRERKSRYQER 119

Query: 120 RNVDRKQHVSEE 131
           +  + K   +E+
Sbjct: 120 QAAESKPPEAEK 131


>gi|148825179|ref|YP_001289932.1| 30S ribosomal protein S6 [Haemophilus influenzae PittEE]
 gi|166226969|sp|A5U9U8|RS6_HAEIE RecName: Full=30S ribosomal protein S6
 gi|148715339|gb|ABQ97549.1| 30S ribosomal protein S6 [Haemophilus influenzae PittEE]
          Length = 125

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 60/126 (47%), Gaps = 1/126 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y   ++E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGSVKEAGGQVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+  P   I E++   R ++ VLRSL +         +      +          + 
Sbjct: 60  VLMNVEVPQQVIDELETTFRYNDAVLRSLVIHTKHAVTEASPMKAAKEERKPLAEVENND 119

Query: 121 NVDRKQ 126
             D ++
Sbjct: 120 FEDAEE 125


>gi|70734081|ref|YP_257721.1| 30S ribosomal protein S6 [Pseudomonas fluorescens Pf-5]
 gi|91207932|sp|Q4KJ62|RS6_PSEF5 RecName: Full=30S ribosomal protein S6
 gi|68348380|gb|AAY95986.1| ribosomal protein S6 [Pseudomonas fluorescens Pf-5]
          Length = 141

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 30/105 (28%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           V +N+     A+ E++   R ++ V+R+L +  +      +  ++
Sbjct: 60  VMLNVECTGKALAELEDNFRYNDAVIRNLVIRREEAITGQSEMLK 104


>gi|154247047|ref|YP_001418005.1| 30S ribosomal protein S6 [Xanthobacter autotrophicus Py2]
 gi|226705649|sp|A7IK05|RS6_XANP2 RecName: Full=30S ribosomal protein S6
 gi|154161132|gb|ABS68348.1| ribosomal protein S6 [Xanthobacter autotrophicus Py2]
          Length = 152

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 78/106 (73%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD+++QQ+++   +++ +I+ NGG V      G++++ YRI KNRKA++
Sbjct: 1   MPLYEHVFLARQDVTAQQVEELTTRFKGVIEANGGSVGKTEYWGVKSLTYRINKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             +NI +P AAI E++R+ RIDE+VLR LTL V+ HE+ P+  +Q+
Sbjct: 61  TLLNINAPAAAIQELERQQRIDEDVLRILTLRVEEHEEGPSAMLQK 106


>gi|83591754|ref|YP_425506.1| 30S ribosomal protein S6 [Rhodospirillum rubrum ATCC 11170]
 gi|91207786|sp|Q2RXC6|RS6_RHORT RecName: Full=30S ribosomal protein S6
 gi|83574668|gb|ABC21219.1| SSU ribosomal protein S6P [Rhodospirillum rubrum ATCC 11170]
          Length = 160

 Score =  119 bits (300), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 73/107 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE V + RQDIS+ Q+     +  +++ E GG V      G+RT+ +RI+KNRK +Y
Sbjct: 1   MALYECVLIARQDISNAQVDTMGDEVSAILSEGGGSVSKREYWGLRTLNFRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH 107
           + +NI +P  A+HE+ R++R++E+V+R +T+ V+  E++P+  +Q++
Sbjct: 61  LLLNIDAPAPAVHELDRRLRLNEDVIRHMTVKVEELEEAPSAMMQKN 107


>gi|264677149|ref|YP_003277055.1| ribosomal protein S6 [Comamonas testosteroni CNB-2]
 gi|299530693|ref|ZP_07044108.1| 30S ribosomal protein S6 [Comamonas testosteroni S44]
 gi|262207661|gb|ACY31759.1| ribosomal protein S6 [Comamonas testosteroni CNB-2]
 gi|298721209|gb|EFI62151.1| 30S ribosomal protein S6 [Comamonas testosteroni S44]
          Length = 120

 Score =  119 bits (300), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 32/119 (26%), Positives = 63/119 (52%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + L+  D  S+Q+   + +Y+ +I   GG+V    + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIILLIHPD-QSEQVPAMLERYKGMIAAGGGKVHREEDWGRRQLAYMINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           + +NI +  A + E++   + ++ VLR LT+     E + +  ++  +R++       +
Sbjct: 60  LCLNIEADQAVMAELEHAFKFNDAVLRHLTVQKKKAETAASAMMKSVEREEARKANQAE 118


>gi|17987763|ref|NP_540397.1| 30S ribosomal protein S6 [Brucella melitensis bv. 1 str. 16M]
 gi|256044171|ref|ZP_05447078.1| 30S ribosomal protein S6 [Brucella melitensis bv. 1 str. Rev.1]
 gi|260563529|ref|ZP_05834015.1| SSU ribosomal protein S6P [Brucella melitensis bv. 1 str. 16M]
 gi|265990584|ref|ZP_06103141.1| SSU ribosomal protein S6P [Brucella melitensis bv. 1 str. Rev.1]
 gi|24212309|sp|Q8YFP0|RS6_BRUME RecName: Full=30S ribosomal protein S6
 gi|17983485|gb|AAL52661.1| ssu ribosomal protein s6p [Brucella melitensis bv. 1 str. 16M]
 gi|260153545|gb|EEW88637.1| SSU ribosomal protein S6P [Brucella melitensis bv. 1 str. 16M]
 gi|263001368|gb|EEZ13943.1| SSU ribosomal protein S6P [Brucella melitensis bv. 1 str. Rev.1]
          Length = 148

 Score =  119 bits (300), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 50/104 (48%), Positives = 73/104 (70%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV L RQDIS QQ+   + Q++ +++ NGG+   V   G+R + YRI+KNRKAYY
Sbjct: 1   MALYEHVLLARQDISQQQVDALVEQFKGVLEANGGKFGKVENWGLRPLTYRIKKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             +NI +P AA+ EM+R+MRI+E+VL  LT+ V+ HE+  +  +
Sbjct: 61  TLVNIDAPAAAVAEMERQMRINEDVLSFLTVRVEEHEEGQSAML 104


>gi|307822878|ref|ZP_07653109.1| ribosomal protein S6 [Methylobacter tundripaludum SV96]
 gi|307736482|gb|EFO07328.1| ribosomal protein S6 [Methylobacter tundripaludum SV96]
          Length = 152

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 61/120 (50%), Gaps = 1/120 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S Q+   I +Y+S I+   G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSSQVPAMIERYKSTIETASGKIHRLEDWGRRHLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+    A + E++   R ++ +LRS+TLL  +     ++       +++        
Sbjct: 60  VLMNVECDQATLEELESGFRFNDAILRSMTLLQKAAITEASIIATSTAEENKAAESRAKD 119


>gi|92117878|ref|YP_577607.1| 30S ribosomal protein S6 [Nitrobacter hamburgensis X14]
 gi|122417598|sp|Q1QKV0|RS6_NITHX RecName: Full=30S ribosomal protein S6
 gi|91800772|gb|ABE63147.1| SSU ribosomal protein S6P [Nitrobacter hamburgensis X14]
          Length = 147

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 52/125 (41%), Positives = 80/125 (64%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD SSQQ+++   Q   +I   GG+V      G+R++ YR++KNRKA++
Sbjct: 1   MPLYEHVFLARQDASSQQVEELTNQITGVITGLGGKVTKTENWGVRSLTYRMKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI  P A + E++R+ RI E+V+R L++ V+ HE+ P+  +++ DRD   D      
Sbjct: 61  VLLNIDGPAAVVSEIERQERIHEDVIRYLSIRVEEHEEGPSAMMRKADRDRERDDRGGGF 120

Query: 121 NVDRK 125
             DR+
Sbjct: 121 RGDRE 125


>gi|229586274|ref|YP_002844775.1| 30S ribosomal protein S6 [Rickettsia africae ESF-5]
 gi|15619101|gb|AAL02602.1| 30S ribosomal protein S6 [Rickettsia conorii str. Malish 7]
 gi|228021324|gb|ACP53032.1| 30S ribosomal protein S6 [Rickettsia africae ESF-5]
          Length = 145

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 64/112 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 25  MSFYESVFIIRQDVSLNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHY 84

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ +        E++RKM+++EN++R LT+  DS    P+  ++    ++ 
Sbjct: 85  YFLGLDITGNVKEELERKMKLNENIIRFLTIQADSISSEPSPILKNQSTENT 136


>gi|126735965|ref|ZP_01751709.1| ribosomal protein S6 [Roseobacter sp. CCS2]
 gi|126714522|gb|EBA11389.1| ribosomal protein S6 [Roseobacter sp. CCS2]
          Length = 117

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +NGG++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNTQAESLIEHFGTVLADNGGKLLENEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            FM   +P  AI EM+R MR+ E+V+R LT+ VD+H++ P++ +Q+
Sbjct: 61  AFMRTDAPAPAIQEMERLMRLHEDVMRVLTIKVDAHQEGPSVQMQK 106


>gi|15839150|ref|NP_299838.1| 30S ribosomal protein S6 [Xylella fastidiosa 9a5c]
 gi|28199812|ref|NP_780126.1| 30S ribosomal protein S6 [Xylella fastidiosa Temecula1]
 gi|71899834|ref|ZP_00681984.1| Ribosomal protein S6 [Xylella fastidiosa Ann-1]
 gi|182682564|ref|YP_001830724.1| 30S ribosomal protein S6 [Xylella fastidiosa M23]
 gi|54039538|sp|P66605|RS6_XYLFT RecName: Full=30S ribosomal protein S6
 gi|54041980|sp|P66604|RS6_XYLFA RecName: Full=30S ribosomal protein S6
 gi|226705650|sp|B2I9S9|RS6_XYLF2 RecName: Full=30S ribosomal protein S6
 gi|9107773|gb|AAF85358.1|AE004063_7 30S ribosomal protein S6 [Xylella fastidiosa 9a5c]
 gi|28057933|gb|AAO29775.1| 30S ribosomal protein S6 [Xylella fastidiosa Temecula1]
 gi|71730425|gb|EAO32506.1| Ribosomal protein S6 [Xylella fastidiosa Ann-1]
 gi|182632674|gb|ACB93450.1| ribosomal protein S6 [Xylella fastidiosa M23]
 gi|307578844|gb|ADN62813.1| 30S ribosomal protein S6 [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 143

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 68/124 (54%), Gaps = 3/124 (2%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE V L+  D  S+Q++  + +Y++LI+   G++  + + G R +AY I+K  KA+Y+
Sbjct: 3   RHYEIVLLVHPD-QSEQVQAMLERYKALIENGHGKIHRLEDWGRRQLAYPIQKLVKAHYL 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            MNI    + ++E+    R ++ +LR L +     +   +  ++   +DD+ D+  R R 
Sbjct: 62  MMNIEVEQSVLNELVDLFRFNDAILRHLAIKRSGPDTEQSFIMK--SKDDKGDKPERRRR 119

Query: 122 VDRK 125
            D +
Sbjct: 120 DDDE 123


>gi|153875702|ref|ZP_02003385.1| Ribosomal protein S6 [Beggiatoa sp. PS]
 gi|152067834|gb|EDN66615.1| Ribosomal protein S6 [Beggiatoa sp. PS]
          Length = 125

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 63/124 (50%), Gaps = 1/124 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  + Q+   I +YQ++I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIIFLVHPD-QTDQVAAMIERYQAIIKEQDGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+     A+ E+    R ++ V+R L L+       P+   +  + +  +       
Sbjct: 60  VLMNVECNIKALDELVENFRFNDAVIRHLVLIQKRAITEPSPMSRPKEDNQASQEPSYYF 119

Query: 121 NVDR 124
           + D+
Sbjct: 120 DEDK 123


>gi|294084211|ref|YP_003550969.1| 30S ribosomal protein S6 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663784|gb|ADE38885.1| Ribosomal protein S6 [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 146

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 69/110 (62%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+LYE VF+ RQD+SS Q++    ++  +I   GG ++     G+RT+AYRI+KNRK +Y
Sbjct: 1   MRLYESVFIARQDVSSTQVEAMADEFAGIITSTGGSIKKREYWGLRTLAYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V  N+ +    + E +R M ++E+VLR + + ++  +++P++ +Q     
Sbjct: 61  VMFNMETDSDTLKEYERIMGLNEDVLRFMNIRIEEVDEAPSIMMQAKSER 110


>gi|165918507|ref|ZP_02218593.1| ribosomal protein S6 [Coxiella burnetii RSA 334]
 gi|165917753|gb|EDR36357.1| ribosomal protein S6 [Coxiella burnetii RSA 334]
          Length = 127

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/115 (34%), Positives = 64/115 (55%), Gaps = 1/115 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +YQS+I+E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVILVHPD-QSSQVPAMVERYQSMIKEKGGKVHRLEDWGRRQLAYSIDKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
           + MNI S    I E++   R ++ V+RSL L  D      +L +Q  ++   + +
Sbjct: 60  LLMNIESDQGVISELENAFRYNDAVIRSLILKRDHAITKSSLIMQGAEKGKSSRK 114


>gi|224510727|pdb|3FIH|F Chain F, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 30s Subunit, Trnas And The Ternary
           Complex.
 gi|251837144|pdb|3IY8|F Chain F, Leishmania Tarentolae Mitonchondrial Ribosome Small
           Subunit
 gi|294662222|pdb|2WWL|F Chain F, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 30s, The P-Site
           Trna And The Tnac Leader Peptide (Part 1 Of 2).
 gi|308387970|pdb|3OFO|F Chain F, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|308387991|pdb|3OFP|F Chain F, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 gi|309320028|pdb|3OFA|F Chain F, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The First 70s Ribosome.
 gi|309320049|pdb|3OFB|F Chain F, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The Second 70s Ribosome.
 gi|309320132|pdb|3OFX|F Chain F, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|309320153|pdb|3OFY|F Chain F, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
 gi|315113617|pdb|3OAQ|F Chain F, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 gi|315113638|pdb|3OAR|F Chain F, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
          Length = 100

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 1/101 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPT 101
           V MN+ +P   I E++   R ++ V+RS+ +         +
Sbjct: 60  VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEAS 100


>gi|292571635|gb|ADE29550.1| 30S ribosomal protein S6 [Rickettsia prowazekii Rp22]
          Length = 145

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 64/112 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 25  MSFYESVFIIRQDVSLNDIDKIVDDFTKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHY 84

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ I        E++RKM+++EN++R LT+  DS    P+  ++    ++ 
Sbjct: 85  YFLGIDITSNVKEELERKMKLNENIIRFLTIKADSISSEPSPILKNQSTENT 136


>gi|71065894|ref|YP_264621.1| 30S ribosomal protein S6 [Psychrobacter arcticus 273-4]
 gi|91207784|sp|Q4FS21|RS6_PSYA2 RecName: Full=30S ribosomal protein S6
 gi|71038879|gb|AAZ19187.1| SSU ribosomal protein S6P [Psychrobacter arcticus 273-4]
          Length = 132

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 55/114 (48%), Gaps = 1/114 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y  L+Q+N G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYELVLLVHPD-QSDQVVGMVERYIKLVQDNNGTIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
           V  NI +    + E++   R ++ ++RSL +  D      +   +  D      
Sbjct: 60  VLFNIETDGETLAELEELFRYNDAIIRSLVMRRDDAVTEESQLAKNADEKRARK 113


>gi|90419489|ref|ZP_01227399.1| ribosomal protein S6 [Aurantimonas manganoxydans SI85-9A1]
 gi|90336426|gb|EAS50167.1| ribosomal protein S6 [Aurantimonas manganoxydans SI85-9A1]
          Length = 146

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/106 (47%), Positives = 79/106 (74%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQDIS+QQ++  + Q + +++ NGG++  V   G++T+ +RI+KNRKAYY
Sbjct: 1   MALYEHVFLARQDISNQQVEQLVEQLRGILETNGGKIGKVENWGLKTLTFRIKKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             MNI +P AA+ EM+R+MR +E++LR +T+ V+ HE+  +  +Q+
Sbjct: 61  TLMNIDAPSAAVQEMERQMRFNEDILRYMTIRVEEHEEGQSAMMQK 106


>gi|153209207|ref|ZP_01947273.1| ribosomal protein S6 [Coxiella burnetii 'MSU Goat Q177']
 gi|212218344|ref|YP_002305131.1| 30S ribosomal protein S6 [Coxiella burnetii CbuK_Q154]
 gi|226703445|sp|B6J6T7|RS6_COXB1 RecName: Full=30S ribosomal protein S6
 gi|120575462|gb|EAX32086.1| ribosomal protein S6 [Coxiella burnetii 'MSU Goat Q177']
 gi|212012606|gb|ACJ19986.1| SSU ribosomal protein S6P [Coxiella burnetii CbuK_Q154]
          Length = 127

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 65/119 (54%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +YQS+I+E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVILVHPD-QSSQVPAMVERYQSMIKEKGGKVHRLEDWGRRQLAYSIDKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           + MNI S    I E++   R ++ V+RSL L  D      +L +Q  ++   + +   D
Sbjct: 60  LLMNIESDQGVISELENAFRYNDAVIRSLILKRDHAITQSSLIMQGAEKGKSSRKEKVD 118


>gi|254244174|ref|ZP_04937496.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa 2192]
 gi|126197552|gb|EAZ61615.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa 2192]
          Length = 139

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 63/125 (50%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y   I+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVGGMVERYTKAIEEDGGKIHRLKDWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+     A+ E++   R ++ V+R+L +  D      +  ++  +  +         
Sbjct: 60  VLMNVECSAKALAELEDNFRYNDAVIRNLVMRRDEAVTEQSEMLKAEESRNERRERRERP 119

Query: 121 NVDRK 125
           N + +
Sbjct: 120 NDNAE 124


>gi|254238350|ref|ZP_04931673.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa C3719]
 gi|126170281|gb|EAZ55792.1| 30S ribosomal protein S6 [Pseudomonas aeruginosa C3719]
          Length = 139

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 62/125 (49%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y   I+E+GG++  +   G R +AY I    KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVGGMVERYTKAIEEDGGKIHRLKNWGRRQLAYAINNVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+     A+ E++   R ++ V+R+L +  D      +  ++  +  +         
Sbjct: 60  VLMNVECSAKALAELEDNFRYNDAVIRNLVMRRDEAVTEQSEMLKAEESRNERRERRERP 119

Query: 121 NVDRK 125
           N + +
Sbjct: 120 NDNAE 124


>gi|114800162|ref|YP_760858.1| 30S ribosomal protein S6 [Hyphomonas neptunium ATCC 15444]
 gi|123323137|sp|Q0C085|RS6_HYPNA RecName: Full=30S ribosomal protein S6
 gi|114740336|gb|ABI78461.1| ribosomal protein S6 [Hyphomonas neptunium ATCC 15444]
          Length = 112

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 42/111 (37%), Positives = 67/111 (60%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + R DIS  Q++  I +  + ++E G  V      G+R++AY I+K RK +Y
Sbjct: 1   MALYEHVVITRPDISPAQVESFIEEMTTFLKEKGATVGKTEYWGLRSLAYPIKKQRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
             +NI  P  AIHE++R+ RI E+V+R +T+ V++    P+  + R +R  
Sbjct: 61  SLINIDGPADAIHELERRQRIAEDVMRYMTVRVETLSDEPSPVLSRKERRR 111


>gi|85716344|ref|ZP_01047317.1| 30S ribosomal protein S6 [Nitrobacter sp. Nb-311A]
 gi|85696860|gb|EAQ34745.1| 30S ribosomal protein S6 [Nitrobacter sp. Nb-311A]
          Length = 139

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD SSQQ+++   Q    I   GG+V      G+R++ YR++KNRKA++
Sbjct: 1   MPLYEHVFLARQDASSQQVEELTNQITGAITGLGGKVTKTENWGVRSLTYRMKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI  P   ++E++R+ RI E+V+R LT+ VD HE+ P+  +++
Sbjct: 61  VLLNIDGPATIVNEIERQERIHEDVIRYLTVRVDEHEEGPSAMMRK 106


>gi|71275196|ref|ZP_00651483.1| Ribosomal protein S6 [Xylella fastidiosa Dixon]
 gi|71898276|ref|ZP_00680450.1| Ribosomal protein S6 [Xylella fastidiosa Ann-1]
 gi|170731187|ref|YP_001776620.1| 30S ribosomal protein S6 [Xylella fastidiosa M12]
 gi|226705651|sp|B0U5H2|RS6_XYLFM RecName: Full=30S ribosomal protein S6
 gi|71164005|gb|EAO13720.1| Ribosomal protein S6 [Xylella fastidiosa Dixon]
 gi|71732015|gb|EAO34072.1| Ribosomal protein S6 [Xylella fastidiosa Ann-1]
 gi|167965980|gb|ACA12990.1| 30S ribosomal protein S6 [Xylella fastidiosa M12]
          Length = 143

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 67/125 (53%), Gaps = 3/125 (2%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE V L+  D  S+Q++  + +Y++LI+   G++  + + G R +AY I+K  KA+Y+
Sbjct: 3   RHYEIVLLVHPD-QSEQVQAMLERYKALIENGHGKIHRLEDWGRRQLAYPIQKLVKAHYL 61

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            MNI    + ++E+    R ++ +LR L +         +  ++   +DD+ D+  R R 
Sbjct: 62  MMNIEVEQSVLNELVDLFRFNDAILRHLAIKRSGPYTEQSFIMK--SKDDKGDKPERRRR 119

Query: 122 VDRKQ 126
            D + 
Sbjct: 120 DDDES 124


>gi|300115388|ref|YP_003761963.1| 30S ribosomal protein S6 [Nitrosococcus watsonii C-113]
 gi|299541325|gb|ADJ29642.1| ribosomal protein S6 [Nitrosococcus watsonii C-113]
          Length = 156

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 61/113 (53%), Gaps = 1/113 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y+ +I+ +GG +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFLVHPD-QSEQLSAMMDRYRQMIEVDGGRIHRLEDWGRRQLAYPIQKLYKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
           V MNI   P AI E+    R ++ VLR + +  +      +   +  +   R+
Sbjct: 60  VLMNIECTPRAIEELTSAFRFNDAVLRDMVIQREEAITETSPLAKGEESSGRS 112


>gi|254487872|ref|ZP_05101077.1| ribosomal protein S6 [Roseobacter sp. GAI101]
 gi|214044741|gb|EEB85379.1| ribosomal protein S6 [Roseobacter sp. GAI101]
          Length = 120

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 42/106 (39%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +N G++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNTQAEGLIEHFGTVLADNDGKLVDSEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  AI EM+R MR+ ++V+R LT+ VD H++ P++ +Q+
Sbjct: 61  AFLRSDAPATAIQEMERLMRLHDDVMRVLTIKVDEHKELPSVQMQK 106


>gi|83945281|ref|ZP_00957630.1| 30S ribosomal protein S6 [Oceanicaulis alexandrii HTCC2633]
 gi|83851451|gb|EAP89307.1| 30S ribosomal protein S6 [Oceanicaulis alexandrii HTCC2633]
          Length = 116

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 69/116 (59%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YEHVF+ R D+S  Q++  I + ++LI+E GG+V      G+RT+AYR+ KNRK +Y
Sbjct: 1   MNKYEHVFIARPDVSPAQVESAIEELKALIEEKGGKVHKTEYWGLRTLAYRMNKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
            ++++ +    +  +  + R  ++V+R +T  VD   + P+  +++ +   R +R 
Sbjct: 61  GYLDMEAGNEVLEALDYRQRFADDVMRYMTCRVDELNEEPSAVLRKGEDRKRRERR 116


>gi|90020704|ref|YP_526531.1| 30S ribosomal protein S6 [Saccharophagus degradans 2-40]
 gi|123277536|sp|Q21LW0|RS6_SACD2 RecName: Full=30S ribosomal protein S6
 gi|89950304|gb|ABD80319.1| SSU ribosomal protein S6P [Saccharophagus degradans 2-40]
          Length = 152

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/109 (27%), Positives = 58/109 (53%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   + +Y + ++++GG V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPGMVERYTAAVKDSGGAVHRLEDWGRRQMAYSINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           + MN+      + E+    R ++ VLR++ +  D      +  ++  + 
Sbjct: 60  ILMNVECGEEVLEELTTNFRYNDAVLRNMIIRCDEAVTEESPIMKAENE 108


>gi|254417739|ref|ZP_05031463.1| ribosomal protein S6, putative [Brevundimonas sp. BAL3]
 gi|196183916|gb|EDX78892.1| ribosomal protein S6, putative [Brevundimonas sp. BAL3]
          Length = 147

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 67/104 (64%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH  + RQDIS+QQ +      + LI + GG V  +   G+R + YR++KNRKA+Y
Sbjct: 20  MALYEHTVMTRQDISAQQAEALNDTIKDLIVQGGGSVAKIEYWGLRNLTYRVKKNRKAHY 79

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             + + +PPAA+ E++R++ I+E+VLR LT+ V+  +   +  +
Sbjct: 80  SLLAVDAPPAAMAEVERQLGINEDVLRWLTVRVEELDLELSPLL 123


>gi|91204937|ref|YP_537292.1| 30S ribosomal protein S6 [Rickettsia bellii RML369-C]
 gi|122426077|sp|Q1RKB1|RS6_RICBR RecName: Full=30S ribosomal protein S6
 gi|91068481|gb|ABE04203.1| 30S ribosomal protein S6 [Rickettsia bellii RML369-C]
          Length = 120

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 65/112 (58%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+R +AY+I  ++K +Y
Sbjct: 1   MSFYESVFIVRQDVSLNDIDKIVDDFSKIIKDNNGAIVKKEYWGLRALAYKIGNHKKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
             + + + PA   E++RKM+++EN++R LT  VDS    P+  ++    ++ 
Sbjct: 61  YLLGLDTTPAVKQELERKMKLNENIIRFLTQKVDSISNEPSPILKNQSTENT 112


>gi|157827735|ref|YP_001496799.1| 30S ribosomal protein S6 [Rickettsia bellii OSU 85-389]
 gi|166227375|sp|A8GY12|RS6_RICB8 RecName: Full=30S ribosomal protein S6
 gi|157803039|gb|ABV79762.1| 30S ribosomal protein S6 [Rickettsia bellii OSU 85-389]
          Length = 120

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 65/112 (58%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+R +AY+I  ++K +Y
Sbjct: 1   MSFYESVFIVRQDVSLNDIDKIVDDFTKIIKDNNGAIVKKEYWGLRALAYKIGNHKKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
             + + + PA   E++RKM+++EN++R LT  VDS    P+  ++    ++ 
Sbjct: 61  YLLGLDTTPAVKQELERKMKLNENIIRFLTQKVDSISNEPSPILKNQSTENT 112


>gi|257453410|ref|ZP_05618705.1| 30S ribosomal protein S6 [Enhydrobacter aerosaccus SK60]
 gi|257449162|gb|EEV24110.1| 30S ribosomal protein S6 [Enhydrobacter aerosaccus SK60]
          Length = 142

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/135 (26%), Positives = 65/135 (48%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y +L++E GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYELVLLVHPD-QSDQVVGMVERYINLVKEQGGAIHRLEDWGRRQLAYPINKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR-HDRDDRNDRFPRD 119
           V +NI +    + E++   R ++ ++RSL +  D      +   +   ++  R      D
Sbjct: 60  VLLNIEAGQQTLDELEELFRYNDAIIRSLVIRRDEAITEESPLAKSAEEKRARKASRRND 119

Query: 120 RNVDRKQHVSEEKPL 134
              D  Q   +E  +
Sbjct: 120 TAQDDYQSNDDESEV 134


>gi|160872394|ref|ZP_02062526.1| ribosomal protein S6 [Rickettsiella grylli]
 gi|159121193|gb|EDP46531.1| ribosomal protein S6 [Rickettsiella grylli]
          Length = 128

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 60/125 (48%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y ++++ +GG+V    + G R I + I K  KA+Y
Sbjct: 1   MRHYEIVLLIHPD-QSDQVSAMVQRYTTIVKNSGGKVHRFEDWGRRQICFPINKLPKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+     A+ E+    R ++ VLR L + VD      +   +  +     ++    R
Sbjct: 60  ILMNVECGKEAMAELTDNFRFNDAVLRQLIIKVDKAITGQSPLAKAKEVQAHENKREYSR 119

Query: 121 NVDRK 125
             + +
Sbjct: 120 ETEVE 124


>gi|157825189|ref|YP_001492909.1| 30S ribosomal protein S6 [Rickettsia akari str. Hartford]
 gi|157799147|gb|ABV74401.1| 30S ribosomal protein S6 [Rickettsia akari str. Hartford]
          Length = 142

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 64/112 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 22  MSFYESVFIIRQDVSLNDIDKIVDDFVKIIKDNNGTIIKKEYWGIRTLAYKIGNNKKGHY 81

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ I        E++RKM+++EN++R LT+  DS    P+  ++    ++ 
Sbjct: 82  YFLGIDVTCNVKEELERKMKLNENIIRFLTIKTDSISSEPSPILKNQSTENT 133


>gi|90416566|ref|ZP_01224497.1| 30S ribosomal protein S6 [marine gamma proteobacterium HTCC2207]
 gi|90331765|gb|EAS46993.1| 30S ribosomal protein S6 [marine gamma proteobacterium HTCC2207]
          Length = 153

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 61/121 (50%), Gaps = 1/121 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y + I+   G+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVSGMIERYTASIEAGEGKVHRMEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E+    R ++ VLRSL +  D    + +  ++  + D  +      R
Sbjct: 60  ILMNVECSQEVLDELSSTFRYNDAVLRSLVVRRDEAITAESPIMKIENADKADKEARERR 119

Query: 121 N 121
           N
Sbjct: 120 N 120


>gi|163746684|ref|ZP_02154041.1| 30S ribosomal protein S6 [Oceanibulbus indolifex HEL-45]
 gi|161379798|gb|EDQ04210.1| 30S ribosomal protein S6 [Oceanibulbus indolifex HEL-45]
          Length = 117

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +N G++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNTQAEGLIEHFGTVLADNDGKLVDSEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  A+ EM+R MR+ ++V+R LT+ VD H++ P++ +Q+
Sbjct: 61  AFLRSDAPATAVQEMERLMRLHDDVMRVLTIKVDEHKELPSVQMQK 106


>gi|83943161|ref|ZP_00955621.1| ribosomal protein S6 [Sulfitobacter sp. EE-36]
 gi|83954296|ref|ZP_00963016.1| ribosomal protein S6 [Sulfitobacter sp. NAS-14.1]
 gi|83841333|gb|EAP80503.1| ribosomal protein S6 [Sulfitobacter sp. NAS-14.1]
 gi|83846169|gb|EAP84046.1| ribosomal protein S6 [Sulfitobacter sp. EE-36]
          Length = 120

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 72/106 (67%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +N G++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNTQAEGLIEHFGTVLADNDGKLVDSEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +P  A+ EM+R MR+ ++V+R LT+ VD H++ P++ +Q+
Sbjct: 61  AFLRSDAPATAVQEMERLMRLHDDVMRVLTIKVDEHKELPSVQMQK 106


>gi|91977453|ref|YP_570112.1| 30S ribosomal protein S6 [Rhodopseudomonas palustris BisB5]
 gi|123721764|sp|Q135M8|RS6_RHOPS RecName: Full=30S ribosomal protein S6
 gi|91683909|gb|ABE40211.1| SSU ribosomal protein S6P [Rhodopseudomonas palustris BisB5]
          Length = 160

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD S+QQ+++   Q   +I+  GG+V      G+R++ YR+ KNRKA++
Sbjct: 1   MPLYEHVFLARQDASTQQVEELTTQITGVIEGLGGKVTKTEAWGLRSLTYRMNKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI  P A + E++R+ RI+E+++R LT+ V+ HE+ P+  +++
Sbjct: 61  VMLNIDGPSAVVAEVERQERINEDIIRYLTVRVEEHEEGPSAMMRK 106


>gi|114328878|ref|YP_746035.1| 30S ribosomal protein S6 [Granulibacter bethesdensis CGDNIH1]
 gi|122326173|sp|Q0BPZ0|RS6_GRABC RecName: Full=30S ribosomal protein S6
 gi|114317052|gb|ABI63112.1| SSU ribosomal protein S6P [Granulibacter bethesdensis CGDNIH1]
          Length = 154

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 71/113 (62%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE V + R D++ QQ++       SLI+  GG ++     G+RT+AYRI+KNRK +Y
Sbjct: 1   MPLYESVLIARNDVTQQQVESVADHVASLIEAEGGAIKKREYWGLRTLAYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
           + + + + PA I E++R++R++E+VLR +T+ V+  +  P++ + R   D   
Sbjct: 61  MLLGLDAKPATITEVERQLRLNEDVLRFMTIRVEEIDDVPSVILSRKSDDRER 113


>gi|126739373|ref|ZP_01755066.1| ribosomal protein S6 [Roseobacter sp. SK209-2-6]
 gi|126719473|gb|EBA16182.1| ribosomal protein S6 [Roseobacter sp. SK209-2-6]
          Length = 117

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 41/106 (38%), Positives = 71/106 (66%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHV + RQD+S+ Q +  I  + +++ +N G++      G++T+AY+I KNRK +Y
Sbjct: 1   MPLYEHVMIARQDLSNSQAEGLIEHFGAVLADNEGKLVDSEYWGVKTMAYKINKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
            F+   +  AA+ EM+R MR+ ++V+R LT+ VD H + P++ +Q+
Sbjct: 61  SFLRTDASAAAVQEMERLMRLHDDVMRVLTIKVDEHAEGPSVQMQK 106


>gi|165932623|ref|YP_001649412.1| 30S ribosomal protein S6 [Rickettsia rickettsii str. Iowa]
 gi|165907710|gb|ABY72006.1| SSU ribosomal protein S6P [Rickettsia rickettsii str. Iowa]
          Length = 133

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 64/111 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 13  MSFYESVFIIRQDVSLNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHY 72

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
            F+ +        E++RKM+++EN++R LT+  DS    P+  ++    ++
Sbjct: 73  YFLGLDITGNVKEELERKMKLNENIIRFLTIQADSISSEPSPILKNQSTEN 123


>gi|157964104|ref|YP_001498928.1| 30S ribosomal protein S6 [Rickettsia massiliae MTU5]
 gi|157843880|gb|ABV84381.1| 30S ribosomal protein S6 [Rickettsia massiliae MTU5]
          Length = 145

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 64/112 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 25  MSFYESVFIIRQDVSLNDIDKIVNDFAKIIKDNNGTIIKKEYWGVRTLAYKIGNNKKGHY 84

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ +        E++RKM+++EN++R LT+  DS    P+  ++    ++ 
Sbjct: 85  YFLGLDITGNVKEELERKMKLNENIIRFLTIQADSISSEPSPILKNQSTENT 136


>gi|33152177|ref|NP_873530.1| 30S ribosomal protein S6 [Haemophilus ducreyi 35000HP]
 gi|61215717|sp|Q7VMD7|RS6_HAEDU RecName: Full=30S ribosomal protein S6
 gi|33148399|gb|AAP95919.1| 30S ribosomal protein S6 [Haemophilus ducreyi 35000HP]
          Length = 124

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y + + E GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMIERYTASVTEAGGQVHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MN+ +P + I E++   R ++ VLR+L +   +  +  +L  +  +          + 
Sbjct: 60  VLMNVEAPKSVIDELETNFRYNDAVLRNLIVHTKAAVKEASLMAKAKESKTTEVVAEVES 119

Query: 121 NVDRK 125
               +
Sbjct: 120 KEASE 124


>gi|292493501|ref|YP_003528940.1| ribosomal protein S6 [Nitrosococcus halophilus Nc4]
 gi|291582096|gb|ADE16553.1| ribosomal protein S6 [Nitrosococcus halophilus Nc4]
          Length = 148

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 41/147 (27%), Positives = 72/147 (48%), Gaps = 15/147 (10%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y+ LI+ +GG +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQLPAMIERYRQLIETDGGRIHRLEDWGRRQLAYPIQKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ--------------R 106
           V MN+   P AI E+    R ++ VLR + +  +     P+   +               
Sbjct: 60  VLMNVECTPQAIEELTSAFRFNDAVLRDVVMRREEAVTEPSPLAKGEESGSRSYDSSRPS 119

Query: 107 HDRDDRNDRFPRDRNVDRKQHVSEEKP 133
            DR++R++   +    + +    +EK 
Sbjct: 120 RDREERDESENKSSESESEDKGEQEKE 146


>gi|291515312|emb|CBK64522.1| SSU ribosomal protein S6P [Alistipes shahii WAL 8301]
          Length = 114

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 57/114 (50%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++   +S  Q+++   ++Q +I ENGG++      G+R +AY I+K    +Y
Sbjct: 1   MNNYETVFIVTPVLSDAQVQEVADKFQGVITENGGQIVNKESWGLRKLAYPIQKKTTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +      + ++ ++ + R DE V+R LT   D +    +   +    + + +
Sbjct: 61  FLVEFTGEGSLVNTLETQYRRDERVIRFLTFKQDKYAVEYSEKRRAKLSNKQEE 114


>gi|118602662|ref|YP_903877.1| 30S ribosomal protein S6 [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|166227378|sp|A1AWU9|RS6_RUTMC RecName: Full=30S ribosomal protein S6
 gi|118567601|gb|ABL02406.1| SSU ribosomal protein S6P [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 113

 Score =  118 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE   ++  D  S Q+   + +Y+ +I   GG++    + G + +AY I+K  KA+Y
Sbjct: 1   MRHYEITLIVHPD-QSAQVGTMMEKYKEIITTGGGKIHRKEDWGRKHLAYPIKKIYKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           + MNI      + ++    R ++ +LR+L +  D    +P++ +   D++ 
Sbjct: 60  LMMNIECDQEVLDKLNYNFRFNDAILRNLIISEDGVITTPSIMMANKDKEK 110


>gi|299133698|ref|ZP_07026892.1| ribosomal protein S6 [Afipia sp. 1NLS2]
 gi|298591534|gb|EFI51735.1| ribosomal protein S6 [Afipia sp. 1NLS2]
          Length = 150

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 73/106 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD S+QQ+++   Q   +I+  GG+V      G+R++ YR+ KNRKA++
Sbjct: 1   MPLYEHVFLARQDASAQQVEEFTTQITGVIEGLGGKVAKTENWGVRSLTYRMNKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI  P A + E++R+ RI+E+++R LT+ VD  E+ P+  +++
Sbjct: 61  VLLNIDGPAAIVSEIERQERINEDIIRYLTVRVDELEEGPSAMMRK 106


>gi|296113492|ref|YP_003627430.1| 30S ribosomal protein S6 [Moraxella catarrhalis RH4]
 gi|295921186|gb|ADG61537.1| 30S ribosomal protein S6 [Moraxella catarrhalis RH4]
 gi|326559387|gb|EGE09812.1| 30S ribosomal protein S6 [Moraxella catarrhalis 46P47B1]
 gi|326559760|gb|EGE10170.1| 30S ribosomal protein S6 [Moraxella catarrhalis 7169]
 gi|326565024|gb|EGE15224.1| 30S ribosomal protein S6 [Moraxella catarrhalis 103P14B1]
 gi|326568101|gb|EGE18185.1| 30S ribosomal protein S6 [Moraxella catarrhalis BC7]
 gi|326568518|gb|EGE18590.1| 30S ribosomal protein S6 [Moraxella catarrhalis BC1]
 gi|326572421|gb|EGE22413.1| 30S ribosomal protein S6 [Moraxella catarrhalis BC8]
 gi|326572533|gb|EGE22522.1| 30S ribosomal protein S6 [Moraxella catarrhalis CO72]
 gi|326574130|gb|EGE24078.1| 30S ribosomal protein S6 [Moraxella catarrhalis 101P30B1]
 gi|326575566|gb|EGE25490.1| 30S ribosomal protein S6 [Moraxella catarrhalis O35E]
          Length = 133

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 35/130 (26%), Positives = 68/130 (52%), Gaps = 2/130 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+ D + +Y+S++++NGG    + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEVVLLVHPD-QSNQVADMVTKYRSIVEDNGGNNHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI      + +++   + ++ ++RSL +  D      +   +  + D R  +  R  
Sbjct: 60  VLLNIECNDETLAQLEELFKYNDAIIRSLIIRRDEAITEQSPLAKEAE-DKRTRKANRRN 118

Query: 121 NVDRKQHVSE 130
           +V  ++  S+
Sbjct: 119 DVRTQEAESD 128


>gi|254516843|ref|ZP_05128901.1| Na+/solute symporter [gamma proteobacterium NOR5-3]
 gi|219674348|gb|EED30716.1| Na+/solute symporter [gamma proteobacterium NOR5-3]
          Length = 149

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 64/125 (51%), Gaps = 1/125 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y ++I ++GG V  + + G R +A+ I K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPGMIERYSNIITKDGGSVHRMEDWGRRQLAFPISKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+ +   A+ E+    R ++ V+R+L +  D+ +   +  ++             DR
Sbjct: 60  ILMNVEASNEAMDELTTTFRYNDAVIRNLVIRRDAPDLEESPIMKAEKESRERKSRYEDR 119

Query: 121 NVDRK 125
               K
Sbjct: 120 QGSEK 124


>gi|326566024|gb|EGE16184.1| 30S ribosomal protein S6 [Moraxella catarrhalis 12P80B1]
          Length = 133

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 35/130 (26%), Positives = 68/130 (52%), Gaps = 2/130 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+ D + +Y+S++++NGG    + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEVVLLVHPD-QSNQVADMVTKYRSIVEDNGGNNHRLEDWGRRQLAYPISKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +NI      + +++   + ++ ++RSL +  D      +   +  + D R  +  R  
Sbjct: 60  VLLNIECNDETLAQLEELFKYNDAIIRSLIIRRDEAITEQSPLAKEAE-DKRTRKANRRN 118

Query: 121 NVDRKQHVSE 130
           +V  ++  S+
Sbjct: 119 DVRTQEAESD 128


>gi|238757531|ref|ZP_04618716.1| 30S ribosomal protein S6 [Yersinia aldovae ATCC 35236]
 gi|238764706|ref|ZP_04625650.1| 30S ribosomal protein S6 [Yersinia kristensenii ATCC 33638]
 gi|238783559|ref|ZP_04627581.1| 30S ribosomal protein S6 [Yersinia bercovieri ATCC 43970]
 gi|238787553|ref|ZP_04631351.1| 30S ribosomal protein S6 [Yersinia frederiksenii ATCC 33641]
 gi|238792977|ref|ZP_04636606.1| 30S ribosomal protein S6 [Yersinia intermedia ATCC 29909]
 gi|238797594|ref|ZP_04641091.1| 30S ribosomal protein S6 [Yersinia mollaretii ATCC 43969]
 gi|238697102|gb|EEP89875.1| 30S ribosomal protein S6 [Yersinia kristensenii ATCC 33638]
 gi|238704293|gb|EEP96825.1| 30S ribosomal protein S6 [Yersinia aldovae ATCC 35236]
 gi|238715614|gb|EEQ07604.1| 30S ribosomal protein S6 [Yersinia bercovieri ATCC 43970]
 gi|238718591|gb|EEQ10410.1| 30S ribosomal protein S6 [Yersinia mollaretii ATCC 43969]
 gi|238724340|gb|EEQ15982.1| 30S ribosomal protein S6 [Yersinia frederiksenii ATCC 33641]
 gi|238727577|gb|EEQ19102.1| 30S ribosomal protein S6 [Yersinia intermedia ATCC 29909]
          Length = 122

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 60/123 (48%), Gaps = 1/123 (0%)

Query: 9   LLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP 68
           ++  D  S+Q+   I +Y + I    G +  + + G R +AY I K  KA+YV +N+ +P
Sbjct: 1   MVHPD-QSEQVPGMIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAP 59

Query: 69  PAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNVDRKQHV 128
             AI E++   R ++ V+RS+ + V       +  ++  D       F  + N D +   
Sbjct: 60  QEAIDELETNFRFNDAVIRSMVMRVKHAVTEASPMVKAKDERRERHDFASEANDDSEAGD 119

Query: 129 SEE 131
           SEE
Sbjct: 120 SEE 122


>gi|167754092|ref|ZP_02426219.1| hypothetical protein ALIPUT_02380 [Alistipes putredinis DSM 17216]
 gi|167658717|gb|EDS02847.1| hypothetical protein ALIPUT_02380 [Alistipes putredinis DSM 17216]
          Length = 114

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 56/114 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++   +S  Q+K+   ++Q +I ENGG++      G++ +AY I+K    +Y
Sbjct: 1   MNNYETVFIVTPVLSDAQVKEVADKFQGVITENGGQIVNSEAWGLKKLAYPIQKKTTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +      + ++ ++ + R DE ++R LT   D      +   +    + + +
Sbjct: 61  FLIEFTGEGSIVNTLETQYRRDERIIRFLTFKQDKFAVEYSEKRRAKLSNKQEE 114


>gi|157803226|ref|YP_001491775.1| 30S ribosomal protein S6 [Rickettsia canadensis str. McKiel]
 gi|166227376|sp|A8EXA7|RS6_RICCK RecName: Full=30S ribosomal protein S6
 gi|157784489|gb|ABV72990.1| 30S ribosomal protein S6 [Rickettsia canadensis str. McKiel]
          Length = 121

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 65/112 (58%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQDIS   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 1   MSFYESVFIIRQDISLNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGSNKKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ +   P    E++RKM+++EN++R LT+  D+    P+  ++    ++ 
Sbjct: 61  YFLGLDITPNVKEEIERKMKLNENIIRFLTIKADAISSEPSPMLKNQSTENN 112


>gi|154706381|ref|YP_001424309.1| 30S ribosomal protein S6 [Coxiella burnetii Dugway 5J108-111]
 gi|189045462|sp|A9KFL5|RS6_COXBN RecName: Full=30S ribosomal protein S6
 gi|154355667|gb|ABS77129.1| SSU ribosomal protein S6P [Coxiella burnetii Dugway 5J108-111]
          Length = 126

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 39/116 (33%), Positives = 63/116 (54%), Gaps = 1/116 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +YQS+I+E  G+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVILVHPD-QSSQVPAMVERYQSMIKEKDGKVHRLEDWGRRQLAYSIDKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
           + MNI S    I E++   R ++ V+RSL L  D      +L +Q  ++   + + 
Sbjct: 60  LLMNIESDQGVISELENAFRYNDAVIRSLILKRDHAITKSSLIMQGAEKGKSSSKK 115


>gi|329896990|ref|ZP_08271783.1| SSU ribosomal protein S6p [gamma proteobacterium IMCC3088]
 gi|328921498|gb|EGG28883.1| SSU ribosomal protein S6p [gamma proteobacterium IMCC3088]
          Length = 147

 Score =  116 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 64/116 (55%), Gaps = 1/116 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  +I+++GG+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTQIIEKDGGKVHRLEDWGRRQLAYTINKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
           V MN+ +   A+ E+    R ++ V+R+L + +D  + S +L ++           
Sbjct: 60  VLMNVEASLEAMDELTTIFRYNDAVIRNLVIKMDEADTSESLIMKAEKESRERKNR 115


>gi|238897796|ref|YP_002923475.1| 30S ribosomal subunit protein S6 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
 gi|259495337|sp|C4K434|RS6_HAMD5 RecName: Full=30S ribosomal protein S6
 gi|229465553|gb|ACQ67327.1| 30S ribosomal subunit protein S6 [Candidatus Hamiltonella defensa
           5AT (Acyrthosiphon pisum)]
          Length = 143

 Score =  116 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 73/132 (55%), Gaps = 2/132 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S Q+   I +Y ++I ++GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSDQVPGMIQRYSTVITQSGGQIHRIEDWGRRQLAYAINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119
           V +N+ +P  AI+E++   R ++ V+R+L   ++      +  I+ + +R +  +     
Sbjct: 60  VLLNVEAPQNAINELETNFRFNDAVMRNLIKRMNHAVTEESPIIKMKDERREVVELTTSG 119

Query: 120 RNVDRKQHVSEE 131
              ++K H  E+
Sbjct: 120 SEDNQKDHHKED 131


>gi|238755920|ref|ZP_04617248.1| 30S ribosomal protein S6 [Yersinia ruckeri ATCC 29473]
 gi|238705879|gb|EEP98268.1| 30S ribosomal protein S6 [Yersinia ruckeri ATCC 29473]
          Length = 122

 Score =  116 bits (292), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 62/123 (50%), Gaps = 1/123 (0%)

Query: 9   LLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP 68
           ++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+YV +N+ +P
Sbjct: 1   MVHPD-QSEQVPGMIERYSATITNAAGQIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAP 59

Query: 69  PAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNVDRKQHV 128
             AI E++   R ++ V+RS+ + V +     +  ++  D       F  + N D +   
Sbjct: 60  QEAIDELETNFRFNDAVIRSMVMRVKNAVTEASPMVKAKDERRERHDFASETNDDSEAGD 119

Query: 129 SEE 131
           SEE
Sbjct: 120 SEE 122


>gi|29654191|ref|NP_819883.1| 30S ribosomal protein S6 [Coxiella burnetii RSA 493]
 gi|161830223|ref|YP_001596843.1| 30S ribosomal protein S6 [Coxiella burnetii RSA 331]
 gi|212212683|ref|YP_002303619.1| 30S ribosomal protein S6 [Coxiella burnetii CbuG_Q212]
 gi|61215752|sp|Q83D76|RS6_COXBU RecName: Full=30S ribosomal protein S6
 gi|189045463|sp|A9ND53|RS6_COXBR RecName: Full=30S ribosomal protein S6
 gi|226703446|sp|B6J0J6|RS6_COXB2 RecName: Full=30S ribosomal protein S6
 gi|29541457|gb|AAO90397.1| SSU ribosomal protein S6P [Coxiella burnetii RSA 493]
 gi|161762090|gb|ABX77732.1| ribosomal protein S6 [Coxiella burnetii RSA 331]
 gi|212011093|gb|ACJ18474.1| SSU ribosomal protein S6P [Coxiella burnetii CbuG_Q212]
          Length = 127

 Score =  116 bits (291), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 39/115 (33%), Positives = 63/115 (54%), Gaps = 1/115 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +YQS+I+E  G+V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVILVHPD-QSSQVPAMVERYQSMIKEKDGKVHRLEDWGRRQLAYSIDKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
           + MNI S    I E++   R ++ V+RSL L  D      +L +Q  ++   + +
Sbjct: 60  LLMNIESDQGVISELENAFRYNDAVIRSLILKRDHAITKSSLIMQGAEKGKSSRK 114


>gi|67004068|gb|AAY60994.1| 30S ribosomal protein S6 [Rickettsia felis URRWXCal2]
          Length = 129

 Score =  116 bits (291), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 64/112 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 9   MSFYESVFIIRQDVSLNDIDKIVDDFAKIIKDNNGTIVKKEYWGLRTLAYKIGNNKKGHY 68

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ +        E++RKM+++EN++R LT+  DS    P+  ++    ++ 
Sbjct: 69  YFLGLDITGNVKEELERKMKLNENIIRFLTIKADSISSEPSQILKNQSTENT 120


>gi|123969448|ref|YP_001010306.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. AS9601]
 gi|123199558|gb|ABM71199.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. AS9601]
          Length = 174

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 72/133 (54%), Gaps = 6/133 (4%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
            YE +++LR DI+  ++ + I +Y  L++E GG +      G R +AY+I K+R+  YV 
Sbjct: 28  YYETMYILRPDIAEDEVTNHIDKYNKLLEEFGGTILDSQMRGKRRLAYQIAKHREGIYVQ 87

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNV 122
           ++       I ++++ MR+ E+V+R +T+  +    +P  + +   + + ND      N 
Sbjct: 88  LSHQGDGQHIFKIEKAMRLSEDVIRYMTVKQEGPLPTPRPSNKSTSQSENND------NP 141

Query: 123 DRKQHVSEEKPLS 135
           D K    E++P++
Sbjct: 142 DAKVESKEKQPVA 154


>gi|162149103|ref|YP_001603564.1| 30S ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545154|ref|YP_002277383.1| 30S ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5]
 gi|189045471|sp|A9H1N0|RS6_GLUDA RecName: Full=30S ribosomal protein S6
 gi|161787680|emb|CAP57276.1| 30S ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532831|gb|ACI52768.1| ribosomal protein S6 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 161

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 78/119 (65%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE VF+ R D+S QQ++       +L++ +GG V+     G+R++AYRI+KNRK +Y
Sbjct: 1   MPLYETVFIARNDVSQQQVEAVADGIAALLETDGGAVKKREYWGLRSLAYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH-DRDDRNDRFPR 118
           + + + + P  I E++R++ ++E+V+R LTL VD  +++P++ + R  D  +R  R P+
Sbjct: 61  MLLGLDAKPETIKEIERQLGLNEDVMRVLTLRVDEIDEAPSVILSRKGDERERGFRGPK 119


>gi|332529063|ref|ZP_08405028.1| 30S ribosomal protein S6 [Hylemonella gracilis ATCC 19624]
 gi|332041507|gb|EGI77868.1| 30S ribosomal protein S6 [Hylemonella gracilis ATCC 19624]
          Length = 122

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 62/121 (51%), Gaps = 1/121 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + ++  D  S+Q+   + +Y+ ++   GG+V  V + G R + Y I K  KA+Y
Sbjct: 1   MRHYEIILMIHPD-QSEQVPAMLERYKGMVTTGGGKVHRVEDWGRRQMTYLINKLAKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + +NI +  A + E++   +  + VLR LT++    E  P+  ++  +R++         
Sbjct: 60  LCLNIEADRAVMEELEHAFKFSDAVLRHLTVVKKKAETGPSAMMKAVEREEARKVQQTAE 119

Query: 121 N 121
            
Sbjct: 120 A 120


>gi|313159261|gb|EFR58630.1| ribosomal protein S6 [Alistipes sp. HGB5]
          Length = 114

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 54/114 (47%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++   +S  Q+++   ++Q +I ENGG++      G+R +AY I+K    +Y
Sbjct: 1   MNNYETVFIVTPVLSDAQVQEVADKFQGVITENGGQIVNKESWGLRKLAYPIQKKTTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +        I+ ++ + R DE ++R LT   D      +   +    +   +
Sbjct: 61  FLVEFTGEGMLINTLETQYRRDERIIRFLTFKQDKFAVEYSEKRRAKLSNKSEE 114


>gi|153845041|ref|ZP_01993725.1| 30S ribosomal protein S6 [Vibrio parahaemolyticus AQ3810]
 gi|149745158|gb|EDM56409.1| 30S ribosomal protein S6 [Vibrio parahaemolyticus AQ3810]
          Length = 128

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 62/125 (49%), Gaps = 1/125 (0%)

Query: 6   HVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNI 65
            VF++  D  S+Q+   I +Y   I E GG++  + + G R +AY I K  KA+YV MN+
Sbjct: 5   IVFMVHPD-QSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNV 63

Query: 66  ASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNVDRK 125
            +  A I E++   R ++ VLR++ +   +     ++ +++ +          +   + K
Sbjct: 64  EADQAVIDELETAFRFNDAVLRNMIMRTKAAITEQSIMLKQKEERAPRREERSEAKPEAK 123

Query: 126 QHVSE 130
              +E
Sbjct: 124 SEAAE 128


>gi|254784759|ref|YP_003072187.1| 30S ribosomal protein S6 [Teredinibacter turnerae T7901]
 gi|259495345|sp|C5BN45|RS6_TERTT RecName: Full=30S ribosomal protein S6
 gi|237684065|gb|ACR11329.1| ribosomal protein S6 [Teredinibacter turnerae T7901]
          Length = 151

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/115 (29%), Positives = 58/115 (50%), Gaps = 1/115 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y S ++++GG V  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSEQVPGMIERYTSAVKDSGGSVHRLEDWGRRQMAYSINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
           V MNI     A+ E+    R ++ +LR++ +  D      +   +    +     
Sbjct: 60  VLMNIECGDQALEELTTNFRYNDAILRNMVIRCDEAVTEESPIQKAEKENRERKN 114


>gi|302383704|ref|YP_003819527.1| ribosomal protein S6 [Brevundimonas subvibrioides ATCC 15264]
 gi|302194332|gb|ADL01904.1| ribosomal protein S6 [Brevundimonas subvibrioides ATCC 15264]
          Length = 127

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 41/104 (39%), Positives = 64/104 (61%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH  + RQDIS+QQ +      + LI   GG V  +   G+R + YR++KNRKA+Y
Sbjct: 1   MALYEHTVMSRQDISAQQAEALNDTIKDLIVAGGGSVAKIEYWGLRNLTYRVKKNRKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             + I  PP A+ E++R++ I+E+VLR LT+ V+  +   +  +
Sbjct: 61  SLLAIDCPPPAMAEVERQLGINEDVLRWLTVRVEELDLELSPLL 104


>gi|289209096|ref|YP_003461162.1| ribosomal protein S6 [Thioalkalivibrio sp. K90mix]
 gi|288944727|gb|ADC72426.1| ribosomal protein S6 [Thioalkalivibrio sp. K90mix]
          Length = 134

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 38/131 (29%), Positives = 71/131 (54%), Gaps = 2/131 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+Q+   I +Y+ L++ + G++  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEVVFLVHPD-QSEQVPAMIERYKGLVEGHEGKIHRLEDWGRRQLAYPIQKLVKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V MNI +   A+ E+    R ++ VLR L + ++      +   +  + +    R  R+R
Sbjct: 60  VLMNIEASEEALEELVSAFRFNDAVLRHLAMRMEEAVTETSPLAKGQEEEGAKGRR-RER 118

Query: 121 NVDRKQHVSEE 131
           + +  Q  S++
Sbjct: 119 DDEGGQAASDD 129


>gi|217977083|ref|YP_002361230.1| 30S ribosomal protein S6 [Methylocella silvestris BL2]
 gi|254765445|sp|B8ESH8|RS6_METSB RecName: Full=30S ribosomal protein S6
 gi|217502459|gb|ACK49868.1| ribosomal protein S6 [Methylocella silvestris BL2]
          Length = 146

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 77/106 (72%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH++L RQD+S+QQ++    Q++ +I+  GG++  V   G++T+AYRI+KNRKA++
Sbjct: 1   MALYEHIYLARQDVSAQQVETLTEQFRGIIESLGGKIEKVEYWGVKTLAYRIKKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
             +NI +P AAI EM+R+  ++E+VLR LT+ V++ E   +  +++
Sbjct: 61  TLLNIDAPAAAITEMERQSSLNEDVLRLLTIRVEALEAGQSAMMRK 106


>gi|109900047|ref|YP_663302.1| ribosomal protein S6 [Pseudoalteromonas atlantica T6c]
 gi|109702328|gb|ABG42248.1| SSU ribosomal protein S6P [Pseudoalteromonas atlantica T6c]
          Length = 135

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 35/129 (27%), Positives = 66/129 (51%), Gaps = 1/129 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  ++ +NGG +  + + G R +AY I K  KA+Y
Sbjct: 2   MRHYEIVFMVHPD-QSEQVPGMIERYTGILTQNGGTIHRMEDWGRRQLAYPIDKLHKAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N  +   A+ E++   R ++ VLR+L +     E   +   +   R+ R++R   + 
Sbjct: 61  VLINAEASAEAVEELETAFRFNDVVLRNLVMRTKDAETEQSPMAKEERREKRDERPSSED 120

Query: 121 NVDRKQHVS 129
                +  +
Sbjct: 121 KSAEPEAAT 129


>gi|116667415|pdb|2GY9|F Chain F, Structure Of The 30s Subunit Of A Pre-Translocational E.
          Coli Ribosome Obtained By Fitting Atomic Models For Rna
          And Protein Components Into Cryo-Em Map Emd-1056
 gi|116667467|pdb|2GYB|F Chain F, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli
          Ribosome Complex Obtained By Fitting Atomic Models For
          Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 95

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 53/96 (55%), Gaps = 1/96 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE VF++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+Y
Sbjct: 1  MRHYEIVFMVHPD-QSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
          V MN+ +P   I E++   R ++ V+RS+ +     
Sbjct: 60 VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHA 95


>gi|169633238|ref|YP_001706974.1| 30S ribosomal protein S6 [Acinetobacter baumannii SDF]
 gi|169795504|ref|YP_001713297.1| 30S ribosomal protein S6 [Acinetobacter baumannii AYE]
 gi|213158556|ref|YP_002319854.1| ribosomal protein S6 [Acinetobacter baumannii AB0057]
 gi|215482991|ref|YP_002325196.1| ribosomal protein S6 [Acinetobacter baumannii AB307-0294]
 gi|229577093|ref|YP_001085200.2| 30S ribosomal protein S6 [Acinetobacter baumannii ATCC 17978]
 gi|239501438|ref|ZP_04660748.1| 30S ribosomal protein S6 [Acinetobacter baumannii AB900]
 gi|260554566|ref|ZP_05826787.1| ribosomal protein S6 [Acinetobacter baumannii ATCC 19606]
 gi|301345098|ref|ZP_07225839.1| 30S ribosomal protein S6 [Acinetobacter baumannii AB056]
 gi|301510830|ref|ZP_07236067.1| 30S ribosomal protein S6 [Acinetobacter baumannii AB058]
 gi|301595325|ref|ZP_07240333.1| 30S ribosomal protein S6 [Acinetobacter baumannii AB059]
 gi|332850733|ref|ZP_08432980.1| ribosomal protein S6 [Acinetobacter baumannii 6013150]
 gi|332866956|ref|ZP_08437282.1| ribosomal protein S6 [Acinetobacter baumannii 6013113]
 gi|332873686|ref|ZP_08441629.1| ribosomal protein S6 [Acinetobacter baumannii 6014059]
 gi|226703405|sp|B7H0K0|RS6_ACIB3 RecName: Full=30S ribosomal protein S6
 gi|226703406|sp|B7IBC1|RS6_ACIB5 RecName: Full=30S ribosomal protein S6
 gi|226703407|sp|B0VM10|RS6_ACIBS RecName: Full=30S ribosomal protein S6
 gi|226703408|sp|B0V7G7|RS6_ACIBY RecName: Full=30S ribosomal protein S6
 gi|226703588|sp|A3M6Q4|RS6_ACIBT RecName: Full=30S ribosomal protein S6
 gi|169148431|emb|CAM86297.1| 30S ribosomal protein S6 [Acinetobacter baumannii AYE]
 gi|169152030|emb|CAP00910.1| 30S ribosomal protein S6 [Acinetobacter baumannii]
 gi|193077740|gb|ABO12598.2| 30S ribosomal protein S6 [Acinetobacter baumannii ATCC 17978]
 gi|213057716|gb|ACJ42618.1| ribosomal protein S6 [Acinetobacter baumannii AB0057]
 gi|213987725|gb|ACJ58024.1| ribosomal protein S6 [Acinetobacter baumannii AB307-0294]
 gi|260411108|gb|EEX04405.1| ribosomal protein S6 [Acinetobacter baumannii ATCC 19606]
 gi|322507496|gb|ADX02950.1| rpsF [Acinetobacter baumannii 1656-2]
 gi|323518608|gb|ADX92989.1| 30S ribosomal protein S6 [Acinetobacter baumannii TCDC-AB0715]
 gi|332730570|gb|EGJ61886.1| ribosomal protein S6 [Acinetobacter baumannii 6013150]
 gi|332734337|gb|EGJ65464.1| ribosomal protein S6 [Acinetobacter baumannii 6013113]
 gi|332738074|gb|EGJ68958.1| ribosomal protein S6 [Acinetobacter baumannii 6014059]
          Length = 127

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 63/129 (48%), Gaps = 2/129 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y S I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+    + + E++   R ++ ++R+L +  +      +L  +  + + R  +  R+ 
Sbjct: 60  ILMNVECGQSTLDELEELFRYNDAIIRNLIIRREHAITEESLLAKSAE-EKRARKAQREE 118

Query: 121 NVDRKQHVS 129
                Q   
Sbjct: 119 AQQVAQEAE 127


>gi|71891874|ref|YP_277603.1| 30S ribosomal subunit protein S6 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|91207902|sp|Q493V5|RS6_BLOPB RecName: Full=30S ribosomal protein S6
 gi|71795980|gb|AAZ40731.1| 30S ribosomal subunit protein S6 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 117

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 58/112 (51%), Gaps = 1/112 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D+S +QI   I +Y +++    G+V  +   G R +AY + K  KAYY
Sbjct: 1   MRYYEIVFMVHPDLS-EQISSIINRYTTIVTNAQGKVHRIENWGRRQLAYPVNKLCKAYY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
           V +NI      + E+      ++N++RS+ +        P+  +++ + +  
Sbjct: 60  VLLNIEVSQDTVKELNDDFHFNKNIIRSMIVRTKYAIVEPSPMMKKIEENQE 111


>gi|262369756|ref|ZP_06063084.1| 30S ribosomal protein S6 [Acinetobacter johnsonii SH046]
 gi|262315824|gb|EEY96863.1| 30S ribosomal protein S6 [Acinetobacter johnsonii SH046]
          Length = 128

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 32/130 (24%), Positives = 65/130 (50%), Gaps = 3/130 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y + I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSDQVVGMVERYLTHIKEAEGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E++   R ++ ++RSL +  ++     +L  +  +  ++  R  +  
Sbjct: 60  ILMNVECGQTTLDELEELFRYNDAIIRSLIIRRENAITEESLLAKSAE--EKRARKAQRE 117

Query: 121 NVDRKQHVSE 130
              + Q  +E
Sbjct: 118 EAQQAQDSAE 127


>gi|260549408|ref|ZP_05823627.1| ribosomal protein S6 [Acinetobacter sp. RUH2624]
 gi|260407517|gb|EEX00991.1| ribosomal protein S6 [Acinetobacter sp. RUH2624]
          Length = 127

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 62/129 (48%), Gaps = 2/129 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y S I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E++   R ++ ++R+L +  +      +L  +  + + R  +  R+ 
Sbjct: 60  ILMNVECGQTTLDELEELFRYNDAIIRNLIIRREHAITEESLLAKSAE-EKRARKAQREE 118

Query: 121 NVDRKQHVS 129
                Q   
Sbjct: 119 AQQVAQEAE 127


>gi|255020466|ref|ZP_05292531.1| SSU ribosomal protein S6p [Acidithiobacillus caldus ATCC 51756]
 gi|254970076|gb|EET27573.1| SSU ribosomal protein S6p [Acidithiobacillus caldus ATCC 51756]
          Length = 125

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 60/119 (50%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VFL+  D  S+ +   I +Y+ +I+ +GG +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFLVHPD-QSELVPQMIERYRGMIEGDGGTIHRLEDWGRRQLAYPIKKAHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           + MN+    AA+ E++   R  + VLR L L  D     P+   +  +          +
Sbjct: 60  ILMNVECSAAALAELEDAFRFSDAVLRHLILARDEAITQPSFLARDENDRRERSESQEE 118


>gi|114569763|ref|YP_756443.1| 30S ribosomal protein S6 [Maricaulis maris MCS10]
 gi|122316233|sp|Q0AQD2|RS6_MARMM RecName: Full=30S ribosomal protein S6
 gi|114340225|gb|ABI65505.1| SSU ribosomal protein S6P [Maricaulis maris MCS10]
          Length = 117

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 77/116 (66%), Gaps = 1/116 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH+F++R D+S  Q++  + + ++LI+E GG+   +   G+R ++YRI K+RK +Y
Sbjct: 1   MALYEHIFIVRPDVSPAQMESLLEETKALIEEKGGKTGKIEYWGLRNLSYRINKSRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPT-LTIQRHDRDDRNDR 115
             ++I +    I+E++R  R+ E+V+R +TL V++H + P+ +  ++ DR  R +R
Sbjct: 61  GLIDIDAEADVINELERLQRLSEDVIRHMTLRVEAHTEEPSAILTKKDDRRGRRER 116


>gi|34580978|ref|ZP_00142458.1| 30S ribosomal protein S6 [Rickettsia sibirica 246]
 gi|28262363|gb|EAA25867.1| 30S ribosomal protein S6 [Rickettsia sibirica 246]
          Length = 121

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 64/112 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 1   MSFYESVFIIRQDVSLNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ +        E++RKM+++EN++R LT+  DS    P+  ++    ++ 
Sbjct: 61  YFLGLDITGNVKEELERKMKLNENIIRFLTIQADSISSEPSPILKNQSTENT 112


>gi|332308095|ref|YP_004435946.1| ribosomal protein S6 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332175424|gb|AEE24678.1| ribosomal protein S6 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 134

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 68/135 (50%), Gaps = 3/135 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  ++ +NGG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPGMIERYTGILTQNGGTIHRMEDWGRRQLAYPIDKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N  +   A+ E++   R ++ VLR+L +     E   +   +   R+ R++R   + 
Sbjct: 60  VLINAEASAEAVEELETAFRFNDVVLRNLVMRTKDAETEQSPMAKEERREKRDERPSSED 119

Query: 121 NV--DRKQHVSEEKP 133
                     S+EK 
Sbjct: 120 KSVEPEAATASDEKE 134


>gi|15603918|ref|NP_220433.1| 30S ribosomal protein S6 [Rickettsia prowazekii str. Madrid E]
 gi|6226109|sp|Q9ZEA6|RS6_RICPR RecName: Full=30S ribosomal protein S6
 gi|3860609|emb|CAA14510.1| 30S RIBOSOMAL PROTEIN S6 (rpsF) [Rickettsia prowazekii]
          Length = 121

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 64/112 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 1   MSFYESVFIIRQDVSLNDIDKIVDDFTKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ I        E++RKM+++EN++R LT+  DS    P+  ++    ++ 
Sbjct: 61  YFLGIDITSNVKEELERKMKLNENIIRFLTIKADSISSEPSPILKNQSTENT 112


>gi|157827935|ref|YP_001494177.1| 30S ribosomal protein S6 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|238650506|ref|YP_002916358.1| 30S ribosomal protein S6 [Rickettsia peacockii str. Rustic]
 gi|166227377|sp|A8GQJ4|RS6_RICRS RecName: Full=30S ribosomal protein S6
 gi|259495343|sp|C4K159|RS6_RICPU RecName: Full=30S ribosomal protein S6
 gi|157800416|gb|ABV75669.1| 30S ribosomal protein S6 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|238624604|gb|ACR47310.1| 30S ribosomal protein S6 [Rickettsia peacockii str. Rustic]
          Length = 121

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 64/111 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 1   MSFYESVFIIRQDVSLNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
            F+ +        E++RKM+++EN++R LT+  DS    P+  ++    ++
Sbjct: 61  YFLGLDITGNVKEELERKMKLNENIIRFLTIQADSISSEPSPILKNQSTEN 111


>gi|51473302|ref|YP_067059.1| 30S ribosomal protein S6 [Rickettsia typhi str. Wilmington]
 gi|61216179|sp|Q68XR5|RS6_RICTY RecName: Full=30S ribosomal protein S6
 gi|51459614|gb|AAU03577.1| 30S ribosomal protein S6 [Rickettsia typhi str. Wilmington]
          Length = 121

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 65/112 (58%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 1   MSFYESVFIIRQDVSLNDIDKIVDDFTKIIKDNDGTIIKKEYWGLRTLAYKIGNNKKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ I        E++RKM+++E+++R LT+ VDS    P+  ++    ++ 
Sbjct: 61  YFLGIDITSNIKEELERKMKLNESIIRFLTIKVDSISSEPSPILKNQSTENT 112


>gi|161723851|ref|NP_359701.2| 30S ribosomal protein S6 [Rickettsia conorii str. Malish 7]
 gi|20139897|sp|Q92JK3|RS6_RICCN RecName: Full=30S ribosomal protein S6
          Length = 121

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 64/112 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 1   MSFYESVFIIRQDVSLNDIDKIVDDFAKIIKDNNGTIIKKEYWGLRTLAYKIGNNKKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ +        E++RKM+++EN++R LT+  DS    P+  ++    ++ 
Sbjct: 61  YFLGLDITGNVKEELERKMKLNENIIRFLTIQADSISSEPSPILKNQSTENT 112


>gi|269468494|gb|EEZ80152.1| ribosomal protein S6 [uncultured SUP05 cluster bacterium]
          Length = 115

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 30/116 (25%), Positives = 57/116 (49%), Gaps = 1/116 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE   ++  D  S Q+   + +Y+ +I  +GG +    + G + +AY I K  KA+Y
Sbjct: 1   MRHYEIALIVHPD-QSAQVGTMMDKYKEMITADGGNIHREEDWGRKHLAYPIDKIYKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
           + MNI      + ++    R ++ VLR+L +   +    P++ +   D D +  R 
Sbjct: 60  LMMNIECGQETLDKLNYNFRFNDAVLRNLIISKKTAITEPSIMMTAKDEDKKPVRR 115


>gi|262375304|ref|ZP_06068537.1| ribosomal protein S6 [Acinetobacter lwoffii SH145]
 gi|262309558|gb|EEY90688.1| ribosomal protein S6 [Acinetobacter lwoffii SH145]
          Length = 128

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 32/130 (24%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y + I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSDQVVGMVERYLTHIKEAEGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E++   R ++ ++RSL +  ++     +L  +  +  ++  R  +  
Sbjct: 60  ILMNVECGQTTLDELEELFRYNDAIIRSLIIRRENAITEESLLAKSAE--EKRARKAQRE 117

Query: 121 NVDRKQHVSE 130
                Q  +E
Sbjct: 118 EAQHAQDSAE 127


>gi|148255213|ref|YP_001239798.1| 30S ribosomal protein S6 [Bradyrhizobium sp. BTAi1]
 gi|166226804|sp|A5EI98|RS6_BRASB RecName: Full=30S ribosomal protein S6
 gi|146407386|gb|ABQ35892.1| SSU ribosomal protein S6P [Bradyrhizobium sp. BTAi1]
          Length = 153

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD S+QQ+++   Q   +++  GG+V      G+R++ YR+ KNRKA++
Sbjct: 1   MPLYEHVFLARQDASTQQVEELTTQMTGIVEGLGGKVTKTENWGVRSLTYRMNKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI +P AAI E++R+ RI E+V+R L++ VD  E+ P+  +++
Sbjct: 61  VLLNIDAPSAAIAEIERQERISEDVIRYLSVRVDELEEGPSAMMRK 106


>gi|296116663|ref|ZP_06835273.1| 30S ribosomal protein S6 [Gluconacetobacter hansenii ATCC 23769]
 gi|295976875|gb|EFG83643.1| 30S ribosomal protein S6 [Gluconacetobacter hansenii ATCC 23769]
          Length = 167

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 76/119 (63%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE V + R D+S QQ++       ++++   G ++     G+RT+AYRI+KNRK +Y
Sbjct: 1   MPLYETVLIARNDVSQQQVETIADGIATVLEAESGSIKKREYWGLRTLAYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH-DRDDRNDRFPR 118
           + + + + PAAI E++R++ ++E+VLR L L VD  +++P++ + R  D  +R  R P+
Sbjct: 61  MLLGLDATPAAIKEIERQLSLNEDVLRVLMLRVDEIDEAPSVILSRKGDERERGFRGPK 119


>gi|255016569|ref|ZP_05288695.1| 30S ribosomal protein S6 [Bacteroides sp. 2_1_7]
          Length = 145

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 52/116 (44%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++ +L++  G E+      G+R +AY I K    +Y
Sbjct: 28  MNNYETVFILTPVLSDAQMKEAVEKFTNLLKAQGAEIVNEENWGLRKLAYPIDKKTTGFY 87

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
             +   + P+ I  ++   R DE V+R LT   D +        +         + 
Sbjct: 88  QLVEFKADPSVIATLELNFRRDERVIRFLTFRQDKYAAEYAAKRRNLKSSKETVKE 143


>gi|299769500|ref|YP_003731526.1| 30S ribosomal protein S6 [Acinetobacter sp. DR1]
 gi|298699588|gb|ADI90153.1| 30S ribosomal protein S6 [Acinetobacter sp. DR1]
          Length = 127

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 62/129 (48%), Gaps = 2/129 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y S I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSDQVVGMVERYISQIKEAEGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E++   R ++ ++R+L +  +      +L  +  + + R  +  R+ 
Sbjct: 60  ILMNVECGQTTLDELEELFRYNDAIIRNLIIRREHAITEESLLAKSAE-EKRARKAQREE 118

Query: 121 NVDRKQHVS 129
                Q   
Sbjct: 119 AQQVAQDAE 127


>gi|332678242|gb|AEE87371.1| SSU ribosomal protein S6p [Francisella cf. novicida Fx1]
          Length = 111

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 63/110 (57%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE V ++  D  S Q+   +G+Y+ +I+E GG+V    + G R +AY I K  KA+Y
Sbjct: 1   MKHYEIVLMIHPD-QSDQLDAMLGKYRGIIEEKGGKVHRFEDWGRRQLAYPIEKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V  NI  P  ++ +++  +R ++ +LR L +        P++ ++ ++++
Sbjct: 60  VLFNIECPTESLEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKE 109


>gi|293609460|ref|ZP_06691762.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827912|gb|EFF86275.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 129

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 62/129 (48%), Gaps = 2/129 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y S I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 3   MRHYEIVLLVHPD-QSDQVVGMVERYISQIKEAEGQIHRLEDWGRRQLAYPINKIHKAHY 61

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E++   R ++ ++R+L +  +      +L  +  + + R  +  R+ 
Sbjct: 62  ILMNVECGQTTLDELEELFRYNDAIIRNLIIRREHAITEESLLAKSAE-EKRARKAQREE 120

Query: 121 NVDRKQHVS 129
                Q   
Sbjct: 121 AQQVAQEAE 129


>gi|114773243|ref|ZP_01450478.1| 30S ribosomal protein S6 [alpha proteobacterium HTCC2255]
 gi|114546362|gb|EAU49271.1| 30S ribosomal protein S6 [alpha proteobacterium HTCC2255]
          Length = 131

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 63/132 (47%), Gaps = 1/132 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I +Y  ++ ++GG +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVPAMIEKYSGILTQDGGSITRLEDWGRRQLAYPIEKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N  +   A+ E++   R ++ +LR+L +         +   +   R++R  +     
Sbjct: 60  VLINAEASAEALEELETAFRFNDVILRNLVMRTKGPVTEASPMKKEERREERPTKREDAA 119

Query: 121 NVDRKQHVSEEK 132
                    E+ 
Sbjct: 120 PAPAADASDEQA 131


>gi|325122722|gb|ADY82245.1| 30S ribosomal protein S6 [Acinetobacter calcoaceticus PHEA-2]
          Length = 127

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 62/129 (48%), Gaps = 2/129 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y S I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSDQVVGMVERYISQIKEAEGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E++   R ++ ++R+L +  +      +L  +  + + R  +  R+ 
Sbjct: 60  ILMNVECGQTTLDELEELFRYNDAIIRNLIIRREHAITEESLLAKSAE-EKRARKAQREE 118

Query: 121 NVDRKQHVS 129
                Q   
Sbjct: 119 AQQVAQEAE 127


>gi|163755339|ref|ZP_02162459.1| 30S ribosomal protein S6 [Kordia algicida OT-1]
 gi|161324759|gb|EDP96088.1| 30S ribosomal protein S6 [Kordia algicida OT-1]
          Length = 112

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 58/113 (51%), Gaps = 2/113 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  QIK+T+ +++  I   GG++      G++ +AY I+  +  +Y
Sbjct: 1   MNHYETVFILNPVLSETQIKETVAKFEDFIVSRGGKMISKENWGLKKLAYPIQHKKSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
                 +P   I++ + + R DE ++R LT+ +D H  +     +R +R    
Sbjct: 61  HLFEFQAPGEIINQYELEFRRDERIMRYLTVRLDKH--AIAWAEKRRNRKTAK 111


>gi|254372904|ref|ZP_04988393.1| 30S ribosomal protein S6 [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254374358|ref|ZP_04989840.1| 30S ribosomal protein S6 [Francisella novicida GA99-3548]
 gi|151570631|gb|EDN36285.1| 30S ribosomal protein S6 [Francisella novicida GA99-3549]
 gi|151572078|gb|EDN37732.1| 30S ribosomal protein S6 [Francisella novicida GA99-3548]
          Length = 111

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 63/110 (57%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE V ++  D  S Q+   +G+Y+ +I+E GG++    + G R +AY I K  KA+Y
Sbjct: 1   MKHYEIVLMIHPD-QSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V  NI  P  ++ +++  +R ++ +LR L +        P++ ++ ++++
Sbjct: 60  VLFNIECPTESLEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKE 109


>gi|162022125|ref|YP_246159.2| 30S ribosomal protein S6 [Rickettsia felis URRWXCal2]
 gi|91207788|sp|Q4UN64|RS6_RICFE RecName: Full=30S ribosomal protein S6
          Length = 121

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 64/112 (57%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++RQD+S   I   +  +  +I++N G +      G+RT+AY+I  N+K +Y
Sbjct: 1   MSFYESVFIIRQDVSLNDIDKIVDDFAKIIKDNNGTIVKKEYWGLRTLAYKIGNNKKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
            F+ +        E++RKM+++EN++R LT+  DS    P+  ++    ++ 
Sbjct: 61  YFLGLDITGNVKEELERKMKLNENIIRFLTIKADSISSEPSQILKNQSTENT 112


>gi|119713692|gb|ABL97742.1| ribosomal protein S6 [uncultured marine bacterium EB0_41B09]
          Length = 203

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 34/138 (24%), Positives = 65/138 (47%), Gaps = 8/138 (5%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q+   I + Q  +  N G +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVFIVHPD-QSEQVPSMIERIQKSVTANKGNIHRLEDWGRRQLAYPIQKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH-------DRDDRN 113
           V MNI     ++ E++   + ++ V+R L +   +   S +  +          +  +  
Sbjct: 60  VLMNIECSLESLAELEHNFKFNDAVIRHLVVSKKTAVTSESPMMGEEKSKSLLGENKNNT 119

Query: 114 DRFPRDRNVDRKQHVSEE 131
                ++    K+ V+EE
Sbjct: 120 KSEAEEKAPAVKKEVTEE 137


>gi|308048248|ref|YP_003911814.1| 30S ribosomal protein S6P [Ferrimonas balearica DSM 9799]
 gi|307630438|gb|ADN74740.1| SSU ribosomal protein S6P [Ferrimonas balearica DSM 9799]
          Length = 130

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 65/131 (49%), Gaps = 1/131 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE VF++  D  S+Q++  I +Y + I+++GG++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVFMVHPD-QSEQVQGMIERYTATIEKDGGKIHRLEDWGRRQLAYPIEKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V +N  +   A+ E++   R ++ V+RS+ +   +     +   +  +     +      
Sbjct: 60  VLVNAEATAEAVAELETNFRYNDAVIRSMVIRTKAAVTEASPMAKAKEERREREERRERT 119

Query: 121 NVDRKQHVSEE 131
                Q  S E
Sbjct: 120 EAKPAQEASAE 130


>gi|56708147|ref|YP_170043.1| 30S ribosomal protein S6 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|89256363|ref|YP_513725.1| 30S ribosomal protein S6 [Francisella tularensis subsp. holarctica
           LVS]
 gi|110670618|ref|YP_667175.1| 30S ribosomal protein S6 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118497543|ref|YP_898593.1| 30S ribosomal protein S6 [Francisella tularensis subsp. novicida
           U112]
 gi|134301960|ref|YP_001121929.1| 30S ribosomal protein S6 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|167010708|ref|ZP_02275639.1| 30S ribosomal protein S6 [Francisella tularensis subsp. holarctica
           FSC200]
 gi|187931623|ref|YP_001891607.1| 30S ribosomal protein S6 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224457243|ref|ZP_03665716.1| 30S ribosomal protein S6 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|254367699|ref|ZP_04983720.1| 30S ribosomal protein S6 [Francisella tularensis subsp. holarctica
           257]
 gi|254369337|ref|ZP_04985349.1| 30S ribosomal protein S6 [Francisella tularensis subsp. holarctica
           FSC022]
 gi|254370631|ref|ZP_04986636.1| 30S ribosomal protein S6 [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254874950|ref|ZP_05247660.1| 30S ribosomal protein S6 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|290954056|ref|ZP_06558677.1| 30S ribosomal protein S6 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|295312549|ref|ZP_06803309.1| 30S ribosomal protein S6 [Francisella tularensis subsp. holarctica
           URFT1]
 gi|61215373|sp|Q5NFZ9|RS6_FRATT RecName: Full=30S ribosomal protein S6
 gi|122500738|sp|Q2A3H7|RS6_FRATH RecName: Full=30S ribosomal protein S6
 gi|122970928|sp|Q14HF1|RS6_FRAT1 RecName: Full=30S ribosomal protein S6
 gi|166226831|sp|A0Q6H4|RS6_FRATN RecName: Full=30S ribosomal protein S6
 gi|166226967|sp|A4IY07|RS6_FRATW RecName: Full=30S ribosomal protein S6
 gi|226703470|sp|B2SGH0|RS6_FRATM RecName: Full=30S ribosomal protein S6
 gi|56604639|emb|CAG45695.1| 30S ribosomal protein S6 [Francisella tularensis subsp. tularensis
           SCHU S4]
 gi|89144194|emb|CAJ79463.1| 30S ribosomal protein S6 [Francisella tularensis subsp. holarctica
           LVS]
 gi|110320951|emb|CAL09078.1| 30S ribosomal protein S6 [Francisella tularensis subsp. tularensis
           FSC198]
 gi|118423449|gb|ABK89839.1| 30S ribosomal protein S6 [Francisella novicida U112]
 gi|134049737|gb|ABO46808.1| ribosomal protein S6 [Francisella tularensis subsp. tularensis
           WY96-3418]
 gi|134253510|gb|EBA52604.1| 30S ribosomal protein S6 [Francisella tularensis subsp. holarctica
           257]
 gi|151568874|gb|EDN34528.1| 30S ribosomal protein S6 [Francisella tularensis subsp. tularensis
           FSC033]
 gi|157122287|gb|EDO66427.1| 30S ribosomal protein S6 [Francisella tularensis subsp. holarctica
           FSC022]
 gi|187712532|gb|ACD30829.1| 30S ribosomal protein S6 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254840949|gb|EET19385.1| 30S ribosomal protein S6 [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159353|gb|ADA78744.1| 30S ribosomal protein S6 [Francisella tularensis subsp. tularensis
           NE061598]
          Length = 111

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 63/110 (57%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE V ++  D  S Q+   +G+Y+ +I+E GG++    + G R +AY I K  KA+Y
Sbjct: 1   MKHYEVVLMIHPD-QSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V  NI  P  ++ +++  +R ++ +LR L +        P++ ++ ++++
Sbjct: 60  VLFNIECPTESLEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKE 109


>gi|192358927|ref|YP_001983437.1| 30S ribosomal protein S6 [Cellvibrio japonicus Ueda107]
 gi|226703436|sp|B3PCS2|RS6_CELJU RecName: Full=30S ribosomal protein S6
 gi|190685092|gb|ACE82770.1| 30S ribosomal protein S6 [Cellvibrio japonicus Ueda107]
          Length = 147

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 68/135 (50%), Gaps = 5/135 (3%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S+Q+   + +Y S ++ +GG+V    + G R +AY I K  KA+Y
Sbjct: 1   MRHYEVVVLIHPD-QSEQVPAMVERYTSTVKADGGQVHRFEDWGRRQLAYSINKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH----DRDDRNDRF 116
           V +N+    AA+ E+    R ++ VLRSL +  D+     +  ++      +R  R  R 
Sbjct: 60  VLLNVECSDAALEELTTNFRYNDAVLRSLVIREDAAITEESFILKAEKEGRERKARPARA 119

Query: 117 PRDRNVDRKQHVSEE 131
            R  + + +    EE
Sbjct: 120 ERRDDTEAEDLSDEE 134


>gi|148244752|ref|YP_001219446.1| 30S ribosomal protein S6 [Candidatus Vesicomyosocius okutanii HA]
 gi|166227401|sp|A5CWD9|RS6_VESOH RecName: Full=30S ribosomal protein S6
 gi|146326579|dbj|BAF61722.1| 30S ribosomal protein S6 [Candidatus Vesicomyosocius okutanii HA]
          Length = 113

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE   ++  D  S Q+   + +Y+ +I  +GG++    + G + +AY I+K  KA+Y
Sbjct: 1   MRHYEITLIVHPD-QSAQVGTMMDKYKEIINADGGKIHKEEDWGRKHLAYPIKKIYKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           + MNI      + ++    R ++ +LRSL +  +    +P++ +   D++ 
Sbjct: 60  LMMNIECDQEMLDKLNYNFRFNDAILRSLIISKNKAITTPSIMMVNKDKEK 110


>gi|27379190|ref|NP_770719.1| 30S ribosomal protein S6 [Bradyrhizobium japonicum USDA 110]
 gi|32171527|sp|Q89MW3|RS6_BRAJA RecName: Full=30S ribosomal protein S6
 gi|27352341|dbj|BAC49344.1| 30S ribosomal protein S6 [Bradyrhizobium japonicum USDA 110]
          Length = 166

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 73/106 (68%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD S QQ+++   Q   +++  GG+V      G+R++ YR+ KNRKA++
Sbjct: 1   MALYEHVFLARQDASPQQVEELTAQMTGIVEGLGGKVTKTENWGVRSLTYRMNKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI +P AAI E++R+ RI E+V+R L++ V+  E+ P+  +++
Sbjct: 61  VLLNIDAPSAAIAEIERQERISEDVIRYLSVRVEELEEGPSAMMRK 106


>gi|262279562|ref|ZP_06057347.1| ribosomal protein S6 [Acinetobacter calcoaceticus RUH2202]
 gi|262259913|gb|EEY78646.1| ribosomal protein S6 [Acinetobacter calcoaceticus RUH2202]
          Length = 127

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 32/130 (24%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y S I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSDQVVGMVERYISQIKEAEGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E++   R ++ ++R+L +  +      +L  +  +  ++  R  +  
Sbjct: 60  ILMNVECGQTTLDELEELFRYNDAIIRNLIIRREHAITEESLLAKSAE--EKRARKAQRE 117

Query: 121 NVDRKQHVSE 130
              +  H +E
Sbjct: 118 EAQQVTHEAE 127


>gi|255319500|ref|ZP_05360714.1| ribosomal protein S6 [Acinetobacter radioresistens SK82]
 gi|262378476|ref|ZP_06071633.1| ribosomal protein S6 [Acinetobacter radioresistens SH164]
 gi|255303440|gb|EET82643.1| ribosomal protein S6 [Acinetobacter radioresistens SK82]
 gi|262299761|gb|EEY87673.1| ribosomal protein S6 [Acinetobacter radioresistens SH164]
          Length = 128

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 64/129 (49%), Gaps = 2/129 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y + I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSDQVVGMVERYLTHIKEADGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E++   R ++ ++R++ +  ++     +L  +  + + R  +  R+ 
Sbjct: 60  ILMNVECGQTTLDELEELFRYNDAIIRNVIIRRENAITEESLLAKSAE-EKRARKAQREE 118

Query: 121 NVDRKQHVS 129
               +  V 
Sbjct: 119 AQHNQDSVE 127


>gi|332184105|gb|AEE26359.1| SSU ribosomal protein S6p [Francisella cf. novicida 3523]
          Length = 111

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 64/110 (58%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE V ++  D  S Q+   +G+Y+S+I+E GG++    + G R +AY I K  KA+Y
Sbjct: 1   MKHYEVVLMIHPD-QSDQLDAMLGKYRSIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V  NI  P  ++ +++  +R ++ +LR L +        P++ ++ ++++
Sbjct: 60  VLFNIECPTESLEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKE 109


>gi|146340286|ref|YP_001205334.1| 30S ribosomal protein S6 [Bradyrhizobium sp. ORS278]
 gi|166226805|sp|A4YT77|RS6_BRASO RecName: Full=30S ribosomal protein S6
 gi|146193092|emb|CAL77103.1| 30S ribosomal protein S6 [Bradyrhizobium sp. ORS278]
          Length = 153

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 74/106 (69%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEHVFL RQD S+QQ+++   Q   +++  GG+V      G+R++ YR+ KNRKA++
Sbjct: 1   MPLYEHVFLARQDASTQQVEELTTQMTGIVEGLGGKVTKTENWGVRSLTYRMNKNRKAHF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           V +NI +P AAI E++R+ RI E+V+R L++ V+  E+ P+  +++
Sbjct: 61  VLLNIDAPSAAIAEIERQERISEDVIRYLSVRVEELEEGPSAMMRK 106


>gi|330993921|ref|ZP_08317851.1| 30S ribosomal protein S6 [Gluconacetobacter sp. SXCC-1]
 gi|329758867|gb|EGG75381.1| 30S ribosomal protein S6 [Gluconacetobacter sp. SXCC-1]
          Length = 161

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/119 (36%), Positives = 75/119 (63%), Gaps = 1/119 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE V + R D+S QQ++       + ++   G V+     G+RT+AYRI+KNRK +Y
Sbjct: 1   MPLYETVLIARNDVSQQQVEAIADGIATYLEAESGSVKKREYWGLRTLAYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH-DRDDRNDRFPR 118
           + + + +  AAI E++R++ ++E+VLR LTL VD  +++P++ + R  D  +R  R P+
Sbjct: 61  MLLGLDASSAAIKEIERQLSLNEDVLRVLTLRVDEIDEAPSVILSRKGDERERGFRGPK 119


>gi|260063157|ref|YP_003196237.1| 30S ribosomal protein S6 [Robiginitalea biformata HTCC2501]
 gi|88783251|gb|EAR14423.1| 30S ribosomal protein S6 [Robiginitalea biformata HTCC2501]
          Length = 112

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 55/96 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QI++T+ ++++ + +NG ++    + G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSDTQIEETVKKFENFLTKNGAKMVSKEDWGLKKLAYPIQHKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
                +P   I   +++ + DE ++R LT+ +D H
Sbjct: 61 HLFEFTAPGEVIGPYEQEFKRDERIMRFLTVKLDKH 96


>gi|94676773|ref|YP_589002.1| ribosomal protein S6 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|166226803|sp|Q1LSR2|RS6_BAUCH RecName: Full=30S ribosomal protein S6
 gi|94219923|gb|ABF14082.1| ribosomal protein S6 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 125

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 67/125 (53%), Gaps = 3/125 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V ++  D  S+Q+   I +Y ++I    G++  + + G R ++Y I+K  KA+Y
Sbjct: 1   MRHYEIVLMVHPD-QSEQVSRMIERYSTVITSAQGKIHRLEDWGRRQLSYPIKKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD--DRNDRFPR 118
           V +N+ +    + E+ + +R +E ++RS+ + V       +  ++  D +     +++  
Sbjct: 60  VLINLEASQKVMDELSKYLRFNEAIIRSMIMRVKHIVTEASPMVKTKDDNLVTEINKYSE 119

Query: 119 DRNVD 123
           ++N +
Sbjct: 120 EKNSE 124


>gi|281603662|gb|ADA76646.1| 30S ribosomal protein S6 [Shigella flexneri 2002017]
 gi|313646323|gb|EFS10785.1| ribosomal protein S6 [Shigella flexneri 2a str. 2457T]
 gi|332083775|gb|EGI88993.1| ribosomal protein S6 [Shigella dysenteriae 155-74]
 gi|332749344|gb|EGJ79765.1| ribosomal protein S6 [Shigella flexneri 4343-70]
 gi|332763252|gb|EGJ93495.1| ribosomal protein S6 [Shigella flexneri 2930-71]
          Length = 123

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 63/124 (50%), Gaps = 2/124 (1%)

Query: 9   LLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP 68
           ++  D  S+Q+   I +Y + I    G++  + + G R +AY I K  KA+YV MN+ +P
Sbjct: 1   MVHPD-QSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAP 59

Query: 69  PAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRDRNVDRKQH 127
              I E++   R ++ V+RS+ +         +  ++ + +R +R D F  +   D +  
Sbjct: 60  QEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANETADDAEAG 119

Query: 128 VSEE 131
            SEE
Sbjct: 120 DSEE 123


>gi|53757419|gb|AAU91710.1| ribosomal protein S6 [Methylococcus capsulatus str. Bath]
          Length = 128

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 57/121 (47%), Gaps = 2/121 (1%)

Query: 9   LLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP 68
           ++  D  S Q+   I +Y+S+I+   G +  + + G R +AY I K  KA+YV MNI   
Sbjct: 1   MVHPD-QSGQVPAMIERYRSIIEGAAGRIHRLEDWGRRQLAYPIAKLHKAHYVLMNIECD 59

Query: 69  PAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNVDRKQHV 128
            A + E++   R ++ VLRSLT+  D     P+   +    D   DR P D         
Sbjct: 60  QATLEELESGFRFNDAVLRSLTIRRDEAVTEPSALARSGS-DAEADRAPADEGSVEAAGA 118

Query: 129 S 129
            
Sbjct: 119 E 119


>gi|40062774|gb|AAR37668.1| ribosomal protein S6 [uncultured marine bacterium 439]
          Length = 117

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 55/118 (46%), Gaps = 1/118 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE   ++  D  S Q+   I +Y+ +I  +GG V    + G + +AY I K  KA+Y
Sbjct: 1   MRHYEITLIVHPD-QSSQVTTMIEKYKEIITTSGGNVHREEDWGRKHLAYPINKIYKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPR 118
           + MNI      + ++    R ++ +LR+L +       +P++ I   + D        
Sbjct: 60  LMMNIECDQETLDKLNYNFRFNDAILRNLIISKSEAITTPSIMIANSEEDKDKVTEKE 117


>gi|115314808|ref|YP_763531.1| 30S ribosomal protein S6 [Francisella tularensis subsp. holarctica
           OSU18]
 gi|115129707|gb|ABI82894.1| ribosomal protein S6 [Francisella tularensis subsp. holarctica
           OSU18]
          Length = 120

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE V ++  D  S Q+   +G+Y  +I+E GG++    + G R +AY I K  KA+Y
Sbjct: 10  MKHYEVVLMIHPD-QSDQLDAMLGKYCGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHY 68

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V  NI  P  ++ +++  +R ++ +LR L +        P++ ++ ++++
Sbjct: 69  VLFNIECPTESLEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKE 118


>gi|255535654|ref|YP_003096025.1| SSU ribosomal protein S6p [Flavobacteriaceae bacterium 3519-10]
 gi|255341850|gb|ACU07963.1| SSU ribosomal protein S6p [Flavobacteriaceae bacterium 3519-10]
          Length = 125

 Score =  111 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 55/113 (48%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+++ + +++ L+  +  E+      G++ +AY I+  +  +Y
Sbjct: 13  MNNYETVFILTPVLSDTQVEEAVQKFEDLLTSHNCEIVAKENWGLKKLAYPIQLKKNGFY 72

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
             +        + +++   + DE ++R LT  +D H     +T +  ++  + 
Sbjct: 73  TLIEFKGEGTVVADLELAFKRDERIIRFLTTKLDKHAIDYAVTRRSKNKSAKA 125


>gi|313887203|ref|ZP_07820899.1| ribosomal protein S6 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332300446|ref|YP_004442367.1| 30S ribosomal protein S6 [Porphyromonas asaccharolytica DSM 20707]
 gi|312923432|gb|EFR34245.1| ribosomal protein S6 [Porphyromonas asaccharolytica PR426713P-I]
 gi|332177509|gb|AEE13199.1| 30S ribosomal protein S6 [Porphyromonas asaccharolytica DSM 20707]
          Length = 115

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 53/115 (46%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++ S +   G  +      G++ +AY I K    +Y
Sbjct: 1   MNHYETVFILTPVLSDAQMKEAVDKFTSHLTSAGATIVNDEHWGLKKLAYPIEKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
            F+   + P+ I   +  +R DE VLR LT+  D    +     +    +   ++
Sbjct: 61  HFIEFDAEPSVIKPFETLLRRDETVLRYLTIAQDKFHHAYAEKRRSLKSNPVAEK 115


>gi|325279431|ref|YP_004251973.1| 30S ribosomal protein S6 [Odoribacter splanchnicus DSM 20712]
 gi|324311240|gb|ADY31793.1| 30S ribosomal protein S6 [Odoribacter splanchnicus DSM 20712]
          Length = 116

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 58/114 (50%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE VF+    +S QQIK+ + ++++ I +NGG +      G+R +AY I+K    +Y 
Sbjct: 3   NHYETVFITTPVLSEQQIKEAVEKFKNTITDNGGTIEHEEAWGLRKLAYPIQKKTTGFYH 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
            +   +  A + +++   R DE V+R LT  +D +    TL  +      + ++
Sbjct: 63  LLQFEAEGALVDKLETAYRRDERVIRFLTFRLDKYAYEYTLKRRSKYAAKQEEK 116


>gi|126697235|ref|YP_001092121.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9301]
 gi|126544278|gb|ABO18520.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9301]
          Length = 153

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 69/132 (52%), Gaps = 6/132 (4%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
            YE +++LR DI+  ++   I +Y  L++E GG +      G R +AY+I K+R+  YV 
Sbjct: 7   YYETMYILRPDIAEDEVTTYIDKYNKLLEEFGGTILDSQMRGKRRLAYQIAKHREGIYVQ 66

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNV 122
           ++       I ++++ MR+ E+V+R +T+  +    +P  + +   + D  +      N 
Sbjct: 67  LSHQGDGQHIFKIEKAMRLSEDVIRYMTVKQEGPLPTPRPSSKSSTKADDKE------NP 120

Query: 123 DRKQHVSEEKPL 134
           + K    EE+P+
Sbjct: 121 ETKVEPKEEQPV 132


>gi|52841822|ref|YP_095621.1| 30S ribosomal protein S6 [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|54294364|ref|YP_126779.1| 30S ribosomal protein S6 [Legionella pneumophila str. Lens]
 gi|54297505|ref|YP_123874.1| 30S ribosomal protein S6 [Legionella pneumophila str. Paris]
 gi|148359129|ref|YP_001250336.1| 30S ribosomal protein S6 [Legionella pneumophila str. Corby]
 gi|296107177|ref|YP_003618877.1| rpsF 30S ribosomal protein S6 [Legionella pneumophila 2300/99
           Alcoy]
 gi|61215400|sp|Q5WWM0|RS6_LEGPL RecName: Full=30S ribosomal protein S6
 gi|61215408|sp|Q5X4X0|RS6_LEGPA RecName: Full=30S ribosomal protein S6
 gi|61215428|sp|Q5ZV48|RS6_LEGPH RecName: Full=30S ribosomal protein S6
 gi|166226977|sp|A5IC90|RS6_LEGPC RecName: Full=30S ribosomal protein S6
 gi|52628933|gb|AAU27674.1| 30S ribosomal protein S6 [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|53751290|emb|CAH12701.1| 30S ribosomal protein S6 [Legionella pneumophila str. Paris]
 gi|53754196|emb|CAH15673.1| 30S ribosomal protein S6 [Legionella pneumophila str. Lens]
 gi|148280902|gb|ABQ54990.1| 30S ribosomal protein S6 [Legionella pneumophila str. Corby]
 gi|295649078|gb|ADG24925.1| rpsF 30S ribosomal protein S6 [Legionella pneumophila 2300/99
           Alcoy]
 gi|307610292|emb|CBW99856.1| 30S ribosomal protein S6 [Legionella pneumophila 130b]
          Length = 112

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 61/111 (54%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y+ +I ++ G++    +LG R +AY I K  KA+Y
Sbjct: 1   MRHYEIMFLVHPD-QSEQVPGMVERYEGIITKHNGKIHRKEDLGRRQLAYSINKVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           + MN+     A++E+K   + ++ +LR L  +      + ++ +++     
Sbjct: 60  ILMNVECNLDALNEIKNAFKFNDAILRHLITVQKQAITTESVLMKKEKETK 110


>gi|148260512|ref|YP_001234639.1| ribosomal protein S6 [Acidiphilium cryptum JF-5]
 gi|166226792|sp|A5FYN8|RS6_ACICJ RecName: Full=30S ribosomal protein S6
 gi|146402193|gb|ABQ30720.1| SSU ribosomal protein S6P [Acidiphilium cryptum JF-5]
          Length = 158

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/102 (35%), Positives = 64/102 (62%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE V + R +I+ QQ+        + ++   G V+     G+R +AYRI+KNRK +Y
Sbjct: 1   MPLYECVLIARSEITQQQVDTIADAVTAQVESESGAVKKREYWGLRNLAYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
           V + + + PA I EM+R++ ++E+VLR +T+ V+  +++P+ 
Sbjct: 61  VLLGLDAEPATISEMERQLGLNEDVLRFMTVRVEDIDEAPSA 102


>gi|91070594|gb|ABE11494.1| 30S ribosomal protein S6 [uncultured Prochlorococcus marinus clone
           HOT0M-8F9]
          Length = 157

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/133 (25%), Positives = 70/133 (52%), Gaps = 6/133 (4%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
            YE +++LR DI+  ++ + I +Y  L++E GG +      G R +AY+I K+R+  YV 
Sbjct: 11  YYETMYILRPDIAEDEVTNHIDKYNKLLEEFGGTILDSQMRGKRRLAYQIAKHREGIYVQ 70

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNV 122
           ++       I ++++ MR+ E+V+R +T+  +    +P  + +   + +  D      N 
Sbjct: 71  LSHQGDGQHIFKIEKAMRLSEDVIRYMTVKQEGPLPTPRPSNKSTSQSESKD------NP 124

Query: 123 DRKQHVSEEKPLS 135
             K    E++P++
Sbjct: 125 VPKVESKEKQPVA 137


>gi|169656606|ref|YP_001428513.2| 30S ribosomal protein S6 [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|164551674|gb|ABU61557.2| ribosomal protein S6 [Francisella tularensis subsp. holarctica
           FTNF002-00]
          Length = 120

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 63/110 (57%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE V ++  D  S Q+   +G+Y+ +I+E GG++    + G R +AY I K  KA+Y
Sbjct: 10  MKHYEVVLMIHPD-QSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHY 68

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V  NI  P  ++ +++  +R ++ +LR L +        P++ ++ ++++
Sbjct: 69  VLFNIECPTESLEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKE 118


>gi|150010520|ref|YP_001305263.1| 30S ribosomal protein S6 [Parabacteroides distasonis ATCC 8503]
 gi|256842193|ref|ZP_05547697.1| ribosomal protein S6 [Parabacteroides sp. D13]
 gi|262384880|ref|ZP_06078012.1| ribosomal protein S6 [Bacteroides sp. 2_1_33B]
 gi|298377640|ref|ZP_06987591.1| ribosomal protein S6 [Bacteroides sp. 3_1_19]
 gi|301308938|ref|ZP_07214883.1| ribosomal protein S6 [Bacteroides sp. 20_3]
 gi|166227359|sp|A6LIX7|RS6_PARD8 RecName: Full=30S ribosomal protein S6
 gi|149938944|gb|ABR45641.1| ribosomal protein S6 [Parabacteroides distasonis ATCC 8503]
 gi|256736077|gb|EEU49407.1| ribosomal protein S6 [Parabacteroides sp. D13]
 gi|262293596|gb|EEY81532.1| ribosomal protein S6 [Bacteroides sp. 2_1_33B]
 gi|298265343|gb|EFI07005.1| ribosomal protein S6 [Bacteroides sp. 3_1_19]
 gi|300832964|gb|EFK63589.1| ribosomal protein S6 [Bacteroides sp. 20_3]
          Length = 118

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 52/116 (44%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++ +L++  G E+      G+R +AY I K    +Y
Sbjct: 1   MNNYETVFILTPVLSDAQMKEAVEKFTNLLKAQGAEIVNEENWGLRKLAYPIDKKTTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
             +   + P+ I  ++   R DE V+R LT   D +        +         + 
Sbjct: 61  QLVEFKADPSVIATLELNFRRDERVIRFLTFRQDKYAAEYAAKRRNLKSSKETVKE 116


>gi|149372599|ref|ZP_01891711.1| 30S ribosomal protein S6 [unidentified eubacterium SCB49]
 gi|149354642|gb|EDM43206.1| 30S ribosomal protein S6 [unidentified eubacterium SCB49]
          Length = 112

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 61/113 (53%), Gaps = 2/113 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  QIK+T+ +Y+ ++   G ++    + G++ ++Y I+  +  +Y
Sbjct: 1   MNQYETVFILNPVLSEDQIKETVKKYEDILVSGGAKMISKEDWGLKKLSYAIQHKKSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
             M    P   I++++   R DE V+R LT+ +D H  +     +R +RD + 
Sbjct: 61  HLMEYQVPGEVINDLELAFRRDERVMRYLTVKLDKH--AIAWAEKRRNRDKQK 111


>gi|34540403|ref|NP_904882.1| 30S ribosomal protein S6 [Porphyromonas gingivalis W83]
 gi|188994503|ref|YP_001928755.1| 30S ribosomal protein S6 [Porphyromonas gingivalis ATCC 33277]
 gi|61216268|sp|Q7MWL3|RS6_PORGI RecName: Full=30S ribosomal protein S6
 gi|226695113|sp|B2RIG3|RS6_PORG3 RecName: Full=30S ribosomal protein S6
 gi|34396716|gb|AAQ65781.1| ribosomal protein S6 [Porphyromonas gingivalis W83]
 gi|188594183|dbj|BAG33158.1| 30S ribosomal protein S6 [Porphyromonas gingivalis ATCC 33277]
          Length = 117

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 53/119 (44%), Gaps = 2/119 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++  L+++ G  +      G+R +AY I+K    +Y
Sbjct: 1   MNNYETVFILTPVLSDAQMKEAVDKFTGLLKQEGAVIVNEENWGLRKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
             +   + P  I +++   R DE V+R LT   D          +R     + +     
Sbjct: 61  QLVEFQANPDVIAKLETNFRRDERVIRFLTFRQDKFAAE--YAAKRRSLKAKTEEVKEA 117


>gi|302346421|ref|YP_003814719.1| ribosomal protein S6 [Prevotella melaninogenica ATCC 25845]
 gi|302150932|gb|ADK97193.1| ribosomal protein S6 [Prevotella melaninogenica ATCC 25845]
          Length = 141

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 54/96 (56%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ +++ L+ +NG E+      G++ +AY I+K    +Y
Sbjct: 28  MNQYETVFILTPVLSDEQMKETVAKFKKLLTDNGAEILNEEAWGLKKLAYNIQKKSSGFY 87

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
             +   + P  I  ++   R DE V+R +T+  D +
Sbjct: 88  ALLEFNAEPTVIDTLETGFRRDEKVIRYITVKQDKY 123


>gi|126654886|ref|ZP_01726420.1| 30S ribosomal protein S6 [Cyanothece sp. CCY0110]
 gi|126623621|gb|EAZ94325.1| 30S ribosomal protein S6 [Cyanothece sp. CCY0110]
          Length = 126

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 32/100 (32%), Positives = 52/100 (52%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE +F+LR D+S +Q+   + +YQ  + EN          G R +AY I+K     YV
Sbjct: 3   RQYEMIFILRPDLSEEQVNQAVTKYQEFLTENNATDLQTKIWGKRRLAYPIQKKVDGIYV 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPT 101
             N  +  + I  ++R MR+ E+VLR LT+ +D      +
Sbjct: 63  QFNYQADGSQIAPLERMMRLGEDVLRYLTIKLDDVSSETS 102


>gi|332293236|ref|YP_004431845.1| ribosomal protein S6 [Krokinobacter diaphorus 4H-3-7-5]
 gi|332171322|gb|AEE20577.1| ribosomal protein S6 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 113

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 62/112 (55%), Gaps = 2/112 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  QIK+T+ +Y+ L++E G ++    + G++ +AY I+  +  +Y
Sbjct: 1   MNHYETVFILNPVLSDDQIKETVKKYEGLLKEKGAKMISKEDWGLKKLAYPIQNKKSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
             +       AI++ +   R DE V+R LT+ +D H  + +   +R ++  +
Sbjct: 61  HLLEFTVDGQAINDYELAFRRDERVMRYLTVTLDKH--AISWAERRREKLKK 110


>gi|167627910|ref|YP_001678410.1| 30S ribosomal protein S6 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|189045469|sp|B0U079|RS6_FRAP2 RecName: Full=30S ribosomal protein S6
 gi|167597911|gb|ABZ87909.1| 30S ribosomal protein S6 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 111

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE V ++  D  S+Q+   + +Y+ +I+E GG++    + G R +AY I K  KA+Y
Sbjct: 1   MKHYEIVLMIHPD-QSEQLDAMLSKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V  N+     ++ +++  ++ ++ VLR L +        P++ ++ ++++
Sbjct: 60  VLFNVECDVESLEKLQENLKYNDAVLRRLVISKKEAVTEPSIMMETNEKE 109


>gi|225011729|ref|ZP_03702167.1| ribosomal protein S6 [Flavobacteria bacterium MS024-2A]
 gi|225004232|gb|EEG42204.1| ribosomal protein S6 [Flavobacteria bacterium MS024-2A]
          Length = 112

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 51/98 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QI++ + ++   I+ N G +      G++ +AY I   +  +Y
Sbjct: 1  MNQYETVFILNPVLSETQIEEAVQKFVEFIKTNQGSMTSQENWGLKKLAYPIENKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQ 98
               A+P  A+  ++ + R DE ++R LT+ +D H  
Sbjct: 61 HLFEYAAPSEAVAALEVEFRRDERIMRYLTVKLDKHSL 98


>gi|241668462|ref|ZP_04756040.1| 30S ribosomal protein S6 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876996|ref|ZP_05249706.1| 30S ribosomal protein S6 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254843017|gb|EET21431.1| 30S ribosomal protein S6 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 111

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE V ++  D  S+Q+   + +Y+ +I+E GG++    + G R +AY I K  KA+Y
Sbjct: 1   MKHYEIVLMIHPD-QSEQLDAMLSKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           V  NI     ++ +++  ++ ++ VLR L +        P++ ++ ++++
Sbjct: 60  VLFNIECDVESLEKLQENLKYNDAVLRRLVISKKEAVTEPSIMMETNEKE 109


>gi|270160071|ref|ZP_06188727.1| ribosomal protein S6 [Legionella longbeachae D-4968]
 gi|289165148|ref|YP_003455286.1| 30S ribosomal protein S6 [Legionella longbeachae NSW150]
 gi|269988410|gb|EEZ94665.1| ribosomal protein S6 [Legionella longbeachae D-4968]
 gi|288858321|emb|CBJ12189.1| 30S ribosomal protein S6 [Legionella longbeachae NSW150]
          Length = 112

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 28/109 (25%), Positives = 58/109 (53%), Gaps = 1/109 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +FL+  D  S+Q+   + +Y+ +I ++ G +    +LG R +AY I    KA+Y
Sbjct: 1   MRHYEIMFLVHPD-QSEQVPAMVERYEGIISKHNGVIHRKEDLGRRQLAYPICDVHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
           + MNI     A+ E+K   + ++ ++R+L         + ++ +++   
Sbjct: 60  ILMNIECSLEALEEIKNAFKYNDAIIRNLITRQKQAITTESVLMKKEKE 108


>gi|86130270|ref|ZP_01048870.1| 30S ribosomal protein S6 [Dokdonia donghaensis MED134]
 gi|85818945|gb|EAQ40104.1| 30S ribosomal protein S6 [Dokdonia donghaensis MED134]
          Length = 113

 Score =  109 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 62/112 (55%), Gaps = 2/112 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  QIK+T+ +Y+ L++E G ++    + G++ +AY I+  +  +Y
Sbjct: 1   MNHYETVFILNPVLSDDQIKETVKKYEGLLKEKGAKMISKEDWGLKKLAYPIQNKKSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
             +       AI++ +   R DE V+R LT+ +D H  + +   +R ++  +
Sbjct: 61  HLLEFTVDGQAINDYELAFRRDERVMRYLTVAMDKH--AISWAERRREKLKK 110


>gi|282877914|ref|ZP_06286723.1| ribosomal protein S6 [Prevotella buccalis ATCC 35310]
 gi|281299915|gb|EFA92275.1| ribosomal protein S6 [Prevotella buccalis ATCC 35310]
          Length = 114

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 59/113 (52%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ +++ L+ +NG E+      GM+ +AY+I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKETVAKFKKLLTDNGAEILNEEAWGMKKLAYQIQKKNSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
                   P  +  ++   R DE V+R +T+ +D +     L  ++   + + 
Sbjct: 61  CLFEFKGEPTLVQTLETGFRRDEKVIRYMTVKLDKYAAEYALKRKQKYANKKE 113


>gi|218264330|ref|ZP_03478187.1| hypothetical protein PRABACTJOHN_03878 [Parabacteroides johnsonii
           DSM 18315]
 gi|218222098|gb|EEC94748.1| hypothetical protein PRABACTJOHN_03878 [Parabacteroides johnsonii
           DSM 18315]
          Length = 117

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 52/116 (44%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++ ++++E G E+      G+R +AY I K    +Y
Sbjct: 1   MNNYETVFILTPVLSDAQMKEAVEKFTNILKEQGAEIVNEENWGLRKLAYPIDKKTTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
             +   + P  I  ++   R DE V+R LT   D +        +         + 
Sbjct: 61  QLVEFKANPETIATLEVNFRRDERVIRFLTFRQDKYAAEYAAKRRSLKSSKETVKE 116


>gi|33519563|ref|NP_878395.1| 30S ribosomal protein S6 [Candidatus Blochmannia floridanus]
 gi|61215720|sp|Q7VQN9|RS6_BLOFL RecName: Full=30S ribosomal protein S6
 gi|33517226|emb|CAD83608.1| 30S ribosomal subunit protein S6 [Candidatus Blochmannia
           floridanus]
          Length = 120

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 56/113 (49%), Gaps = 1/113 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V ++  D S  QI + +  Y  +I  + G++  +   G R +AY I+   KAYY
Sbjct: 1   MRYYEIVLIIHPD-SDNQIDNLVNYYSEIIINSTGKIHRLENWGRRQLAYAIKNLNKAYY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
           + +NI      +  +    R +E +LR L +   +    P+  +++ D +++ 
Sbjct: 60  LLLNIEISKNILDILDNDFRFNEIILRYLIMRTKNIIVDPSAMVKKKDDNNQE 112


>gi|326403704|ref|YP_004283786.1| 30S ribosomal protein S6 [Acidiphilium multivorum AIU301]
 gi|325050566|dbj|BAJ80904.1| 30S ribosomal protein S6 [Acidiphilium multivorum AIU301]
          Length = 158

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 63/102 (61%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE V + R +I+ QQ+        + ++   G V+     G+R +AYRI+KNRK +Y
Sbjct: 1   MPLYECVLIARSEITQQQVDTIADAVTAQVESESGAVKKREYWGLRNLAYRIKKNRKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
           V + + + P  I EM+R++ ++E+VLR +T+ V+  +++P+ 
Sbjct: 61  VLLGLDAEPVTISEMERQLGLNEDVLRFMTVRVEDIDEAPSA 102


>gi|284006635|emb|CBA71896.1| 30S ribosomal protein S6 [Arsenophonus nasoniae]
          Length = 122

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 1/123 (0%)

Query: 9   LLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP 68
           ++  D  S+Q+   I +Y   I E  G++  + + G R +AY I K  KA+YV MN+ +P
Sbjct: 1   MVHPD-QSEQVAGMIERYSGSITEAQGQIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAP 59

Query: 69  PAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNVDRKQHV 128
              I E++   R ++ V+RS+ + V       +  ++  D     D    D         
Sbjct: 60  QEVIDELETNFRFNDAVVRSMIMRVKHAVTEASPMVKAKDDRRSRDLVDEDLEGIEGAED 119

Query: 129 SEE 131
           SEE
Sbjct: 120 SEE 122


>gi|34558168|ref|NP_907983.1| 30S ribosomal protein S6 [Wolinella succinogenes DSM 1740]
 gi|61216265|sp|Q7MQZ8|RS6_WOLSU RecName: Full=30S ribosomal protein S6
 gi|34483887|emb|CAE10883.1| HYPOTHETICAL PROTEIN-Ribosomal protein S6 [Wolinella succinogenes]
          Length = 137

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 71/135 (52%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+++  ++ ++I + I  Y+  I +NGGE+    ++GMR +AY I KN++ YY
Sbjct: 1   MRHYETMFIVKPTLTPEEIVEKINFYKEAIIKNGGEICATQDMGMRNLAYEINKNKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
             +   S P+ + E++R  RI+E++LR + +  +S ++       + + ++     +   
Sbjct: 61  FVVYFKSAPSLVIELERLYRINEDILRFIVIKYESKKEQNAWNTMVDKVNKKAEAPKSAP 120

Query: 119 DRNVDRKQHVSEEKP 133
               +      E  P
Sbjct: 121 VAAPETAPVAPEATP 135


>gi|322381357|ref|ZP_08055360.1| 30S ribosomal protein S6-like protein [Paenibacillus larvae
          subsp. larvae B-3650]
 gi|321154933|gb|EFX47204.1| 30S ribosomal protein S6-like protein [Paenibacillus larvae
          subsp. larvae B-3650]
          Length = 95

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/92 (33%), Positives = 57/92 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R DI   Q++ T+ ++Q +I  NGGE+   + +G R +AY I+K R  +Y
Sbjct: 1  MRKYEIMYIIRPDIEQDQVQATVEKFQGIITNNGGEITKHDVMGKRRLAYEIKKFRDGHY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          V +N  + P  + E+ R M+I + ++R L + 
Sbjct: 61 VLVNFTAEPEVVKELDRVMKISDEIIRYLIVN 92


>gi|318043053|ref|ZP_07975009.1| 30S ribosomal protein S6 [Synechococcus sp. CB0101]
          Length = 122

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/99 (30%), Positives = 54/99 (54%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ L+ E G EV      G R +AY I K+++  YV
Sbjct: 4   PYYETMYILRPDIPEEEVETHVTKYRDLVTEAGAEVLDCQMRGKRRLAYPIAKHKEGIYV 63

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
            +        +  +++ MRI E+V+R LT+  D    +P
Sbjct: 64  QLAHNGDGQQVATLEKAMRISEDVIRYLTVKQDGPLPAP 102


>gi|282880328|ref|ZP_06289042.1| ribosomal protein S6 [Prevotella timonensis CRIS 5C-B1]
 gi|281305830|gb|EFA97876.1| ribosomal protein S6 [Prevotella timonensis CRIS 5C-B1]
          Length = 114

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 59/113 (52%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ ++++L+ +NG E+      G++ +AY+I+K    +Y
Sbjct: 1   MNHYETVFILTPVLSDEQMKETVAKFKTLLTDNGAEILNEEAWGLKKLAYQIQKKNSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
                   P  +  ++   R DE V+R +T+ +D +        ++   + + 
Sbjct: 61  CLFEFKGEPTLVDTLEIGFRRDEKVIRFMTVKLDKYAAQYAEKRKQKYANKKE 113


>gi|86142230|ref|ZP_01060740.1| 30S ribosomal protein S6 [Leeuwenhoekiella blandensis MED217]
 gi|85830982|gb|EAQ49439.1| 30S ribosomal protein S6 [Leeuwenhoekiella blandensis MED217]
          Length = 112

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 27/111 (24%), Positives = 56/111 (50%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+T+ +++  +  NG ++    + G++ +AY I+  +  +Y
Sbjct: 1   MNHYETVFILNPVLSDDQVKETVKKFEDFLVSNGAKMISKEDWGLKKLAYAIQNKKSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
                  P   I   + + R DE V+R LT+ +D +        ++ +++ 
Sbjct: 61  HLFEFTVPGEVIANFELEFRRDERVMRFLTVKLDKYAIEWAEKRRKRNKEK 111


>gi|254457666|ref|ZP_05071094.1| 30S ribosomal protein S6 [Campylobacterales bacterium GD 1]
 gi|207086458|gb|EDZ63742.1| 30S ribosomal protein S6 [Campylobacterales bacterium GD 1]
          Length = 151

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 75/134 (55%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE++ +++   ++++I+ +I   + +I  NGGE+   + +GMR +AY I KN + YY
Sbjct: 1   MRNYENLVIVKPTFTAEEIQSSIKAIEEVITSNGGEIATTDSMGMRKLAYPINKNERGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             +  +  P+AI E++R+ RI+E++LR +T+  D++ +             +     ++ 
Sbjct: 61  HVIYYSIAPSAISEIERRFRINEDLLRFVTIKYDTNREIIAWNKLVEKAQRKAAAPAKEE 120

Query: 121 NVDRKQHVSEEKPL 134
               +  V+EE P+
Sbjct: 121 TPVEEAPVTEEAPV 134


>gi|228469684|ref|ZP_04054652.1| ribosomal protein S6 [Porphyromonas uenonis 60-3]
 gi|228308703|gb|EEK17429.1| ribosomal protein S6 [Porphyromonas uenonis 60-3]
          Length = 115

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 48/97 (49%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  Q+K+ + ++ S +   G  +      G++ +AY I K    +Y
Sbjct: 1  MNHYETVFILTPVLSDAQMKEAVDKFTSHLTSAGATIVNDEHWGLKKLAYPIEKKSTGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97
           F+   + P+ I   +  MR DE VLR +T+  D   
Sbjct: 61 HFIEFDAEPSVIKPFETLMRRDETVLRYITIAQDKFH 97


>gi|289579515|ref|YP_003478142.1| ribosomal protein S6 [Thermoanaerobacter italicus Ab9]
 gi|297545638|ref|YP_003677940.1| 30S ribosomal protein S6 [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
 gi|289529228|gb|ADD03580.1| ribosomal protein S6 [Thermoanaerobacter italicus Ab9]
 gi|296843413|gb|ADH61929.1| ribosomal protein S6 [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
          Length = 95

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/95 (37%), Positives = 56/95 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++L  D+S ++ K  I ++++LI ENGGE+   +E G R +AY I K  + YY
Sbjct: 1  MRSYETMYILSPDLSEEERKGLIERFKNLIVENGGEITNFDEWGKRKLAYPIDKKPEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V MN  S      E++R  +I + VLR L +  D 
Sbjct: 61 VLMNFNSDSKVSQELERVYKITDGVLRYLIIRTDE 95


>gi|21672805|ref|NP_660872.1| 30S ribosomal protein S6 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
 gi|25009193|sp|Q8K918|RS6_BUCAP RecName: Full=30S ribosomal protein S6
 gi|21623455|gb|AAM68083.1| 30S ribosomal protein S6 [Buchnera aphidicola str. Sg (Schizaphis
           graminum)]
          Length = 113

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/104 (28%), Positives = 55/104 (52%), Gaps = 1/104 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F++  D S + +   I +Y+ +I  N G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIIFMIHPDYSEK-VSVIIEKYKKIIHHNSGIIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
           + +NI + P  I  ++   R +  V+R++ + V      P+  I
Sbjct: 60  ILLNIETFPKTISLLETDFRFNNAVIRNIIISVKKAINEPSPVI 103


>gi|325285227|ref|YP_004261017.1| 30S ribosomal protein S6 [Cellulophaga lytica DSM 7489]
 gi|324320681|gb|ADY28146.1| 30S ribosomal protein S6 [Cellulophaga lytica DSM 7489]
          Length = 112

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 52/96 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QI++T+ +++  + + G ++      G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSDVQIEETVKKFEDFLIKKGSKMVAKENWGLKKLAYPIQHKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
                +P   I+  + + R DE V+R LT+ +D H
Sbjct: 61 HLFEFTAPGDVINGYELEFRRDERVMRFLTVKLDKH 96


>gi|154491709|ref|ZP_02031335.1| hypothetical protein PARMER_01320 [Parabacteroides merdae ATCC
           43184]
 gi|154087950|gb|EDN86995.1| hypothetical protein PARMER_01320 [Parabacteroides merdae ATCC
           43184]
          Length = 117

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/116 (25%), Positives = 52/116 (44%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++ +L++E G E+      G+R +AY I K    +Y
Sbjct: 1   MNNYETVFILTPVLSDAQMKEAVEKFTNLLKEQGAEIVNEENWGLRKLAYPIDKKTTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
             +   + P  I  ++   R DE V+R LT   D +        +         + 
Sbjct: 61  QLVEFKANPETIATLEINFRRDERVIRFLTFRQDKYAAEYAAKRRSLKSSKETVKE 116


>gi|157414312|ref|YP_001485178.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9215]
 gi|157388887|gb|ABV51592.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9215]
          Length = 157

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 69/132 (52%), Gaps = 6/132 (4%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
            YE +++LR DI+  ++ + I +Y  L++E GG +      G R +AY+I K+R+  YV 
Sbjct: 11  YYETMYILRPDIAEDEVTNHIDKYNKLLEEFGGSILDSQMRGKRRLAYQIAKHREGIYVQ 70

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNV 122
           ++       I ++++ MR+ E+V+R +T+  +    +P  + +   + D        +N 
Sbjct: 71  LSHQGDGQHIFKIEKAMRLSEDVIRYMTVKQEGPLPTPRPSTKSSTQADDK------KNQ 124

Query: 123 DRKQHVSEEKPL 134
           + K     E+P+
Sbjct: 125 ETKVESKGEQPV 136


>gi|254430452|ref|ZP_05044155.1| ribosomal protein S6 [Cyanobium sp. PCC 7001]
 gi|197624905|gb|EDY37464.1| ribosomal protein S6 [Cyanobium sp. PCC 7001]
          Length = 119

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 56/99 (56%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  I +Y+ L+ E GGEV      G R +AY I K+R+  YV
Sbjct: 4   PYYETMYILRPDIPEEEVESHITKYRDLVIEAGGEVLDCQMRGKRRLAYSIDKHREGIYV 63

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
            +N       +  ++R MR+ E+V+R LT+  D    +P
Sbjct: 64  QLNHNGDGQQVAPLERAMRLSEDVIRYLTVKQDGPMPAP 102


>gi|328954271|ref|YP_004371605.1| 30S ribosomal protein S6 [Desulfobacca acetoxidans DSM 11109]
 gi|328454595|gb|AEB10424.1| 30S ribosomal protein S6 [Desulfobacca acetoxidans DSM 11109]
          Length = 153

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 67/145 (46%), Gaps = 10/145 (6%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE +F++  D+   +    I ++  ++    G    + + G R +AY+I+K  + YY
Sbjct: 1   MNRYETIFIINPDLGDDETHSVIDKFTGIVGAQNGVQLKLEDWGRRRLAYKIKKFHQGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR----------D 110
           V ++ A  PA + E +R ++ID+ +LR L++    +     L  +   +           
Sbjct: 61  VLLDFAGVPAGLAEFERNLKIDDRILRFLSVKTGENVDVEALKAEIAAKVKPQAEAGPTP 120

Query: 111 DRNDRFPRDRNVDRKQHVSEEKPLS 135
           +  +  P   +V     V+EE P++
Sbjct: 121 EVPEEAPAQESVAASPAVAEEIPVA 145


>gi|313902807|ref|ZP_07836204.1| SSU ribosomal protein S6P [Thermaerobacter subterraneus DSM
          13965]
 gi|313466927|gb|EFR62444.1| SSU ribosomal protein S6P [Thermaerobacter subterraneus DSM
          13965]
          Length = 97

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 52/96 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++ R D+  +  K  + + Q +I + GG V  V+  G R +AY I   R+ +Y
Sbjct: 1  MRAYELMYITRPDLDEEAEKALLDRLQKIITDGGGTVEQVDVWGRRRLAYEIAGYREGHY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +    P    HE++R +RI ++++R + +L +  
Sbjct: 61 TVVQFQGPAGVTHELERVIRITDDIIRHIIVLREKV 96


>gi|326391892|ref|ZP_08213402.1| ribosomal protein S6 [Thermoanaerobacter ethanolicus JW 200]
 gi|325992054|gb|EGD50536.1| ribosomal protein S6 [Thermoanaerobacter ethanolicus JW 200]
          Length = 95

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/95 (37%), Positives = 56/95 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++L  D+S ++ K  I ++++LI ENGGE+   +E G R +AY I K  + YY
Sbjct: 1  MRSYETMYILSPDLSEEERKGLIERFKNLIIENGGEITNFDEWGKRKLAYPIDKKPEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V MN  S      E++R  +I + VLR L +  D 
Sbjct: 61 VLMNFNSNSKVSQELERVYKITDGVLRYLIIRTDE 95


>gi|73667309|ref|YP_303325.1| 30S ribosomal protein S6 [Ehrlichia canis str. Jake]
 gi|91207915|sp|Q3YRC8|RS6_EHRCJ RecName: Full=30S ribosomal protein S6
 gi|72394450|gb|AAZ68727.1| SSU ribosomal protein S6P [Ehrlichia canis str. Jake]
          Length = 109

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 60/108 (55%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE  F+ +Q ++  +++  +    SL+ +NG E+      G+   AY I K  K +Y
Sbjct: 1   MPLYEFTFIAQQGLTQYELEGLVKGLSSLLTKNGAELLKYEYWGLLDFAYTIDKMNKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
             + I + P+++ E KRK+R++E+VLR L L  D   +  +L IQ + 
Sbjct: 61  CMIYIKATPSSMDEFKRKVRLNEDVLRFLCLKKDKLPKGDSLMIQANQ 108


>gi|89890854|ref|ZP_01202363.1| 30S ribosomal protein S6 [Flavobacteria bacterium BBFL7]
 gi|89516999|gb|EAS19657.1| 30S ribosomal protein S6 [Flavobacteria bacterium BBFL7]
          Length = 114

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 56/116 (48%), Gaps = 2/116 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++++ +   G ++    + G++ +AY I   +  +Y
Sbjct: 1   MNQYETVFILNPVLSDDQVKEAVKKFENFLTTRGAKMVAKEDWGLKKLAYTIENKKSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
                  P   I++ + + R DE V+R LT+ +D +        +R DR     + 
Sbjct: 61  TLFQFEVPGEVINDFEVEFRRDERVMRYLTVKLDKYAIE--WAAKRRDRMSNKAKA 114


>gi|190575041|ref|YP_001972886.1| 30S ribosomal protein S6 [Stenotrophomonas maltophilia K279a]
 gi|190012963|emb|CAQ46595.1| 30s ribosomal protein S6 [Stenotrophomonas maltophilia K279a]
          Length = 136

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 56/106 (52%), Gaps = 1/106 (0%)

Query: 9   LLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP 68
           ++  D  S+Q+   I +Y+SL++   G +  + + G R +AY I+   KA+YV MNI + 
Sbjct: 1   MVHPD-QSEQVPAMIERYKSLVENGNGTIHRLEDWGRRQLAYPIQNLVKAHYVLMNIEAD 59

Query: 69  PAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
            A ++E+    R ++ VLR+L +  D  +   +L ++  D      
Sbjct: 60  QAVLNELTESFRFNDAVLRNLVIKRDEADTEQSLIMKSKDEKGDKP 105


>gi|302343162|ref|YP_003807691.1| ribosomal protein S6 [Desulfarculus baarsii DSM 2075]
 gi|301639775|gb|ADK85097.1| ribosomal protein S6 [Desulfarculus baarsii DSM 2075]
          Length = 141

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 57/93 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F++  ++   +    + +++ +++++G E+  V+  G R +AY+++K  K ++
Sbjct: 1  MRHYETIFIIDPELPEDECSAVVDKFKGILEKDGSEMVKVDLWGRRRLAYQVKKYTKGFF 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLV 93
          V     + PA + E++R  +IDE V+R L++ +
Sbjct: 61 VLFEYGAKPAVVDELERNFKIDERVIRFLSVKL 93


>gi|327403001|ref|YP_004343839.1| 30S ribosomal protein S6P [Fluviicola taffensis DSM 16823]
 gi|327318509|gb|AEA43001.1| SSU ribosomal protein S6P [Fluviicola taffensis DSM 16823]
          Length = 115

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 50/95 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  Q K+ + +Y+S +   GG++      G++ +AY I+K    +Y
Sbjct: 1  MNSYETVFILTPVLSEDQAKEAVQKYESELAAMGGKLTHSESWGLKKLAYPIQKKSTGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
                   + I +++  M+ DE ++R LT+ +D 
Sbjct: 61 FLFQFDGEGSVIADLELIMKRDERIMRFLTVKMDK 95


>gi|254510771|ref|ZP_05122838.1| ribosomal protein S6 [Rhodobacteraceae bacterium KLH11]
 gi|221534482|gb|EEE37470.1| ribosomal protein S6 [Rhodobacteraceae bacterium KLH11]
          Length = 110

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 65/99 (65%)

Query: 8   FLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIAS 67
            + RQD+S+ Q +  +  + +++ +NGG V      G++T+AY+I KNRK +Y F+   +
Sbjct: 1   MIARQDLSNAQAESLVEHFGTVLADNGGNVVDSEYWGVKTMAYKINKNRKGHYSFLKTDA 60

Query: 68  PPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           P  A+ EM+R MR+ ++V+R LT+ VD H + P++ +Q+
Sbjct: 61  PAGAVQEMERLMRLHDDVMRVLTIKVDEHAEGPSVQMQK 99


>gi|307265459|ref|ZP_07547015.1| ribosomal protein S6 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919573|gb|EFN49791.1| ribosomal protein S6 [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 95

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/95 (37%), Positives = 56/95 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++L  D+S ++ K  I ++++LI ENGGE+   +E G R +AY I K  + YY
Sbjct: 1  MRSYETMYILSPDLSEEERKGLIERFKNLIIENGGEITNFDEWGKRKLAYPIDKKLEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V MN  S      E++R  +I + VLR L +  D 
Sbjct: 61 VLMNFNSNSKVSQELERVYKITDGVLRYLIIRTDE 95


>gi|300777790|ref|ZP_07087648.1| 30S ribosomal protein S6 [Chryseobacterium gleum ATCC 35910]
 gi|300503300|gb|EFK34440.1| 30S ribosomal protein S6 [Chryseobacterium gleum ATCC 35910]
          Length = 113

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 56/113 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+++ + +++ LI+E   E+      G++ +AY I+  +  +Y
Sbjct: 1   MNNYETVFILTPVLSDAQVEEAVKKFEDLIKEKNCEIVAKENWGLKKLAYPIQLKKNGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
             +      + + +++   + DE V+R LT  +D H     +T +   +  + 
Sbjct: 61  TLIEFKGEGSVVADLELAFKRDERVIRYLTTKLDKHAVEYAVTRRAKVKAAKA 113


>gi|57239414|ref|YP_180550.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden]
 gi|58579386|ref|YP_197598.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden]
 gi|58617441|ref|YP_196640.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Gardel]
 gi|75356738|sp|Q5FG27|RS6_EHRRG RecName: Full=30S ribosomal protein S6
 gi|81352829|sp|Q5HAJ4|RS6_EHRRW RecName: Full=30S ribosomal protein S6
 gi|57161493|emb|CAH58419.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden]
 gi|58417053|emb|CAI28166.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Gardel]
 gi|58418012|emb|CAI27216.1| 30S ribosomal protein S6 [Ehrlichia ruminantium str. Welgevonden]
          Length = 109

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 57/108 (52%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE  F+ +Q ++  +++  +    SL+ +NG E+      G+   AY I K  K +Y
Sbjct: 1   MPLYEFTFIAQQGLTQYELEGLVKGLSSLLTKNGAELLKYEYWGLLDFAYAIDKMNKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
             M I S   ++ E KRK+R++E+VLR L L  D   +  +L +Q   
Sbjct: 61  CMMYIRSSSTSMDEFKRKVRLNEDVLRFLCLKRDKLPEGDSLMVQASQ 108


>gi|313202817|ref|YP_004041474.1| SSU ribosomal protein s6p [Paludibacter propionicigenes WB4]
 gi|312442133|gb|ADQ78489.1| SSU ribosomal protein S6P [Paludibacter propionicigenes WB4]
          Length = 116

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 54/114 (47%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE VF+L   +S  Q+K+ + ++++++ ENG  +      G+R + Y I+K    +Y 
Sbjct: 3   NHYETVFILTPVLSDVQMKEAVEKFKTILTENGATITNEENWGLRKLQYPIQKKSTGFYS 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
            +   + P  I  ++ + R DE VLR L+  +D +        +     +  + 
Sbjct: 63  LLQFDAEPTVIATLETQFRRDERVLRFLSFRLDKYAFEYAEKRKNVKSKEVKEN 116


>gi|68171813|ref|ZP_00545151.1| Ribosomal protein S6 [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658444|ref|YP_507129.1| 30S ribosomal protein S6 [Ehrlichia chaffeensis str. Arkansas]
 gi|123493682|sp|Q2GHF4|RS6_EHRCR RecName: Full=30S ribosomal protein S6
 gi|67998762|gb|EAM85476.1| Ribosomal protein S6 [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599901|gb|ABD45370.1| ribosomal protein S6 [Ehrlichia chaffeensis str. Arkansas]
          Length = 109

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 59/108 (54%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYE  F+ +Q ++  +++  +    SL+ +NG E+      G+   AY I K  K +Y
Sbjct: 1   MPLYEFTFIAQQGLTQYELEGLVKGLSSLLTKNGAELLKYEYWGLLDFAYTIDKMNKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
             + I + P+++ E KRK+R++E++LR L L  D   +  +L IQ   
Sbjct: 61  CMIYIKATPSSMDEFKRKVRLNEDILRFLCLKKDKLPKGDSLMIQASQ 108


>gi|189463979|ref|ZP_03012764.1| hypothetical protein BACINT_00314 [Bacteroides intestinalis DSM
           17393]
 gi|224536024|ref|ZP_03676563.1| hypothetical protein BACCELL_00888 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|189438552|gb|EDV07537.1| hypothetical protein BACINT_00314 [Bacteroides intestinalis DSM
           17393]
 gi|224522349|gb|EEF91454.1| hypothetical protein BACCELL_00888 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 114

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 53/114 (46%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++   G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILTAEGAEIVNEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT   D +        +      + D
Sbjct: 61  QLIEFNADPTVIDKLELNFRRDERVIRFLTFKQDKYAAEYAAKRRSVKSTKKED 114


>gi|254454531|ref|ZP_05067968.1| ribosomal protein S6 [Octadecabacter antarcticus 238]
 gi|198268937|gb|EDY93207.1| ribosomal protein S6 [Octadecabacter antarcticus 238]
          Length = 111

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 70/100 (70%)

Query: 7   VFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIA 66
           +F+ RQD+S+ Q +  I  + +++ +N G+V +    G++T+AY+I KNRK +Y F+   
Sbjct: 1   MFIARQDLSNTQAEALIEHFSTVLSDNDGKVVMSEYWGVKTMAYKINKNRKGHYAFLRSD 60

Query: 67  SPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           +P  A+ EM+R MR+ E+V+R LT+ VD+HE+ P++ +Q+
Sbjct: 61  APAPAVQEMERLMRLHEDVMRILTIKVDAHEEGPSVQMQK 100


>gi|153808731|ref|ZP_01961399.1| hypothetical protein BACCAC_03030 [Bacteroides caccae ATCC 43185]
 gi|255691415|ref|ZP_05415090.1| ribosomal protein S6 [Bacteroides finegoldii DSM 17565]
 gi|149128557|gb|EDM19775.1| hypothetical protein BACCAC_03030 [Bacteroides caccae ATCC 43185]
 gi|260623061|gb|EEX45932.1| ribosomal protein S6 [Bacteroides finegoldii DSM 17565]
          Length = 114

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++Q  G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILQAEGAEIINEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT  +D +        +    + + D
Sbjct: 61  QLIEFNADPTVIDKLEVNFRRDERVIRFLTFKMDKYAAEYAAKRRSVKSNKKED 114


>gi|302036160|ref|YP_003796482.1| 30S ribosomal protein S6 [Candidatus Nitrospira defluvii]
 gi|300604224|emb|CBK40556.1| 30S ribosomal protein S6 [Candidatus Nitrospira defluvii]
          Length = 117

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 27/100 (27%), Positives = 56/100 (56%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+LYE +F++R  +S ++    I + +  + +NG  +      G + +AY I++ RK  Y
Sbjct: 1   MELYESLFIIRPTLSDEETTALIEKMKGTVTKNGASLERAENWGRKKLAYEIKRERKGTY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
           V+     P A I E++R  R+++++++ LT+ ++     P
Sbjct: 61  VYFYFKGPGAVIAELERAYRLEDSIIKFLTVKLEQEPAPP 100


>gi|258512888|ref|YP_003186322.1| 30S ribosomal protein S6 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
 gi|257479614|gb|ACV59933.1| ribosomal protein S6 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
          Length = 95

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/95 (34%), Positives = 58/95 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++   + ++Q  + I +YQS++ + GG++  + E+G R +AY I  +R+ YY
Sbjct: 1  MRQYETMYIVNPSLEAEQTAEVIQRYQSIVTDKGGQIDELQEIGKRRLAYEIDGHREGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V M          E++R MRID+NV+R LT+ V  
Sbjct: 61 VLMKFTCDTETPKELERLMRIDDNVIRYLTVRVGE 95


>gi|312131695|ref|YP_003999035.1| ssu ribosomal protein s6p [Leadbetterella byssophila DSM 17132]
 gi|311908241|gb|ADQ18682.1| SSU ribosomal protein S6P [Leadbetterella byssophila DSM 17132]
          Length = 120

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 6/123 (4%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE VF+L   +S  QIKD + +++S++ +NG E+      G++ +AY I+     YY 
Sbjct: 4   NQYETVFILTPVLSDAQIKDAVDKFKSVLTDNGAEIINEEAWGLKKLAYPIQHKTTGYYQ 63

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            +   + P  I  ++ + + DE VLR LT  +D H    +      +R  +      +  
Sbjct: 64  LVEFKADPKLIATLETEYKRDERVLRFLTTKLDKHAIEYS------ERRRKGGFKKAETT 117

Query: 122 VDR 124
           V  
Sbjct: 118 VAE 120


>gi|29347573|ref|NP_811076.1| 30S ribosomal protein S6 [Bacteroides thetaiotaomicron VPI-5482]
 gi|253572033|ref|ZP_04849437.1| 30S ribosomal protein S6 [Bacteroides sp. 1_1_6]
 gi|298383734|ref|ZP_06993295.1| ribosomal protein S6 [Bacteroides sp. 1_1_14]
 gi|32171532|sp|Q8A5S5|RS6_BACTN RecName: Full=30S ribosomal protein S6
 gi|29339474|gb|AAO77270.1| 30S ribosomal protein S6 [Bacteroides thetaiotaomicron VPI-5482]
 gi|251838213|gb|EES66300.1| 30S ribosomal protein S6 [Bacteroides sp. 1_1_6]
 gi|298263338|gb|EFI06201.1| ribosomal protein S6 [Bacteroides sp. 1_1_14]
          Length = 114

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++Q  G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILQAEGAEIINEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT  +D +        +    + + D
Sbjct: 61  QLVEFNADPTVIDKLELNFRRDERVIRFLTFKMDKYAAEYAAKRRSVKSNKKED 114


>gi|313205959|ref|YP_004045136.1| SSU ribosomal protein s6p [Riemerella anatipestifer DSM 15868]
 gi|312445275|gb|ADQ81630.1| SSU ribosomal protein S6P [Riemerella anatipestifer DSM 15868]
 gi|315022272|gb|EFT35300.1| SSU ribosomal protein S6p [Riemerella anatipestifer RA-YM]
 gi|325336602|gb|ADZ12876.1| Ribosomal protein S6 [Riemerella anatipestifer RA-GD]
          Length = 113

 Score =  108 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 53/113 (46%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+++ + +++ L+++   E+      G++ +AY I+  +  +Y
Sbjct: 1   MNHYETVFILTPVLSDAQVEEAVKKFEDLLKDQNCEIVAKENWGLKKLAYPIQLKKNGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
             +        + +++   + DE V+R LT  +D H        +   +  + 
Sbjct: 61  TLIEFKGEGTIVADLELAFKRDERVIRYLTTKLDKHAVEYAEKRRAKLKSKKA 113


>gi|295133965|ref|YP_003584641.1| 30S ribosomal protein S6 [Zunongwangia profunda SM-A87]
 gi|294981980|gb|ADF52445.1| 30S ribosomal protein S6 [Zunongwangia profunda SM-A87]
          Length = 112

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/96 (31%), Positives = 52/96 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S +QIK+T+ +Y+  +   G E+      G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSDEQIKETVKKYEEFLVSKGAEMVSKENWGLKKLAYPIQHKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
                +P  AI  ++   R DE ++R LT+ +D H
Sbjct: 61 HLFEFKAPGEAIEPLELAFRRDERMMRYLTVKLDKH 96


>gi|332520812|ref|ZP_08397272.1| ribosomal protein S6 [Lacinutrix algicola 5H-3-7-4]
 gi|332043342|gb|EGI79538.1| ribosomal protein S6 [Lacinutrix algicola 5H-3-7-4]
          Length = 112

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 50/96 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QIK+T+ +Y+  + E G ++    + G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSETQIKETVKKYEDFLTERGAKMVAKEDWGLKKLAYPIQNKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
                     I  ++ + R DE  +R LT+ +D H
Sbjct: 61 HLFEYTIDGEHITPLEVEFRRDERFMRYLTVALDKH 96


>gi|163788026|ref|ZP_02182472.1| 30S ribosomal protein S6 [Flavobacteriales bacterium ALC-1]
 gi|159876346|gb|EDP70404.1| 30S ribosomal protein S6 [Flavobacteriales bacterium ALC-1]
          Length = 116

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 50/96 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QIK+T+ +Y+  +   G ++    + G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSEDQIKETVKKYEDFLVSKGAKMIAKEDWGLKKLAYPIQNKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
                    AI  ++ + R DE  +R LT+ +D H
Sbjct: 61 HLFEYTVAGEAIEPLEVEFRRDERFMRYLTVKLDKH 96


>gi|78780184|ref|YP_398296.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9312]
 gi|91207929|sp|Q317T5|RS6_PROM9 RecName: Full=30S ribosomal protein S6
 gi|78713683|gb|ABB50860.1| SSU ribosomal protein S6P [Prochlorococcus marinus str. MIT 9312]
          Length = 152

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 70/133 (52%), Gaps = 6/133 (4%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
            YE +++LR DI+  ++ + I +Y  L++E GG +      G R +AY+I K+R+  YV 
Sbjct: 6   YYETMYILRPDIAEDEVTNHIDKYNKLLEEFGGTILDSQMRGKRRLAYQIAKHREGIYVQ 65

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNV 122
           ++       I ++++ MRI E+V+R +T+  +    +P  + +   + +  D      N 
Sbjct: 66  LSHQGDGQHIFKIEKAMRISEDVIRYMTVKQEGPLPTPKPSNKSSTQSENKD------NP 119

Query: 123 DRKQHVSEEKPLS 135
           + K    EE+ ++
Sbjct: 120 ETKVESKEEQSVT 132


>gi|260174163|ref|ZP_05760575.1| 30S ribosomal protein S6 [Bacteroides sp. D2]
 gi|299147872|ref|ZP_07040935.1| ribosomal protein S6 [Bacteroides sp. 3_1_23]
 gi|315922428|ref|ZP_07918668.1| 30S ribosomal protein S6 [Bacteroides sp. D2]
 gi|298514055|gb|EFI37941.1| ribosomal protein S6 [Bacteroides sp. 3_1_23]
 gi|313696303|gb|EFS33138.1| 30S ribosomal protein S6 [Bacteroides sp. D2]
          Length = 114

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++Q  G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGVLQAEGAEIINEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT  +D +        +    + + D
Sbjct: 61  QLIEFNADPTVIDKLELNFRRDERVIRFLTFKMDKYAAEYAAKRRSVKSNKKED 114


>gi|88858914|ref|ZP_01133555.1| 30S ribosomal protein S6 [Pseudoalteromonas tunicata D2]
 gi|88819140|gb|EAR28954.1| 30S ribosomal protein S6 [Pseudoalteromonas tunicata D2]
          Length = 105

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 9   LLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP 68
           ++  D  S+Q+   I +Y   I E GG +  + + G R +AY I K  KA+YV MN+ + 
Sbjct: 1   MVHPD-QSEQVPGMIERYTGSITEAGGTIHRLEDWGRRQLAYPIDKLHKAHYVLMNVEAT 59

Query: 69  PAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
              I+E++   R ++ VLR+L +   S     +  +
Sbjct: 60  SEVINELETSFRYNDAVLRNLVMRTKSAVTEASPLV 95


>gi|305667288|ref|YP_003863575.1| 30S ribosomal protein S6 [Maribacter sp. HTCC2170]
 gi|88709335|gb|EAR01568.1| 30S ribosomal protein S6 [Maribacter sp. HTCC2170]
          Length = 112

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 52/99 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QI++T+ +++  + +NG ++      G++ +AY I+  +  +Y
Sbjct: 1  MNNYETVFILNPVLSDVQIEETVKKFEDFLIKNGAKMVAKENWGLKKLAYAIQNKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQS 99
                 P   I   +++ R DE V+R LT+ +D H   
Sbjct: 61 HLFEFTGPGEIITPYEQEFRRDERVMRFLTVKLDKHAIE 99


>gi|218291073|ref|ZP_03495096.1| ribosomal protein S6 [Alicyclobacillus acidocaldarius LAA1]
 gi|218238958|gb|EED06165.1| ribosomal protein S6 [Alicyclobacillus acidocaldarius LAA1]
          Length = 95

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 32/95 (33%), Positives = 58/95 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++   + ++Q  + I +YQ+++ + GG++  + E+G R +AY I  +R+ YY
Sbjct: 1  MRQYETMYIVNPSLEAEQTAEVIQRYQAIVTDKGGQIDELQEIGKRRLAYEIDGHREGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V M          E++R MRID+NV+R LT+ V  
Sbjct: 61 VLMKFTCDTETPKEIERLMRIDDNVIRYLTVRVGE 95


>gi|87123366|ref|ZP_01079217.1| ribosomal protein S6 [Synechococcus sp. RS9917]
 gi|86169086|gb|EAQ70342.1| ribosomal protein S6 [Synechococcus sp. RS9917]
          Length = 122

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 56/102 (54%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ ++ E G EV      G R +AY I K+++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVESHLTKYRDILAEAGAEVLDNQMRGKRRLAYPIAKHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  +++ MR+ E+V+R LT+  D    +P + 
Sbjct: 65  QLSHNGDGQQVAVLEKAMRLSEDVIRYLTVKQDGPLPAPRVM 106


>gi|172037638|ref|YP_001804139.1| 30S ribosomal protein S6 [Cyanothece sp. ATCC 51142]
 gi|254765233|sp|B1WU11|RS6_CYAA5 RecName: Full=30S ribosomal protein S6
 gi|171699092|gb|ACB52073.1| 30s ribosomal protein S6 [Cyanothece sp. ATCC 51142]
          Length = 119

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 50/94 (53%)

Query: 3  LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
           YE +F+LR D+S +Q+   + +YQ  + EN          G R +AY I+K     YV 
Sbjct: 4  HYEMIFILRPDLSEEQVNQAVAKYQEFLTENNATDLQTKIWGKRRLAYPIQKKVDGIYVQ 63

Query: 63 MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
           N  +  + +  ++R MR+ E+V+R LT+ +D  
Sbjct: 64 FNYQADGSQVAPLERMMRLGEDVMRYLTIKLDHV 97


>gi|117925751|ref|YP_866368.1| 30S ribosomal protein S6P [Magnetococcus sp. MC-1]
 gi|167011247|sp|A0LAG9|RS6_MAGSM RecName: Full=30S ribosomal protein S6
 gi|117609507|gb|ABK44962.1| SSU ribosomal protein S6P [Magnetococcus sp. MC-1]
          Length = 144

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 57/104 (54%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE +++LR D++++Q++    ++   +   GG+V      G R +AY ++KN K +Y
Sbjct: 1   MAFYESIYILRADLTTEQVELVNKRFSDNVAATGGKVVRTELWGRRQLAYLVKKNVKGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
           VF  +    + +H+++ K+ IDE+VL+   + ++      +   
Sbjct: 61  VFHILEGEGSMVHDLEAKLGIDEDVLKFQHVRIEDVSDKASPLA 104


>gi|160885185|ref|ZP_02066188.1| hypothetical protein BACOVA_03183 [Bacteroides ovatus ATCC 8483]
 gi|237714854|ref|ZP_04545335.1| 30S ribosomal protein S6 [Bacteroides sp. D1]
 gi|237719992|ref|ZP_04550473.1| 30S ribosomal protein S6 [Bacteroides sp. 2_2_4]
 gi|262406875|ref|ZP_06083424.1| ribosomal protein S6 [Bacteroides sp. 2_1_22]
 gi|293368835|ref|ZP_06615439.1| ribosomal protein S6 [Bacteroides ovatus SD CMC 3f]
 gi|294647157|ref|ZP_06724756.1| ribosomal protein S6 [Bacteroides ovatus SD CC 2a]
 gi|294809232|ref|ZP_06767948.1| ribosomal protein S6 [Bacteroides xylanisolvens SD CC 1b]
 gi|298483613|ref|ZP_07001788.1| ribosomal protein S6 [Bacteroides sp. D22]
 gi|156109535|gb|EDO11280.1| hypothetical protein BACOVA_03183 [Bacteroides ovatus ATCC 8483]
 gi|229445179|gb|EEO50970.1| 30S ribosomal protein S6 [Bacteroides sp. D1]
 gi|229450544|gb|EEO56335.1| 30S ribosomal protein S6 [Bacteroides sp. 2_2_4]
 gi|262355578|gb|EEZ04669.1| ribosomal protein S6 [Bacteroides sp. 2_1_22]
 gi|292636140|gb|EFF54628.1| ribosomal protein S6 [Bacteroides ovatus SD CMC 3f]
 gi|292637444|gb|EFF55863.1| ribosomal protein S6 [Bacteroides ovatus SD CC 2a]
 gi|294443626|gb|EFG12377.1| ribosomal protein S6 [Bacteroides xylanisolvens SD CC 1b]
 gi|295084749|emb|CBK66272.1| SSU ribosomal protein S6P [Bacteroides xylanisolvens XB1A]
 gi|298270183|gb|EFI11769.1| ribosomal protein S6 [Bacteroides sp. D22]
          Length = 114

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++Q  G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGVLQAEGAEIINEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT  +D +        +    + + D
Sbjct: 61  QLIEFNADPTVIDKLEINFRRDERVIRFLTFKMDKYAAEYAAKRRSVKSNKKED 114


>gi|53715146|ref|YP_101138.1| 30S ribosomal protein S6 [Bacteroides fragilis YCH46]
 gi|60683082|ref|YP_213226.1| 30S ribosomal protein S6 [Bacteroides fragilis NCTC 9343]
 gi|253566276|ref|ZP_04843730.1| 30S ribosomal protein S6 [Bacteroides sp. 3_2_5]
 gi|255011272|ref|ZP_05283398.1| 30S ribosomal protein S6 [Bacteroides fragilis 3_1_12]
 gi|265766976|ref|ZP_06094805.1| ribosomal protein S6 [Bacteroides sp. 2_1_16]
 gi|313149084|ref|ZP_07811277.1| 30S ribosomal protein S6 [Bacteroides fragilis 3_1_12]
 gi|61215472|sp|Q64PH7|RS6_BACFR RecName: Full=30S ribosomal protein S6
 gi|81313864|sp|Q5L9B5|RS6_BACFN RecName: Full=30S ribosomal protein S6
 gi|52218011|dbj|BAD50604.1| 30S ribosomal protein S6 [Bacteroides fragilis YCH46]
 gi|60494516|emb|CAH09313.1| putative 30S ribosomal protein S6 [Bacteroides fragilis NCTC 9343]
 gi|251945380|gb|EES85818.1| 30S ribosomal protein S6 [Bacteroides sp. 3_2_5]
 gi|263253353|gb|EEZ24829.1| ribosomal protein S6 [Bacteroides sp. 2_1_16]
 gi|301164597|emb|CBW24156.1| putative 30S ribosomal protein S6 [Bacteroides fragilis 638R]
 gi|313137851|gb|EFR55211.1| 30S ribosomal protein S6 [Bacteroides fragilis 3_1_12]
          Length = 114

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 56/114 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++Q  G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILQAEGAEIINEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT  +D +        +    + + D
Sbjct: 61  QLIEFNAEPTVIDKLELNFRRDERVIRFLTFRMDKYAAEYAAKRRSVKSNKKED 114


>gi|87301535|ref|ZP_01084375.1| 30S ribosomal protein S6 [Synechococcus sp. WH 5701]
 gi|87283752|gb|EAQ75706.1| 30S ribosomal protein S6 [Synechococcus sp. WH 5701]
          Length = 117

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 32/99 (32%), Positives = 55/99 (55%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ L+ E G EV      G R +AY I K+R+  YV
Sbjct: 5   PYYETMYILRPDIPEEEVETHVAKYRDLLTEAGAEVLDCQMRGKRRLAYTIAKHREGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
            +N       +  ++R MR+ E+V+R LT+  D    +P
Sbjct: 65  QLNHDGDGQQVALLERAMRLSEDVIRYLTVKQDGPLPTP 103


>gi|167038654|ref|YP_001666232.1| 30S ribosomal protein S6 [Thermoanaerobacter pseudethanolicus
          ATCC 33223]
 gi|167041004|ref|YP_001663989.1| 30S ribosomal protein S6 [Thermoanaerobacter sp. X514]
 gi|256751476|ref|ZP_05492354.1| ribosomal protein S6 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913785|ref|ZP_07131102.1| ribosomal protein S6 [Thermoanaerobacter sp. X561]
 gi|307725529|ref|YP_003905280.1| 30S ribosomal protein S6 [Thermoanaerobacter sp. X513]
 gi|320117046|ref|YP_004187205.1| 30S ribosomal protein S6 [Thermoanaerobacter brockii subsp.
          finnii Ako-1]
 gi|226695294|sp|B0K8G4|RS6_THEP3 RecName: Full=30S ribosomal protein S6
 gi|226695295|sp|B0K5L9|RS6_THEPX RecName: Full=30S ribosomal protein S6
 gi|166855244|gb|ABY93653.1| ribosomal protein S6 [Thermoanaerobacter sp. X514]
 gi|166857488|gb|ABY95896.1| ribosomal protein S6 [Thermoanaerobacter pseudethanolicus ATCC
          33223]
 gi|256749695|gb|EEU62721.1| ribosomal protein S6 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300890470|gb|EFK85615.1| ribosomal protein S6 [Thermoanaerobacter sp. X561]
 gi|307582590|gb|ADN55989.1| ribosomal protein S6 [Thermoanaerobacter sp. X513]
 gi|319930137|gb|ADV80822.1| ribosomal protein S6 [Thermoanaerobacter brockii subsp. finnii
          Ako-1]
          Length = 95

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 36/95 (37%), Positives = 56/95 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++L  D+S ++ K  I ++++LI ENGGE+   +E G R +AY I K  + YY
Sbjct: 1  MRSYETMYILSPDLSEEERKGLIERFKNLIIENGGEITNFDEWGKRKLAYLIDKKPEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V MN  S      E++R  +I + VLR L +  D 
Sbjct: 61 VLMNFNSDSKVSQELERVYKITDGVLRYLIIRTDE 95


>gi|148243619|ref|YP_001228776.1| 30S ribosomal protein S6 [Synechococcus sp. RCC307]
 gi|166227398|sp|A5GX14|RS6_SYNR3 RecName: Full=30S ribosomal protein S6
 gi|147851929|emb|CAK29423.1| 30S ribosomal protein S6 [Synechococcus sp. RCC307]
          Length = 135

 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 65/132 (49%), Gaps = 2/132 (1%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI+ ++++    +Y+ L+ E GGEV      G R +AY I K+R+  Y+
Sbjct: 5   PNYETMYILRPDIAEEEVESHANKYRDLVVEAGGEVIDSQMRGKRRLAYNIGKHREGIYI 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            +N +     +  +++ MR+ E+V+R LT+  +      +L       +      PR   
Sbjct: 65  QLNYSGDGKQVGPLEKAMRLSEDVIRYLTVKYEGQH--SSLGRSTAPANPMASNTPRTEG 122

Query: 122 VDRKQHVSEEKP 133
            ++ +   +  P
Sbjct: 123 QEQAKTEPQTAP 134


>gi|20809110|ref|NP_624281.1| 30S ribosomal protein S6 [Thermoanaerobacter tengcongensis MB4]
 gi|24212292|sp|Q8R6M1|RS6_THETN RecName: Full=30S ribosomal protein S6
 gi|20517788|gb|AAM25885.1| Ribosomal protein S6 [Thermoanaerobacter tengcongensis MB4]
          Length = 95

 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 36/95 (37%), Positives = 57/95 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++L  D++ ++ K  I ++++LI E GGE+   +E G R +AY I+K  + YY
Sbjct: 1  MRSYETMYVLSPDLNEEERKGLIERFKNLIVERGGEITNFDEWGKRKLAYPIQKKSEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V MN  S P    E++R  RI + VLR L +  D 
Sbjct: 61 VLMNFNSSPDVSRELERVYRITDGVLRYLIIRTDD 95


>gi|153803834|ref|ZP_01958420.1| ribosomal protein S6 [Vibrio cholerae MZO-3]
 gi|124120632|gb|EAY39375.1| ribosomal protein S6 [Vibrio cholerae MZO-3]
          Length = 108

 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 30/108 (27%), Positives = 58/108 (53%)

Query: 16  SQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEM 75
           S+Q+   I +Y   I E GG++  + + G R +AY I K  KA+YV MN+ +  A + E+
Sbjct: 1   SEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEADQAVVDEL 60

Query: 76  KRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNVD 123
           +   R ++ VLR++ +   +    P++ ++  +   + D    D +V+
Sbjct: 61  ETAFRFNDAVLRNMIMRTKAAITEPSIMLKAREERVKRDEMKFDADVE 108


>gi|332185227|ref|ZP_08386976.1| ribosomal protein S6 [Sphingomonas sp. S17]
 gi|332014951|gb|EGI57007.1| ribosomal protein S6 [Sphingomonas sp. S17]
          Length = 130

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 35/101 (34%), Positives = 67/101 (66%)

Query: 7   VFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIA 66
           +FL RQD++  Q+         ++++N G+V      G+R++AY+I KNRKA+YV + I 
Sbjct: 1   MFLARQDLAQAQVDALAEAATKIVEDNQGKVVKTETWGLRSLAYKIAKNRKAHYVMLEID 60

Query: 67  SPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH 107
           +P   + E++R+ +I+E+V+R +T+ VD HE+ P++ +++ 
Sbjct: 61  APAGVVAELERQTQINEDVIRYMTVKVDGHEEGPSVMMRKQ 101


>gi|332881933|ref|ZP_08449575.1| ribosomal protein S6 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
 gi|332680168|gb|EGJ53123.1| ribosomal protein S6 [Capnocytophaga sp. oral taxon 329 str.
          F0087]
          Length = 113

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 47/96 (48%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QIK+ + ++++ +   G E       G++ +AY I+  +  +Y
Sbjct: 1  MNQYETVFILNPVLSETQIKEAVEKFENFLTSRGAEFVSKENWGLKKLAYPIQNKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
                     I   + + R DE V+R LT+ +D H
Sbjct: 61 HLFEFKVAGEVIDAFELEFRRDERVMRYLTVKLDKH 96


>gi|332883574|gb|EGK03857.1| 30S ribosomal protein S6 [Dysgonomonas mossii DSM 22836]
          Length = 118

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 55/117 (47%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++++L+   G ++      G+R +AY I+K    +Y
Sbjct: 1   MNNYETVFILTPVLSDVQMKEAVEKFKTLLVNEGAKIVSEENWGLRKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFP 117
             +   + P+ I +++   R DE V+R LT   D       L  +      + +   
Sbjct: 61  AMLEFEADPSVIAKLEINFRRDERVIRFLTFRQDKFSHEYALKRRSLKSSKKEEVKE 117


>gi|260912754|ref|ZP_05919240.1| 30S ribosomal protein S6 [Pasteurella dagmatis ATCC 43325]
 gi|260633132|gb|EEX51297.1| 30S ribosomal protein S6 [Pasteurella dagmatis ATCC 43325]
          Length = 117

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 57/118 (48%), Gaps = 1/118 (0%)

Query: 9   LLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP 68
           ++  D  S+Q+   I +Y   I+E GG++  + + G R +AY I K  KA+YV MN+ +P
Sbjct: 1   MVHPD-QSEQVPGMIERYTGSIKEAGGQIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAP 59

Query: 69  PAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNVDRKQ 126
              I E++   R ++ VLR++ +         +  ++  D          +   D ++
Sbjct: 60  QEVIDELETTFRYNDAVLRNVIIRTKHAVTEASPMVKAKDDRKALAEVENNDFEDAEE 117


>gi|297569120|ref|YP_003690464.1| ribosomal protein S6 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925035|gb|ADH85845.1| ribosomal protein S6 [Desulfurivibrio alkaliphilus AHT2]
          Length = 134

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 60/132 (45%), Gaps = 1/132 (0%)

Query: 1   MKLYEHVFLLRQDI-SSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAY 59
           M+ YE V ++R    S  ++   I +Y  +I  + GE+  V+  G++ +AY I K  +  
Sbjct: 1   MRNYESVIIVRPSAGSEAELTGVIDKYSGVITAHEGEIGGVDRWGLKKLAYPISKETQGV 60

Query: 60  YVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
           Y+     + P  I E++R +RID+ +L+ LT+ +   E   T +       D        
Sbjct: 61  YLLFRYTTSPDGIKELERLLRIDDRILKFLTVKLTGEEAPFTPSEDEGGNGDEEAAGDEA 120

Query: 120 RNVDRKQHVSEE 131
              D  +   E+
Sbjct: 121 EGNDNNEDNGED 132


>gi|319951621|ref|YP_004162888.1| ssu ribosomal protein s6p [Cellulophaga algicola DSM 14237]
 gi|319420281|gb|ADV47390.1| SSU ribosomal protein S6P [Cellulophaga algicola DSM 14237]
          Length = 112

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 49/96 (51%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QI++T+ +++  +     ++      G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSDTQIEETVKKFEDFLISKDAKMVSKENWGLKKLAYPIQHKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
               +S    +   + + R DE ++R LT+ +D H
Sbjct: 61 HLFEFSSTGEVVSPFELEFRRDERIMRFLTVKLDKH 96


>gi|167755262|ref|ZP_02427389.1| hypothetical protein CLORAM_00767 [Clostridium ramosum DSM 1402]
 gi|237735010|ref|ZP_04565491.1| 30S ribosomal protein S6 [Mollicutes bacterium D7]
 gi|167705312|gb|EDS19891.1| hypothetical protein CLORAM_00767 [Clostridium ramosum DSM 1402]
 gi|229381786|gb|EEO31877.1| 30S ribosomal protein S6 [Coprobacillus sp. D7]
          Length = 93

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 51/92 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +F+++ D+        I  ++ ++  NGG V  V+E G+R +AY I+  +K YY
Sbjct: 1  MNKYEIMFIVKPDVEDDARNALIESFKGILTANGGTVDNVDEWGLRDLAYEIKDYKKGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          V ++     A + E +R   I+ ++LR LTL 
Sbjct: 61 VVVDATCTAADVAEFERLSNINASMLRHLTLR 92


>gi|317123156|ref|YP_004103159.1| 30S ribosomal protein S6P [Thermaerobacter marianensis DSM 12885]
 gi|315593136|gb|ADU52432.1| SSU ribosomal protein S6P [Thermaerobacter marianensis DSM 12885]
          Length = 97

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 52/96 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++ R D+  +  K  + + Q ++ + GG V  V+  G R +AY I   R+ +Y
Sbjct: 1  MRAYELMYITRPDLDEEAEKALLDRLQKIVVDGGGSVEQVDVWGRRRLAYEIAGYREGHY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +    P    HE++R +R+ ++++R + +L +  
Sbjct: 61 TVVQFQGPAGVTHELERVIRLSDDIIRHIIVLREKV 96


>gi|254520714|ref|ZP_05132770.1| RpsF [Clostridium sp. 7_2_43FAA]
 gi|226914463|gb|EEH99664.1| RpsF [Clostridium sp. 7_2_43FAA]
          Length = 96

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 48/94 (51%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+L   +  +  K  I +++ +I+  GG +  V+  G R +AY I K  + +Y
Sbjct: 2  MRKYETIFILHPSLDEEACKANIEKFKGVIENGGGTIENVDVWGRRKLAYEIAKVNEGFY 61

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N  +      E+ R  RI + VLR + +  +
Sbjct: 62 TLINFNADSELPKELDRIFRITDGVLRHIIVKQE 95


>gi|194476869|ref|YP_002049048.1| 30S ribosomal protein S6 [Paulinella chromatophora]
 gi|171191876|gb|ACB42838.1| 30S ribosomal protein S6 [Paulinella chromatophora]
          Length = 121

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 55/102 (53%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ ++ + G EV      G R +AY + K+R+  YV
Sbjct: 4   PYYETMYILRPDIPEEEVESHLTKYRGIVVDAGAEVLDSQMRGKRRLAYPVDKHREGIYV 63

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  ++R MR+ E+V+R LT+  +    +P   
Sbjct: 64  QLSHNGDGQQVAPLERAMRLSEDVIRYLTVKQEGPLPTPRAI 105


>gi|332830346|gb|EGK02974.1| 30S ribosomal protein S6 [Dysgonomonas gadei ATCC BAA-286]
          Length = 118

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 54/117 (46%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++++++   G ++      G+R +AY I+K    +Y
Sbjct: 1   MNNYETVFILTPVLSDVQMKEAVEKFKTILTNEGAKIVNEENWGLRKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFP 117
             +   + PA I +++   R DE V+R LT   D          +      + +   
Sbjct: 61  AMLEFEADPAVIAKLEINFRRDERVIRFLTFRQDKFAHQYAEKRRNLKSPKKEEVKE 117


>gi|296134462|ref|YP_003641709.1| ribosomal protein S6 [Thermincola sp. JR]
 gi|296033040|gb|ADG83808.1| ribosomal protein S6 [Thermincola potens JR]
          Length = 95

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 51/95 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++  ++  +Q    + ++Q ++   GGE+  +++ G R +AY I   R+ +Y
Sbjct: 1  MRAYEAMYIINPELDEEQSNAIVEKFQGIVTGTGGELVKLDKWGKRKLAYEIDHKREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V M     PA   E+ R  RI + +++ + +  D 
Sbjct: 61 VLMQFNGEPATAQELDRVFRITDGIMKYMIVKEDK 95


>gi|291285955|ref|YP_003502771.1| 30S ribosomal protein S6 [Denitrovibrio acetiphilus DSM 12809]
 gi|290883115|gb|ADD66815.1| ribosomal protein S6 [Denitrovibrio acetiphilus DSM 12809]
          Length = 180

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/137 (25%), Positives = 66/137 (48%), Gaps = 3/137 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++R D+  +++   +  Y+  I+++GG++  V   G +T+AY I   R+  Y
Sbjct: 1   MNTYETVFIVRPDLPQEELDKELEFYKGNIEQHGGKILKVEPWGKQTMAYDIENFREGVY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS--HEQSPTLTIQRHDRDDRNDRFPR 118
             +   +      E+  + R +EN+LR + + +D    + +P        R  +    PR
Sbjct: 61  FLIQFEASTEYHDELNLRFRYNENILRFVVVAIDEKKFKLNPKRDTSGPKRYGKKPSGPR 120

Query: 119 DRNVDRKQ-HVSEEKPL 134
               D +Q   +EEK +
Sbjct: 121 KPREDAEQSETTEEKKV 137


>gi|83589001|ref|YP_429010.1| 30S ribosomal protein S6 [Moorella thermoacetica ATCC 39073]
 gi|91207918|sp|Q2RM72|RS6_MOOTA RecName: Full=30S ribosomal protein S6
 gi|83571915|gb|ABC18467.1| SSU ribosomal protein S6P [Moorella thermoacetica ATCC 39073]
          Length = 98

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 57/95 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE VF++R D+ ++     + ++  LI + GG+V  V++ G + +AY +RK R+ YY
Sbjct: 1  MRNYEVVFVIRPDLEAEATTAVVEKFTQLITDQGGQVTRVDQWGKKRMAYEVRKYREGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V +     PA   E++R ++I ++V+R L   ++ 
Sbjct: 61 VLVEFKGTPAVAQELERVLKISDDVIRYLITRLEE 95


>gi|27904982|ref|NP_778108.1| 30S ribosomal protein S6 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
 gi|31076865|sp|Q89A41|RS6_BUCBP RecName: Full=30S ribosomal protein S6
 gi|27904380|gb|AAO27213.1| 30S ribosomal protein S6 [Buchnera aphidicola str. Bp (Baizongia
           pistaciae)]
          Length = 119

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 59/116 (50%), Gaps = 2/116 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + L+  D S + +   I +++ L+    G +  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIILLIHPDCSEK-LPIMIEKFKKLVIGYKGRIHRLEDWGRRQLAYSINKLHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDR 115
             MNI  P   I ++    R D+ V+R++ + V       +  ++ + D+ D+ DR
Sbjct: 60  FLMNIEVPSNCIQDLSNTFRYDDLVIRNIIMHVKKSVTEISPMLKSKEDKLDKKDR 115


>gi|326336348|ref|ZP_08202519.1| 30S ribosomal protein S6 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
 gi|325691522|gb|EGD33490.1| 30S ribosomal protein S6 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
          Length = 113

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 50/95 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QIK+ + ++++ +   G E+    + G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSEAQIKEAVEKFENFLTSKGAEMVAKEDWGLKKLAYSIQNKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
                +P   I   + + R DE V+R LT+ +D 
Sbjct: 61 HLFEFKAPGDIIESFEVEFRRDERVMRYLTVKLDK 95


>gi|311693516|gb|ADP96389.1| ribosomal protein S6 [marine bacterium HP15]
          Length = 130

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 8/131 (6%)

Query: 9   LLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP 68
           ++  D  S+Q+   I +Y  +I E+GG+V  + + G R +AY I K  KA+YV MN+   
Sbjct: 1   MVHPD-QSEQVPAMIERYTGVITEDGGKVHRLEDWGRRHLAYPINKIHKAHYVLMNVECS 59

Query: 69  PAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD-------DRNDRFPRDRN 121
            AA+ E+    R ++ ++R + L  D  +   +       R+               D  
Sbjct: 60  QAAMDELTHNFRFNDAIIRDMILRRDGADTDLSPMKASESREDRRGGDDRPRRSAESDEP 119

Query: 122 VDRKQHVSEEK 132
             R +   EE+
Sbjct: 120 RQRAETQDEEE 130


>gi|256820493|ref|YP_003141772.1| 30S ribosomal protein S6 [Capnocytophaga ochracea DSM 7271]
 gi|315223594|ref|ZP_07865449.1| 30S ribosomal protein S6 [Capnocytophaga ochracea F0287]
 gi|256582076|gb|ACU93211.1| ribosomal protein S6 [Capnocytophaga ochracea DSM 7271]
 gi|314946510|gb|EFS98504.1| 30S ribosomal protein S6 [Capnocytophaga ochracea F0287]
          Length = 113

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 47/99 (47%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QIK+ + ++++ +   G E       G++ +AY I+  +  +Y
Sbjct: 1  MNQYETVFILNPVLSDTQIKEAVEKFENFLTSRGAEFVAKENWGLKKLAYPIQNKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQS 99
                     I   + + R DE V+R LT+ +D H   
Sbjct: 61 HLFEFKVAGEVIDAFELEFRRDERVMRYLTVKLDKHAIE 99


>gi|150025894|ref|YP_001296720.1| 30S ribosomal protein S6 [Flavobacterium psychrophilum JIP02/86]
 gi|166226830|sp|A6H0P3|RS6_FLAPJ RecName: Full=30S ribosomal protein S6
 gi|149772435|emb|CAL43917.1| 30S ribosomal protein S6 [Flavobacterium psychrophilum JIP02/86]
          Length = 113

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 49/96 (51%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  Q+K+T+ +++  +   G  +    + G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSETQVKETVSKFEDYLTSKGATMVSKEDWGLKKMAYEIQNKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
                 P   +   + + R DE V+R LT+ +D H
Sbjct: 61 HLFEFTVPGEVLIGFETEFRRDERVMRFLTVSLDKH 96


>gi|322379728|ref|ZP_08054041.1| 30S ribosomal protein S6 [Helicobacter suis HS5]
 gi|321147877|gb|EFX42464.1| 30S ribosomal protein S6 [Helicobacter suis HS5]
          Length = 135

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/102 (32%), Positives = 62/102 (60%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE +F+L+  +  ++IKD +  YQ +I ++GGEV    ++G R +AY I+K+++ YY
Sbjct: 1   MKHYETMFILKPTLVEEEIKDKLAFYQEVITKSGGEVVNTLDMGHRNLAYEIQKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
             +   +    + E++R  RI+E++LR + L  +S ++    
Sbjct: 61  FVIYFTAHADVVLELERLYRINEDILRFMILKYESKKEQKAW 102


>gi|238750084|ref|ZP_04611587.1| 30S ribosomal subunit protein S6 [Yersinia rohdei ATCC 43380]
 gi|238711628|gb|EEQ03843.1| 30S ribosomal subunit protein S6 [Yersinia rohdei ATCC 43380]
          Length = 110

 Score =  106 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 53/110 (48%)

Query: 22  TIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRI 81
            I +Y + I    G +  + + G R +AY I K  KA+YV +N+ +P  AI E++   R 
Sbjct: 1   MIERYSATITNAAGTIHRLEDWGRRQLAYPINKLHKAHYVLLNVEAPQEAIDELETNFRF 60

Query: 82  DENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNVDRKQHVSEE 131
           ++ V+RS+ + V       +  ++  D       F  + N D +   SEE
Sbjct: 61  NDAVIRSMVMRVKHAVTEASPMVKAKDERRERHDFASEANDDSEAGDSEE 110


>gi|91214892|ref|ZP_01251865.1| 30S ribosomal protein S6 [Psychroflexus torquis ATCC 700755]
 gi|91187319|gb|EAS73689.1| 30S ribosomal protein S6 [Psychroflexus torquis ATCC 700755]
          Length = 112

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 49/96 (51%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QIK+T+ +Y+  +   G ++    + G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSEDQIKETVKKYEDFLVSEGAKMVNKEDWGLKKLAYPIQHKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
                     I  ++   R DE ++R LT+ +D H
Sbjct: 61 HMFEYEVVGPTIEPLEVMFRRDERMMRYLTVKLDKH 96


>gi|323703278|ref|ZP_08114929.1| ribosomal protein S6 [Desulfotomaculum nigrificans DSM 574]
 gi|323531743|gb|EGB21631.1| ribosomal protein S6 [Desulfotomaculum nigrificans DSM 574]
          Length = 95

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 56/95 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++++ D+  +Q+   + +++ L++  G EV  +++ G R +AY +   R+  Y
Sbjct: 1  MRNYEVMYIVKPDVEDEQLNALVERFKGLVENQGAEVTKLDKWGKRRLAYEVNHLREGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V M   + PAA  E+ R ++I ++++R + +  D 
Sbjct: 61 VVMQFKAEPAAAAELDRVLKISDDIIRHIIVREDE 95


>gi|320161642|ref|YP_004174867.1| 30S ribosomal protein S6 [Anaerolinea thermophila UNI-1]
 gi|319995496|dbj|BAJ64267.1| 30S ribosomal protein S6 [Anaerolinea thermophila UNI-1]
          Length = 94

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/93 (35%), Positives = 51/93 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F++  ++        I + Q  I   GG V   +  G RT+AY IRK R+  Y
Sbjct: 1  MRNYEVIFIIHPELDETASTALIEKVQGWITGAGGTVEKTDVWGKRTMAYSIRKQREGNY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLV 93
          V+M +A PPA ++E+   +R+ E VLR L   +
Sbjct: 61 VYMQVAMPPAFVNELSTNLRLTEPVLRYLITAI 93


>gi|213962687|ref|ZP_03390948.1| ribosomal protein S6 [Capnocytophaga sputigena Capno]
 gi|213954682|gb|EEB66003.1| ribosomal protein S6 [Capnocytophaga sputigena Capno]
          Length = 113

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/99 (27%), Positives = 47/99 (47%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QIK+ + ++++ +   G E       G++ +AY I+  +  +Y
Sbjct: 1  MNQYETVFILNPVLSETQIKEAVEKFENFLTSRGAEFVAKENWGLKKLAYPIQNKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQS 99
                     I   + + R DE V+R LT+ +D H   
Sbjct: 61 HLFEFKVAGEVIDAFELEFRRDERVMRYLTVKLDKHAIE 99


>gi|218128602|ref|ZP_03457406.1| hypothetical protein BACEGG_00172 [Bacteroides eggerthii DSM 20697]
 gi|317475594|ref|ZP_07934856.1| ribosomal protein S6 [Bacteroides eggerthii 1_2_48FAA]
 gi|329957653|ref|ZP_08298128.1| ribosomal protein S6 [Bacteroides clarus YIT 12056]
 gi|329960226|ref|ZP_08298668.1| ribosomal protein S6 [Bacteroides fluxus YIT 12057]
 gi|217989204|gb|EEC55518.1| hypothetical protein BACEGG_00172 [Bacteroides eggerthii DSM 20697]
 gi|316908298|gb|EFV29990.1| ribosomal protein S6 [Bacteroides eggerthii 1_2_48FAA]
 gi|328522530|gb|EGF49639.1| ribosomal protein S6 [Bacteroides clarus YIT 12056]
 gi|328532899|gb|EGF59676.1| ribosomal protein S6 [Bacteroides fluxus YIT 12057]
          Length = 114

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 53/114 (46%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++   G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILTAEGAEIVNEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT   D +        +      + D
Sbjct: 61  QLIEFNAEPTVIEKLELNFRRDERVIRFLTFKQDKYAAEYAAKRRSVKSTKKED 114


>gi|126661840|ref|ZP_01732839.1| 30S ribosomal subunit protein S6 [Flavobacteria bacterium BAL38]
 gi|126625219|gb|EAZ95908.1| 30S ribosomal subunit protein S6 [Flavobacteria bacterium BAL38]
          Length = 113

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 52/96 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S QQ+K+T+ +++  +   G E+    + G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSEQQVKETVSKFEDFLTSKGSEMVSKEDWGLKKLAYEIQHKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
                +P   I   + + R DE V+R LT+ +D H
Sbjct: 61 HLFEFKAPAEIIIAFETEFRRDERVMRFLTVSLDKH 96


>gi|282860310|ref|ZP_06269379.1| ribosomal protein S6 [Prevotella bivia JCVIHMP010]
 gi|282586907|gb|EFB92143.1| ribosomal protein S6 [Prevotella bivia JCVIHMP010]
          Length = 114

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 60/113 (53%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ ++++L+ +NG E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKETVAKFKALLTDNGAEILNEEAWGLKKLAYNIQKKSSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
             +   + P+ I+ ++   R DE V+R +T+  D +  +     +      + 
Sbjct: 61  ALLEFNAEPSVINTLETGFRRDEKVIRYITVKQDKYSAAYAEKRRAKWSAKKE 113


>gi|298208562|ref|YP_003716741.1| 30S ribosomal protein S6 [Croceibacter atlanticus HTCC2559]
 gi|83848485|gb|EAP86354.1| 30S ribosomal protein S6 [Croceibacter atlanticus HTCC2559]
          Length = 112

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 54/111 (48%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +QIK+T+ +++  +     ++    + G++ +AY I+  +  +Y
Sbjct: 1   MNHYETVFILNPVLSDEQIKETVKKFEDFLISKDAKMVNKEDWGLKKLAYAIQNKKSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
                      I  ++   R DE ++R LT+ +D H      T  + +++ 
Sbjct: 61  HLFEYQVAGEHIEPLEVLFRRDERIMRFLTVKLDKHAVEWAKTRVKRNKEK 111


>gi|333029250|ref|ZP_08457311.1| 30S ribosomal protein S6 [Bacteroides coprosuis DSM 18011]
 gi|332739847|gb|EGJ70329.1| 30S ribosomal protein S6 [Bacteroides coprosuis DSM 18011]
          Length = 115

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 56/115 (48%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++Q  G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKDVLQAEGAEIVNEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
             +   + PA I +++   R DE V+R LT  +D +        +      +  +
Sbjct: 61  QLLEFNADPAVIEKLEVSFRRDERVIRFLTFKMDKYAAEYAAKRRNIKSSKKEGK 115


>gi|65317455|ref|ZP_00390414.1| COG0360: Ribosomal protein S6 [Bacillus anthracis str. A2012]
 gi|118480502|ref|YP_897653.1| 30S ribosomal protein S6 [Bacillus thuringiensis str. Al Hakam]
 gi|118419727|gb|ABK88146.1| SSU ribosomal protein S6P [Bacillus thuringiensis str. Al Hakam]
          Length = 113

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 53/95 (55%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE ++++R  +  +  K  + ++  ++  NG E+    E G R +AY I   R+ +Y
Sbjct: 18  MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFY 77

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           + +N+ +   AI+E  R  +I+E++LR + +  + 
Sbjct: 78  MILNVNANAEAINEFDRLAKINEDILRHIVVKEEE 112


>gi|325298155|ref|YP_004258072.1| 30S ribosomal protein S6 [Bacteroides salanitronis DSM 18170]
 gi|324317708|gb|ADY35599.1| 30S ribosomal protein S6 [Bacteroides salanitronis DSM 18170]
          Length = 115

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 57/115 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++++++ + G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKTILTQEGAEIINEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
             +   + P+ I +++   R DE V+R LT  +D +        +      + + 
Sbjct: 61  QLLEFKADPSVISKLEINYRRDERVIRFLTFRMDKYAAEYAAKRRSLKSTKKEEN 115


>gi|269959108|ref|YP_003328897.1| 30S ribosomal protein S6 [Anaplasma centrale str. Israel]
 gi|269848939|gb|ACZ49583.1| 30S ribosomal protein S6 [Anaplasma centrale str. Israel]
          Length = 109

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 57/104 (54%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M +YE  F+ +Q ++  +++       +L+ + G E+      G+   AY I KN K +Y
Sbjct: 1   MPIYEFAFIAQQGLTQYELEGLSKGLSALLVKIGAELVKYEYWGLLDFAYSIAKNNKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             M I + P+A+ E +RK+R++E+VLR L L VD   +  +  +
Sbjct: 61  CMMYIRADPSAMDEFRRKVRLNEDVLRFLCLKVDKVCEGKSAMM 104


>gi|307566428|ref|ZP_07628863.1| 30S ribosomal protein S6 [Prevotella amnii CRIS 21A-A]
 gi|307344853|gb|EFN90255.1| 30S ribosomal protein S6 [Prevotella amnii CRIS 21A-A]
          Length = 114

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 59/113 (52%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+T+ ++++L+ +NG E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDDQMKETVAKFKTLLTDNGAEILNEEAWGLKKLAYNIQKKSSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
             +   + P+ ++ ++   R DE V+R +T+  D +  +     +      + 
Sbjct: 61  ALLEFKAEPSVVNTLETGFRRDERVIRYITVKQDKYSAAYAEKRRAKWLAKKE 113


>gi|319899908|ref|YP_004159636.1| SSU ribosomal protein S6P [Bacteroides helcogenes P 36-108]
 gi|319414939|gb|ADV42050.1| SSU ribosomal protein S6P [Bacteroides helcogenes P 36-108]
          Length = 114

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 53/114 (46%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++   G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILTSEGAEIVNEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT   D +        +      + D
Sbjct: 61  QLIEFNAEPTVIEKLEINFRRDERVIRFLTFKQDKYAAEYAAKRRSVKSTKKED 114


>gi|288801222|ref|ZP_06406677.1| ribosomal protein S6 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288331833|gb|EFC70316.1| ribosomal protein S6 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 114

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/113 (23%), Positives = 57/113 (50%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+ + +++ L+ +NG E+      G++ +AY I K    +Y
Sbjct: 1   MNHYETVFILTPVLSDEQMKEAVAKFKKLLTDNGAEILNEEAWGLKKMAYAIDKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
             +   + P  ++ ++   R DE V+R +T+ +D +     +  +      + 
Sbjct: 61  CLLEFKAEPTIVNTLEIGYRRDERVIRFITVKLDKYAAEYAIKRKNKYAKKQE 113


>gi|254459893|ref|ZP_05073309.1| ribosomal protein S6 [Rhodobacterales bacterium HTCC2083]
 gi|206676482|gb|EDZ40969.1| ribosomal protein S6 [Rhodobacteraceae bacterium HTCC2083]
          Length = 110

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/99 (36%), Positives = 66/99 (66%)

Query: 8   FLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIAS 67
            + RQD+S+ Q +  I  + +++ +NGG++      G++T+AY+I KNRK +Y F+   +
Sbjct: 1   MIARQDLSNTQAEGLIEHFGTVLADNGGKLVDHEYWGVKTMAYKINKNRKGHYAFLRSDA 60

Query: 68  PPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR 106
           P  A+ EM+R MR+ E+V+R LT+ +D H + P++ +Q+
Sbjct: 61  PAPAVQEMERLMRLHEDVMRVLTIKMDDHAELPSVQMQK 99


>gi|160890913|ref|ZP_02071916.1| hypothetical protein BACUNI_03358 [Bacteroides uniformis ATCC 8492]
 gi|167764866|ref|ZP_02436987.1| hypothetical protein BACSTE_03258 [Bacteroides stercoris ATCC
           43183]
 gi|270295894|ref|ZP_06202094.1| 30S ribosomal protein S6 [Bacteroides sp. D20]
 gi|156859912|gb|EDO53343.1| hypothetical protein BACUNI_03358 [Bacteroides uniformis ATCC 8492]
 gi|167697535|gb|EDS14114.1| hypothetical protein BACSTE_03258 [Bacteroides stercoris ATCC
           43183]
 gi|270273298|gb|EFA19160.1| 30S ribosomal protein S6 [Bacteroides sp. D20]
          Length = 114

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 53/114 (46%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++   G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILTAEGAEIVNEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT   D +        +      + D
Sbjct: 61  QLIEFNAEPTVIEKLEINFRRDERVIRFLTFKQDKYAAEYAAKRRSVKSTKKED 114


>gi|291277459|ref|YP_003517231.1| putative 30S ribosomal protein S6 [Helicobacter mustelae 12198]
 gi|290964653|emb|CBG40508.1| putative 30S ribosomal protein S6 [Helicobacter mustelae 12198]
          Length = 139

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 73/137 (53%), Gaps = 5/137 (3%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++I   I  Y+  I +NGG ++   ++GMR +AY I+KN++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIASKIEFYKEAITKNGGSIQTTLDMGMRNLAYEIKKNKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT-----IQRHDRDDRNDR 115
             +   + P+ + E++R  RI+E+VLR + +  +S ++            +      +  
Sbjct: 61  FVIYFQANPSLVLELERLYRINEDVLRFIVIKYESKKEQKAWHALVDRANKKPHASTSRP 120

Query: 116 FPRDRNVDRKQHVSEEK 132
              ++  ++ +H SEE 
Sbjct: 121 KSEEKTEEQAEHKSEEA 137


>gi|212691068|ref|ZP_03299196.1| hypothetical protein BACDOR_00558 [Bacteroides dorei DSM 17855]
 gi|237726622|ref|ZP_04557103.1| 30S ribosomal protein S6 [Bacteroides sp. D4]
 gi|265752134|ref|ZP_06087927.1| 30S ribosomal protein S6 [Bacteroides sp. 3_1_33FAA]
 gi|212666300|gb|EEB26872.1| hypothetical protein BACDOR_00558 [Bacteroides dorei DSM 17855]
 gi|229435148|gb|EEO45225.1| 30S ribosomal protein S6 [Bacteroides dorei 5_1_36/D4]
 gi|263236926|gb|EEZ22396.1| 30S ribosomal protein S6 [Bacteroides sp. 3_1_33FAA]
          Length = 114

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 54/114 (47%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++   G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILTAEGAEIINEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT  +D +        +      + D
Sbjct: 61  QLIEFKAEPQVIKKLEINFRRDERVIRFLTFKMDKYAAEYAAKRRNVKSTKKED 114


>gi|33862262|ref|NP_893823.1| 30S ribosomal protein S6 [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
 gi|61216282|sp|Q7UZG1|RS6_PROMP RecName: Full=30S ribosomal protein S6
 gi|33634480|emb|CAE20165.1| 30S ribosomal protein S6 [Prochlorococcus marinus subsp. pastoris
           str. CCMP1986]
          Length = 154

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 74/132 (56%), Gaps = 2/132 (1%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
            YE +++LR DI+  ++ + I +Y  L++E+GG++      G R +AY+I K+R+  YV 
Sbjct: 6   YYETMYILRPDIAEDEVTNHIDKYNKLLEESGGKILDSQMRGKRRLAYQIAKHREGIYVQ 65

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND--RFPRDR 120
           ++       I ++++ MR+ E+V+R LT+  +    +P  + + +++ ++ D        
Sbjct: 66  LSHQGDGQHIFKIEKAMRLSEDVIRYLTVKQEGPLPTPRSSNKGYNQSEKKDIESIDSTN 125

Query: 121 NVDRKQHVSEEK 132
             + K+  +++K
Sbjct: 126 KSEFKEEANDKK 137


>gi|299140846|ref|ZP_07033984.1| ribosomal protein S6 [Prevotella oris C735]
 gi|298577812|gb|EFI49680.1| ribosomal protein S6 [Prevotella oris C735]
          Length = 114

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/116 (25%), Positives = 62/116 (53%), Gaps = 2/116 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ +++ L+ +NG E+      G++ +AY I K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKETVAKFKKLLTDNGAEILNEEAWGLKKMAYAIDKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
             +     P+ I+ ++   R DE V+R +T+ +D +  +     +R ++  + +  
Sbjct: 61  CLIEFKGEPSIINTLETGYRRDEKVIRYMTVRLDKY--AAQYAEKRRNKLGKKEEA 114


>gi|75763192|ref|ZP_00742957.1| SSU ribosomal protein S6P [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|229118964|ref|ZP_04248309.1| 30S ribosomal protein S6 [Bacillus cereus Rock1-3]
 gi|74489324|gb|EAO52775.1| SSU ribosomal protein S6P [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228664489|gb|EEL19985.1| 30S ribosomal protein S6 [Bacillus cereus Rock1-3]
          Length = 113

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 53/95 (55%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE ++++R  +  +  K  + ++  ++  NG E+    E G R +AY I   R+ +Y
Sbjct: 18  MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFY 77

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           + +N+ S   AI+E  R  +I+E++LR + +  + 
Sbjct: 78  MILNVNSNAEAINEFDRLAKINEDILRHIVVKEEE 112


>gi|169351668|ref|ZP_02868606.1| hypothetical protein CLOSPI_02449 [Clostridium spiroforme DSM
          1552]
 gi|169291890|gb|EDS74023.1| hypothetical protein CLOSPI_02449 [Clostridium spiroforme DSM
          1552]
          Length = 93

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 53/92 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +F+++ D+  +     I  +++++  NGG V  V+E G+R +AY I+  +K YY
Sbjct: 1  MNKYEIMFIVKPDVEEEARNTLIENFKNILTANGGTVDNVDEWGLRDLAYEIQDFKKGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          V ++     A + E +R   I+ ++LR LTL 
Sbjct: 61 VVVDTTCTAADVAEFERLSNINSSMLRHLTLR 92


>gi|304318116|ref|YP_003853261.1| ribosomal protein S6 [Thermoanaerobacterium thermosaccharolyticum
          DSM 571]
 gi|302779618|gb|ADL70177.1| ribosomal protein S6 [Thermoanaerobacterium thermosaccharolyticum
          DSM 571]
          Length = 95

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/95 (36%), Positives = 56/95 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F++  D++ +     I ++++LI E GGE+  V+E G R +AY I K  + YY
Sbjct: 1  MRSYETIFIISPDVNDEARPALIEKFKNLITEKGGEITNVDEWGRRKLAYEIDKKSEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V MN  S     HE++R  +I + +LR L + VD 
Sbjct: 61 VLMNFNSDVDVPHELERVYKITDGILRYLIVKVDK 95


>gi|229014640|ref|ZP_04171754.1| 30S ribosomal protein S6 [Bacillus mycoides DSM 2048]
 gi|229136299|ref|ZP_04265046.1| 30S ribosomal protein S6 [Bacillus cereus BDRD-ST196]
 gi|229170177|ref|ZP_04297863.1| 30S ribosomal protein S6 [Bacillus cereus AH621]
 gi|228613278|gb|EEK70417.1| 30S ribosomal protein S6 [Bacillus cereus AH621]
 gi|228647171|gb|EEL03259.1| 30S ribosomal protein S6 [Bacillus cereus BDRD-ST196]
 gi|228746651|gb|EEL96540.1| 30S ribosomal protein S6 [Bacillus mycoides DSM 2048]
          Length = 113

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 53/95 (55%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE ++++R  +  +  K  + ++  ++  NG E+    E G R +AY I   R+ +Y
Sbjct: 18  MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFY 77

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           + +N+ S   AI+E  R  +I+E++LR + +  + 
Sbjct: 78  MILNVNSNSEAINEFDRLAKINEDILRHIVVKEEE 112


>gi|312889161|ref|ZP_07748718.1| SSU ribosomal protein S6P [Mucilaginibacter paludis DSM 18603]
 gi|311298323|gb|EFQ75435.1| SSU ribosomal protein S6P [Mucilaginibacter paludis DSM 18603]
          Length = 121

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 58/118 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V +L   +S +  K+ + ++  ++ +NG E+   +  G+R +AY I K    YY
Sbjct: 1   MQQYETVIILTPLLSVETAKEAVAKFTKILTDNGAEIIQEDNWGLRKLAYPIEKKTTGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPR 118
                 +P   I++++ + R DE ++R LT+ +D H  +     +    + +  +   
Sbjct: 61  HLTEFKAPGELINKLEIEYRRDERIMRFLTIALDKHATAYNDKKRSGAFNQKKPKTEE 118


>gi|224026731|ref|ZP_03645097.1| hypothetical protein BACCOPRO_03488 [Bacteroides coprophilus DSM
           18228]
 gi|224019967|gb|EEF77965.1| hypothetical protein BACCOPRO_03488 [Bacteroides coprophilus DSM
           18228]
          Length = 115

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 56/115 (48%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++++++ + G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDAQMKEAVDKFKAILTQEGAEIINEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
             +   + P+ I +++   R DE V+R LT  +D          +      + + 
Sbjct: 61  QLIEFKAEPSVIEKLEINYRRDERVIRFLTFKMDKFAAEYAAKRRNVKSTKKEEN 115


>gi|325270187|ref|ZP_08136794.1| 30S ribosomal protein S6 [Prevotella multiformis DSM 16608]
 gi|324987488|gb|EGC19464.1| 30S ribosomal protein S6 [Prevotella multiformis DSM 16608]
          Length = 114

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 54/96 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S +Q+K+ + +++ L+ +NG E+      G++ +AY I+K    +Y
Sbjct: 1  MNQYETVFILTPVLSDEQMKEAVAKFRKLLTDNGAEILNEEAWGLKKLAYNIQKKSSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +   + P+ I  ++   R DE V+R +T+  D +
Sbjct: 61 ALLEFNAEPSVIDTLETGFRRDEKVIRYITVKQDKY 96


>gi|319760230|ref|YP_004124168.1| 30S ribosomal protein S6 [Candidatus Blochmannia vafer str. BVAF]
 gi|318038944|gb|ADV33494.1| 30S ribosomal protein S6 [Candidatus Blochmannia vafer str. BVAF]
          Length = 122

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 1/113 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V ++  +   + +   I  Y  +I  +GG+V  V   G R +AY I+K  KAYY
Sbjct: 1   MRHYEIVLIIHPNFGGKIVN-IINNYTEIIISSGGKVHRVENWGDRQLAYSIKKLSKAYY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
           V MNI      I+E+    R +E +LR++ +     +  P+  + + +  ++N
Sbjct: 60  VLMNIEVSLNVINELSNDFRFNEVILRNIIMKTKDAKIDPSPMMNKKEDSNKN 112


>gi|288802529|ref|ZP_06407968.1| ribosomal protein S6 [Prevotella melaninogenica D18]
 gi|288335057|gb|EFC73493.1| ribosomal protein S6 [Prevotella melaninogenica D18]
          Length = 114

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 54/96 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S +Q+K+T+ +++ L+ +NG E+      G++ +AY I+K    +Y
Sbjct: 1  MNQYETVFILTPVLSDEQMKETVAKFKKLLTDNGAEILNEEAWGLKKLAYNIQKKSSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +   + P  I  ++   R DE V+R +T+  D +
Sbjct: 61 ALLEFNAEPTVIDTLETGFRRDEKVIRYITVKQDKY 96


>gi|260592154|ref|ZP_05857612.1| ribosomal protein S6 [Prevotella veroralis F0319]
 gi|260535788|gb|EEX18405.1| ribosomal protein S6 [Prevotella veroralis F0319]
          Length = 114

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 56/96 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S +Q+K+ + ++++L+ +NG E+      G++ +AY I+K    +Y
Sbjct: 1  MNQYETVFILTPVLSDEQMKEAVAKFKTLLTDNGAEILNEEIWGLKKLAYNIQKKSSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +   + P+ I+ ++   R DE V+R +T+  D +
Sbjct: 61 ALLEFNAEPSVINTLETGFRRDEKVIRYITVKQDKY 96


>gi|282898577|ref|ZP_06306565.1| Ribosomal protein S6 [Cylindrospermopsis raciborskii CS-505]
 gi|281196445|gb|EFA71354.1| Ribosomal protein S6 [Cylindrospermopsis raciborskii CS-505]
          Length = 108

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 4   YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
           YE  ++LR D+   Q+   I +YQ+L+ E G E   +   G R +AY I ++R   YV  
Sbjct: 5   YETTYILRPDLGDDQVDQAIVKYQNLLNEQGAENLEIQNRGKRRLAYEINRHRDGVYVQF 64

Query: 64  NIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
           N  +P  AI   +R MR++E+V+R LT+  +    +P
Sbjct: 65  NYTAPAGAIAVFERSMRLNEDVIRYLTVKQEVKTTAP 101


>gi|260436555|ref|ZP_05790525.1| ribosomal protein S6 [Synechococcus sp. WH 8109]
 gi|260414429|gb|EEX07725.1| ribosomal protein S6 [Synechococcus sp. WH 8109]
          Length = 127

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 56/102 (54%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ ++ E G +V      G R +AY I K+++  YV
Sbjct: 8   PYYETMYILRPDIPEEEVESHLNKYRDMLVEAGADVLDNQMRGKRRLAYPIAKHKEGIYV 67

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  +++ MR+ E+V+R LT+  +    +P + 
Sbjct: 68  QLSHNGDGQHVAVLEKAMRLSEDVIRYLTVKQEGPLPAPRVM 109


>gi|150002621|ref|YP_001297365.1| 30S ribosomal protein S6 [Bacteroides vulgatus ATCC 8482]
 gi|254881415|ref|ZP_05254125.1| 30S ribosomal protein S6 [Bacteroides sp. 4_3_47FAA]
 gi|294776101|ref|ZP_06741594.1| ribosomal protein S6 [Bacteroides vulgatus PC510]
 gi|319642802|ref|ZP_07997440.1| hypothetical protein HMPREF9011_03040 [Bacteroides sp. 3_1_40A]
 gi|166226801|sp|A6KWD7|RS6_BACV8 RecName: Full=30S ribosomal protein S6
 gi|149931045|gb|ABR37743.1| 30S ribosomal protein S6 [Bacteroides vulgatus ATCC 8482]
 gi|254834208|gb|EET14517.1| 30S ribosomal protein S6 [Bacteroides sp. 4_3_47FAA]
 gi|294450052|gb|EFG18559.1| ribosomal protein S6 [Bacteroides vulgatus PC510]
 gi|317385546|gb|EFV66487.1| hypothetical protein HMPREF9011_03040 [Bacteroides sp. 3_1_40A]
          Length = 114

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 54/114 (47%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++   G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILTAEGAEIINEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT  +D +        +      + D
Sbjct: 61  QLIEFKAEPQVIEKLEINFRRDERVIRFLTFKMDKYAAEYAAKRRNVKSTKKED 114


>gi|118444568|ref|YP_876989.1| 30S ribosomal protein S6 [Clostridium novyi NT]
 gi|166226824|sp|A0PX87|RS6_CLONN RecName: Full=30S ribosomal protein S6
 gi|118135024|gb|ABK62068.1| ribosomal protein S6 [Clostridium novyi NT]
          Length = 95

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 52/95 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+L   +  +  K  I +++ +I++ GG V  V+E G R +AY I K  + YY
Sbjct: 1  MRNYETLFILNPSLDEEATKAAIEKFKGVIEKEGGVVENVDEWGRRKLAYPINKVNEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N  + P    E++R  RI + V+R + +  + 
Sbjct: 61 TLINFKANPELPRELERVFRITDGVMRFMVVNPEK 95


>gi|237712432|ref|ZP_04542913.1| 30S ribosomal protein S6 [Bacteroides sp. 9_1_42FAA]
 gi|229453753|gb|EEO59474.1| 30S ribosomal protein S6 [Bacteroides sp. 9_1_42FAA]
          Length = 114

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 54/114 (47%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++   G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKGILTAEGAEIINEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  + +++   R DE V+R LT  +D +        +      + D
Sbjct: 61  QLIEFKAEPQVVKKLEINFRRDERVIRFLTFKMDKYAAEYAAKRRNVKSTKKED 114


>gi|152990908|ref|YP_001356630.1| 30S ribosomal protein S6 [Nitratiruptor sp. SB155-2]
 gi|166227355|sp|A6Q464|RS6_NITSB RecName: Full=30S ribosomal protein S6
 gi|151422769|dbj|BAF70273.1| 30S ribosomal protein S6 [Nitratiruptor sp. SB155-2]
          Length = 128

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/130 (26%), Positives = 67/130 (51%), Gaps = 4/130 (3%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  ++ ++ K      + +IQ NGGE+    +LG+R +AY I+K  + +Y
Sbjct: 1   MRHYETLFVLKPTLTDEESKAKFEFIKEVIQNNGGEIVATEDLGVRKLAYPIQKFERGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             +   +P   + E++R  RI E+V+R LT+  ++ +             +R  +     
Sbjct: 61  YIIYFTAPSHTVLELERIYRITEDVIRFLTIKYETKKDISAW----EKMVERAKKLSGQT 116

Query: 121 NVDRKQHVSE 130
           N + K+  +E
Sbjct: 117 NSEAKEEANE 126


>gi|168187293|ref|ZP_02621928.1| ribosomal protein S6 [Clostridium botulinum C str. Eklund]
 gi|169294825|gb|EDS76958.1| ribosomal protein S6 [Clostridium botulinum C str. Eklund]
          Length = 95

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 51/95 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+L   +  +  K  I +++ +I+  GG V  V+E G R +AY I K  + YY
Sbjct: 1  MRNYETLFILNPSLDEEATKAAIEKFKGVIEREGGVVENVDEWGRRKLAYPINKINEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N  + P    E++R  RI + V+R + +  + 
Sbjct: 61 TLINFKANPELPRELERVFRITDGVMRFMVVNPEK 95


>gi|281424415|ref|ZP_06255328.1| ribosomal protein S6 [Prevotella oris F0302]
 gi|281401684|gb|EFB32515.1| ribosomal protein S6 [Prevotella oris F0302]
          Length = 114

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 62/116 (53%), Gaps = 2/116 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ +++ L+ +NG E+      G++ +AY I K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKETVAKFKKLLTDNGAEILNEEAWGLKKMAYAIDKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
             +     P+ ++ ++   R DE V+R +T+ +D +  +     +R ++  + +  
Sbjct: 61  CLIEFKGEPSIVNTLETGYRRDEKVIRYMTVRLDKY--AAQYAEKRRNKLGKKEEA 114


>gi|254994705|ref|ZP_05276895.1| 30S ribosomal protein S6 [Anaplasma marginale str. Mississippi]
 gi|255002818|ref|ZP_05277782.1| 30S ribosomal protein S6 [Anaplasma marginale str. Puerto Rico]
 gi|255003951|ref|ZP_05278752.1| 30S ribosomal protein S6 [Anaplasma marginale str. Virginia]
 gi|91207900|sp|Q5PBN1|RS6_ANAMM RecName: Full=30S ribosomal protein S6
          Length = 109

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 57/104 (54%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M +YE  F+ +Q ++  +++       +L+ + G E+      G+   AY I KN K +Y
Sbjct: 1   MPIYEFAFIAQQGLTQYELEGLSKGLSALLVKIGAELVKYEYWGLLDFAYSIAKNNKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             M I + PAA+ E +R++R++E+VLR L L VD   +  +  +
Sbjct: 61  CMMYIRAEPAAMDEFRRRVRLNEDVLRFLCLKVDKVCEGKSAMM 104


>gi|317479667|ref|ZP_07938791.1| ribosomal protein S6 [Bacteroides sp. 4_1_36]
 gi|316904168|gb|EFV25998.1| ribosomal protein S6 [Bacteroides sp. 4_1_36]
          Length = 114

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 54/114 (47%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++S++   G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKSILTAEGAEIVNEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I +++   R DE V+R LT   D +        +      + D
Sbjct: 61  QLIEFNAEPTVIEKLEINFRRDERVIRFLTFKQDKYAAEYAAKRRSVKSTKKED 114


>gi|317503267|ref|ZP_07961322.1| 30S ribosomal protein S6 [Prevotella salivae DSM 15606]
 gi|315665624|gb|EFV05236.1| 30S ribosomal protein S6 [Prevotella salivae DSM 15606]
          Length = 114

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 61/116 (52%), Gaps = 2/116 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ ++++L+ +NG E+      G++ +AY I K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKETVAKFRNLLTDNGAEILNEEIWGLKKMAYAIEKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
             +     P+ ++ ++   R DE V+R +T+ +D +        +R  +  + +  
Sbjct: 61  CLVEFKGEPSIVNTLETGFRRDEKVIRYMTVRLDKYAVQ--YAEKRRSKLGKKEEA 114


>gi|15617155|ref|NP_240368.1| 30S ribosomal protein S6 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681906|ref|YP_002468292.1| 30S ribosomal protein S6 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682461|ref|YP_002468845.1| 30S ribosomal protein S6 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471612|ref|ZP_05635611.1| 30S ribosomal protein S6 [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11387064|sp|P57627|RS6_BUCAI RecName: Full=30S ribosomal protein S6
 gi|254765225|sp|B8D8C8|RS6_BUCA5 RecName: Full=30S ribosomal protein S6
 gi|254765226|sp|B8D885|RS6_BUCAT RecName: Full=30S ribosomal protein S6
 gi|25294551|pir||F84995 30S ribosomal protein S6 [imported] - Buchnera sp. (strain APS)
 gi|10039220|dbj|BAB13254.1| 30S ribosomal protein S6 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219622194|gb|ACL30350.1| 30S ribosomal protein S6 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624749|gb|ACL30904.1| 30S ribosomal protein S6 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086284|gb|ADP66366.1| 30S ribosomal protein S6 [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086860|gb|ADP66941.1| 30S ribosomal protein S6 [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087448|gb|ADP67528.1| 30S ribosomal protein S6 [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087936|gb|ADP68015.1| 30S ribosomal protein S6 [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 113

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 54/103 (52%), Gaps = 1/103 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F++  D  S +I   I +Y+ +I +N G +  + + G R ++Y I K +KA+Y
Sbjct: 1   MRHYEIIFMVHPD-QSDKIPLLIEKYKKIINDNNGIIHRLEDWGRRQLSYSINKLQKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
           + MNI   P  I  ++   R +  +LR++ + V       +  
Sbjct: 60  ILMNIEVFPKTITLLETDFRFNNIILRNMIMSVKKAIVELSPI 102


>gi|86133512|ref|ZP_01052094.1| 30S ribosomal protein S6 [Polaribacter sp. MED152]
 gi|85820375|gb|EAQ41522.1| 30S ribosomal protein S6 [Polaribacter sp. MED152]
          Length = 113

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 56/115 (48%), Gaps = 2/115 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  QIK+T+ ++   +   G E+    + G++ +AY I+K +  +Y
Sbjct: 1   MNHYETVFILNPVLSDTQIKETVQKFNDYLVSKGAEMISKEDWGLKKLAYPIQKKKSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
                      I   + + R D++V+R LT+ +D H  +     +R +R     +
Sbjct: 61  HLFEFKIAGEEITAFELEFRRDDSVMRYLTVRLDKH--AAAWAEKRRERVKSTKK 113


>gi|149279560|ref|ZP_01885689.1| 30S ribosomal protein S6 [Pedobacter sp. BAL39]
 gi|149229596|gb|EDM34986.1| 30S ribosomal protein S6 [Pedobacter sp. BAL39]
          Length = 120

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 55/119 (46%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE V +L   +S +  K+ I ++  +I ++G E+   +  G+R +AY I K    ++
Sbjct: 1   MNQYETVIVLTPLLSEEVAKEAIAKFSKIITDSGAEIVQEDNWGLRKLAYPIEKKASGFF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
                 S    I +++  ++ DE VLR LT+ +D H  +     +    + +  +    
Sbjct: 61  HLTEYKSSGELITKLELALKRDERVLRFLTIRLDRHAVAYNEKKRSGAFNKKPKKEEAA 119


>gi|260893968|ref|YP_003240065.1| ribosomal protein S6 [Ammonifex degensii KC4]
 gi|260866109|gb|ACX53215.1| ribosomal protein S6 [Ammonifex degensii KC4]
          Length = 95

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 53/95 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R  +  + ++  + +++ ++++ GG V  ++  G R +AY I K R+  Y
Sbjct: 1  MRAYETMYIVRPQVEGEALEAVVEKFKKIVEDGGGTVVSIDRWGKRRLAYPIEKEREGQY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + M   + P  + E+ R  +I  +VLR + +  D 
Sbjct: 61 IVMRFQAEPPVVQELDRVFKITGDVLRHIIVREDE 95


>gi|113953188|ref|YP_732113.1| 30S ribosomal protein S6 [Synechococcus sp. CC9311]
 gi|123327505|sp|Q0I609|RS6_SYNS3 RecName: Full=30S ribosomal protein S6
 gi|113880539|gb|ABI45497.1| ribosomal protein S6 [Synechococcus sp. CC9311]
          Length = 121

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 56/101 (55%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ ++ E G EV      G R +AY I K+++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVESHVTKYRDILTEAGAEVLDNQMRGKRRLAYPIAKHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
            ++       +  +++ MR+ E+V+R LT+  +    +P +
Sbjct: 65  QLSHNGDGQQVGVIEKAMRLSEDVIRYLTVKQEGPLPAPRV 105


>gi|261880413|ref|ZP_06006840.1| 30S ribosomal protein S6 [Prevotella bergensis DSM 17361]
 gi|270332882|gb|EFA43668.1| 30S ribosomal protein S6 [Prevotella bergensis DSM 17361]
          Length = 114

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 56/96 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S +Q+K+T+ +++ L+ +NG E+      G++ +AY I K    +Y
Sbjct: 1  MNHYETVFILTPVLSDEQMKETVAKFKKLLTDNGAEILNEEAWGLKKMAYAIEKKSTGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +   + P+ + +++   R DE V+R +T+ ++ +
Sbjct: 61 CLLEFKAEPSVVDKLETGYRRDEKVIRFMTVKLEKY 96


>gi|78214178|ref|YP_382957.1| 30S ribosomal protein S6 [Synechococcus sp. CC9605]
 gi|123577268|sp|Q3AG80|RS6_SYNSC RecName: Full=30S ribosomal protein S6
 gi|78198637|gb|ABB36402.1| ribosomal protein S6 [Synechococcus sp. CC9605]
          Length = 124

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 56/102 (54%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ ++ E G EV      G R +AY I K+++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVESHLTKYRDMLVEAGAEVLDNQMRGKRRLAYPIAKHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  +++ MR+ E+V+R LT+  +    +P + 
Sbjct: 65  QLSHNGDGQHVAVLEKAMRLSEDVIRYLTVKQEGPLPAPRVM 106


>gi|228961738|ref|ZP_04123341.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228797932|gb|EEM44942.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar pakistani
           str. T13001]
          Length = 113

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 53/95 (55%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE ++++R  +  +  K  + ++  ++  NG E+    E G R +AY I   R+ +Y
Sbjct: 18  MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFY 77

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           + +N+ S   AI+E  R  +I+E++LR + +  + 
Sbjct: 78  MILNVKSNAEAINEFDRLAKINEDILRHIVVKEEE 112


>gi|120435463|ref|YP_861149.1| 30S ribosomal protein S6 [Gramella forsetii KT0803]
 gi|166226968|sp|A0M0D7|RS6_GRAFK RecName: Full=30S ribosomal protein S6
 gi|117577613|emb|CAL66082.1| 30S ribosomal protein S6 [Gramella forsetii KT0803]
          Length = 112

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 60/111 (54%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +QIK+T+ +Y+  +   G E+    + G+R +AY I+  +  +Y
Sbjct: 1   MNNYETVFILNPVLSDEQIKETVKKYEDFLVSKGAEMVAKEDWGLRKLAYAIQHKKSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
                 +P  AI  ++ + R +E ++R LT+ +D H  +     ++ +++ 
Sbjct: 61  HLFEYKAPGDAIEPLELEFRREERMMRYLTVKLDKHAIAWAEKRRKRNKEK 111


>gi|239828696|ref|YP_002951320.1| 30S ribosomal protein S6 [Geobacillus sp. WCH70]
 gi|259495336|sp|C5D9X6|RS6_GEOSW RecName: Full=30S ribosomal protein S6
 gi|239808989|gb|ACS26054.1| ribosomal protein S6 [Geobacillus sp. WCH70]
          Length = 95

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 58/95 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R ++  +  +  + ++ ++++ENG E+  V + G R +AY I+K R  +Y
Sbjct: 1  MRKYEIMYIIRPNLDDEARQAVVDRFNNILKENGAEITNVTDWGKRRLAYEIKKYRDGHY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ S P A+ E  R  RI ++++R + +  + 
Sbjct: 61 MILNVVSEPKAVQEFDRLARISDDIIRHIVVKEEK 95


>gi|166363872|ref|YP_001656145.1| 30S ribosomal protein S6 [Microcystis aeruginosa NIES-843]
 gi|226703489|sp|B0JSQ9|RS6_MICAN RecName: Full=30S ribosomal protein S6
 gi|166086245|dbj|BAG00953.1| 30S ribosomal protein S6 [Microcystis aeruginosa NIES-843]
          Length = 129

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 30/100 (30%), Positives = 52/100 (52%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR D+  + ++  + +Y++LI E+      V   G + +AY I+K     YV
Sbjct: 3   NNYETLYILRPDLGEEVVQQQVERYRTLITEHSATDIQVKVWGKKRLAYPIKKLNDGVYV 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPT 101
            MN  +    +  M+R MR+ + V+R LTL +D     P 
Sbjct: 63  QMNYQASGKQVAPMERAMRLSDEVIRYLTLKLDRVVAPPA 102


>gi|313672480|ref|YP_004050591.1| ribosomal protein s6 [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939236|gb|ADR18428.1| ribosomal protein S6 [Calditerrivibrio nitroreducens DSM 19672]
          Length = 144

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 55/130 (42%), Gaps = 4/130 (3%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF++   +          +++ LI  NGGE+      G   +AY I K+++  Y
Sbjct: 1   MNTYETVFIVSPALPLDDANAIFEKFKDLISTNGGEILNSEYWGKLKMAYPINKHKEGCY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             +   +      E++ + + DENVLR + + +D         +++ D   +      + 
Sbjct: 61  YLIQYKADGKFNSELETRFKYDENVLRFVVVKLD----GKNYKLRKRDEMTKPRSRRYEE 116

Query: 121 NVDRKQHVSE 130
               + +V E
Sbjct: 117 KPQTEVNVDE 126


>gi|295402139|ref|ZP_06812098.1| ribosomal protein S6 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312112740|ref|YP_003991056.1| ribosomal protein S6 [Geobacillus sp. Y4.1MC1]
 gi|294975822|gb|EFG51441.1| ribosomal protein S6 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311217841|gb|ADP76445.1| ribosomal protein S6 [Geobacillus sp. Y4.1MC1]
          Length = 95

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 58/95 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R ++  +  +  + ++ ++++ENG E+  V + G R +AY I+K R  YY
Sbjct: 1  MRKYEIMYIIRPNLDDEARQALVDRFNNILKENGAEITNVTDWGKRRLAYEIKKYRDGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ S P A+ E  R  RI ++++R + +  + 
Sbjct: 61 MIINVVSEPKAVQEFDRLARISDDIIRHIVVREEE 95


>gi|238926738|ref|ZP_04658498.1| ribosomal protein S6 [Selenomonas flueggei ATCC 43531]
 gi|238885270|gb|EEQ48908.1| ribosomal protein S6 [Selenomonas flueggei ATCC 43531]
          Length = 135

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 55/97 (56%), Gaps = 1/97 (1%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           +LYE +F+++  +  +     I ++  LIQ NGG++   +  G + +AY I+   + YYV
Sbjct: 40  RLYEVIFIVKP-MEEEATNAVIEKFTKLIQANGGKIEKEDRWGKKRLAYEIKDMTEGYYV 98

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQ 98
            + + + PA + E  R M+I +++L+ + +  D  E+
Sbjct: 99  LLYVNAEPACVAECDRVMKITDDLLKHMIVRADGIEE 135


>gi|228473934|ref|ZP_04058675.1| ribosomal protein S6 [Capnocytophaga gingivalis ATCC 33624]
 gi|228274448|gb|EEK13289.1| ribosomal protein S6 [Capnocytophaga gingivalis ATCC 33624]
          Length = 113

 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 50/95 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  QIK+ + ++++ +   G E+    + G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSEAQIKEAVEKFENFLTSKGAEMVAKEDWGLKKLAYSIQNKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
                +P   I   + + R DE V+R LT+ ++ 
Sbjct: 61 HLFEFKAPGDIIESFEVEFRRDERVMRYLTVRLEK 95


>gi|303235712|ref|ZP_07322319.1| ribosomal protein S6 [Prevotella disiens FB035-09AN]
 gi|302484159|gb|EFL47147.1| ribosomal protein S6 [Prevotella disiens FB035-09AN]
          Length = 114

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 56/96 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S +Q+K+ + ++++L+ +NG E+      G++ +AY I+K    +Y
Sbjct: 1  MNQYETVFILTPVLSDEQMKEAVAKFKTLLTDNGAEILNEELWGLKKLAYNIQKKSSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +   + P+ I+ ++   R DE V+R +T+  D +
Sbjct: 61 AMLEFNAEPSVINTLETGFRRDEKVIRYITVKQDKY 96


>gi|296330020|ref|ZP_06872504.1| 30S ribosomal protein S6 [Bacillus subtilis subsp. spizizenii
          ATCC 6633]
 gi|305676744|ref|YP_003868416.1| ribosomal protein S6 [Bacillus subtilis subsp. spizizenii str.
          W23]
 gi|296153059|gb|EFG93924.1| 30S ribosomal protein S6 [Bacillus subtilis subsp. spizizenii
          ATCC 6633]
 gi|305414988|gb|ADM40107.1| ribosomal protein S6 [Bacillus subtilis subsp. spizizenii str.
          W23]
          Length = 95

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 52/95 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R +I  +  K  I ++ +++  NG E+    + G R +AY I   R  +Y
Sbjct: 1  MRKYEVMYIIRPNIDEESKKAVIERFSNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N+ +  AA+ E  R  +I ++++R + +  + 
Sbjct: 61 QIVNVQADAAAVQEFDRLAKISDDIIRHIVVKEEE 95


>gi|221633231|ref|YP_002522456.1| 30S ribosomal protein S6 [Thermomicrobium roseum DSM 5159]
 gi|221156055|gb|ACM05182.1| ribosomal protein S6 [Thermomicrobium roseum DSM 5159]
          Length = 105

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 29/97 (29%), Positives = 57/97 (58%), Gaps = 3/97 (3%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVR---LVNELGMRTIAYRIRKNRKA 58
           + YE + LLR D++  +++  + + ++ + E GG +         G R +AY I+K ++A
Sbjct: 9   RPYELMVLLRPDLADDRLEAALERIRNTVVEQGGTITFEKRDTPWGRRRLAYPIQKFQEA 68

Query: 59  YYVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           +YV   +  PP  + E++R++R++E VLR L + +D 
Sbjct: 69  FYVLFQLVCPPRTVREIERELRLNEQVLRHLMVRLDE 105


>gi|224438131|ref|ZP_03659066.1| 30S ribosomal protein S6 [Helicobacter cinaedi CCUG 18818]
 gi|313144571|ref|ZP_07806764.1| 30S ribosomal protein S6 [Helicobacter cinaedi CCUG 18818]
 gi|313129602|gb|EFR47219.1| 30S ribosomal protein S6 [Helicobacter cinaedi CCUG 18818]
          Length = 136

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 78/136 (57%), Gaps = 1/136 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE +F+L+  +  ++IK  I  ++ +I +NGGE+    ++GMR +AY I+KN++ YY
Sbjct: 1   MKFYETMFILKPTLVEEEIKARIDFFKEVITKNGGEIETCLDMGMRNLAYEIKKNKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND-RFPRD 119
             +   + P+ I E++R  RI+E +LR + +  +S ++        +  +++ + +  + 
Sbjct: 61  FVIYFKAEPSLILELERNYRINEEILRFIVIKYESKKEQNAWQSLVNKANNKPEAKATKP 120

Query: 120 RNVDRKQHVSEEKPLS 135
           +  +  +  ++E P +
Sbjct: 121 KKEETPKADTQESPQA 136


>gi|88803225|ref|ZP_01118751.1| 30S ribosomal protein S6 [Polaribacter irgensii 23-P]
 gi|88780791|gb|EAR11970.1| 30S ribosomal protein S6 [Polaribacter irgensii 23-P]
          Length = 113

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 27/113 (23%), Positives = 54/113 (47%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  QIK+T+ ++   +   G E+    + G++ +AY I+K +  +Y
Sbjct: 1   MNHYETVFILNPVLSDTQIKETVQKFNDYLVSRGAEMISKEDWGLKKLAYPIQKKKSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
             +        I   + + R D++V+R L++ +D H  +         +  + 
Sbjct: 61  HLLEYKVAGEEISAFELEFRRDDSVMRYLSIRLDKHAAAWAKIRTERVKSTKK 113


>gi|323705826|ref|ZP_08117398.1| ribosomal protein S6 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534822|gb|EGB24601.1| ribosomal protein S6 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 95

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 34/95 (35%), Positives = 56/95 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F++  D++ +     I ++++LI E GGE+  V+E G + +AY I K  + YY
Sbjct: 1  MRAYETIFIISPDVNDEARPALIEKFKNLITEKGGEITKVDEWGRKKLAYEIDKKTEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V MN  S     HE++R  +I + +LR L + VD 
Sbjct: 61 VLMNFTSNVDVPHELERVYKITDGILRYLIVKVDK 95


>gi|330995928|ref|ZP_08319823.1| ribosomal protein S6 [Paraprevotella xylaniphila YIT 11841]
 gi|332877545|ref|ZP_08445292.1| ribosomal protein S6 [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|329574267|gb|EGG55842.1| ribosomal protein S6 [Paraprevotella xylaniphila YIT 11841]
 gi|332684651|gb|EGJ57501.1| ribosomal protein S6 [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 113

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 56/113 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + +++ ++ +NG E+      G++ +AY I K    +Y
Sbjct: 1   MNQYETVFILTPVLSDDQMKEAVNKFRGILTDNGAEIINEENWGLKKLAYAIEKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
           + M   + P  I  ++   R DE VLR LT+ ++ +        + +     +
Sbjct: 61  ILMEFKAQPEVIKTLEVNFRRDEKVLRFLTIKMEKYAAEYAEKRRNNKSKKED 113


>gi|315587137|gb|ADU41518.1| 30S ribosomal protein S6 [Helicobacter pylori 35A]
 gi|332674049|gb|AEE70866.1| 30S ribosomal protein S6 [Helicobacter pylori 83]
          Length = 158

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 17  MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 76

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 77  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 136

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 137 EKTEHTHSHHTEEAE 151


>gi|153803776|ref|ZP_01958362.1| ribosomal protein S6 [Vibrio cholerae MZO-3]
 gi|124120686|gb|EAY39429.1| ribosomal protein S6 [Vibrio cholerae MZO-3]
          Length = 95

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 2/94 (2%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE VF++  D  S+Q+   I +Y   I E GG++  + + G R +AY I K  KA+Y
Sbjct: 1  MRHYEIVFMVHPD-QSEQVAGMIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V MN+ +  A + E++   R        + +   
Sbjct: 60 VLMNVEADQAVVDELETAFRFTMQ-SAYMIMRTK 92


>gi|22298822|ref|NP_682069.1| 30S ribosomal protein S6 [Thermosynechococcus elongatus BP-1]
 gi|32171538|sp|Q8DJE6|RS6_THEEB RecName: Full=30S ribosomal protein S6
 gi|22295003|dbj|BAC08831.1| 30S ribosomal protein S6 [Thermosynechococcus elongatus BP-1]
          Length = 114

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 32/90 (35%), Positives = 57/90 (63%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE ++++R D+  +Q++ TI Q+++ ++E G     V   G R  AY I+K R+ YY+
Sbjct: 4  RNYETLYIIRPDVGEEQLEQTISQFRTFLEEQGATKLKVQNRGKRRFAYPIKKLREGYYI 63

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTL 91
           M   +P  AI  ++R MR++EN+LR +T+
Sbjct: 64 LMTYTAPGTAIAPLERAMRLNENILRFMTI 93


>gi|15896955|ref|NP_350304.1| 30S ribosomal protein S6 [Clostridium acetobutylicum ATCC 824]
 gi|24212323|sp|Q97CX2|RS6_CLOAB RecName: Full=30S ribosomal protein S6
 gi|15026830|gb|AAK81644.1|AE007867_11 Ribosomal protein S6 [Clostridium acetobutylicum ATCC 824]
 gi|325511132|gb|ADZ22768.1| 30S ribosomal protein S6 [Clostridium acetobutylicum EA 2018]
          Length = 95

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 50/95 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +F+L   +  + I   + +++S+I   GGEV  V+  G R +AY I K  +  Y
Sbjct: 1  MNKYETLFILNPSLDEEGINTNVEKFKSVITNGGGEVENVDLWGKRKLAYEIDKVNEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V +N  S      E+ R  RI ++++R L + ++ 
Sbjct: 61 VLVNFQSDAQLPKELDRVFRISDSIIRHLIISLEK 95


>gi|88809379|ref|ZP_01124887.1| 30S ribosomal protein S6 [Synechococcus sp. WH 7805]
 gi|88786598|gb|EAR17757.1| 30S ribosomal protein S6 [Synechococcus sp. WH 7805]
          Length = 123

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 56/102 (54%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ ++ E G +V      G R +AY I K+++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVESHLTKYRDILVETGADVLDNQMRGKRRLAYPIAKHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  +++ MR+ E+V+R LT+  +    +P + 
Sbjct: 65  QLSHNGDGQQVAVLEKAMRLSEDVIRYLTVKQEGPLPAPRVV 106


>gi|169832353|ref|YP_001718335.1| 30S ribosomal protein S6 [Candidatus Desulforudis audaxviator
          MP104C]
 gi|226703452|sp|B1I6T1|RS6_DESAP RecName: Full=30S ribosomal protein S6
 gi|169639197|gb|ACA60703.1| ribosomal protein S6 [Candidatus Desulforudis audaxviator MP104C]
          Length = 94

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 52/94 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++L+ D+  ++    I ++  +I +  GE+  +N  G R +AY I+  R+ +Y
Sbjct: 1  MRQYEVMYILKPDLEDEESTQLIEKFSKIITDRDGEITELNRWGKRRLAYEIKDYREGHY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V M   +  AA  E+ R  RI + +LR + +  D
Sbjct: 61 VVMKCRAEHAAAQELDRVFRITDGLLRHMIIRED 94


>gi|94263202|ref|ZP_01287019.1| Ribosomal protein S6 [delta proteobacterium MLMS-1]
 gi|94270366|ref|ZP_01291724.1| Ribosomal protein S6 [delta proteobacterium MLMS-1]
 gi|93450832|gb|EAT01865.1| Ribosomal protein S6 [delta proteobacterium MLMS-1]
 gi|93456420|gb|EAT06540.1| Ribosomal protein S6 [delta proteobacterium MLMS-1]
          Length = 126

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 31/96 (32%), Positives = 55/96 (57%), Gaps = 1/96 (1%)

Query: 1  MKLYEHVFLLRQ-DISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAY 59
          M+ YE V ++R    +  +I     +Y ++I E  GEV  VN  G++ +AY ++K  + +
Sbjct: 1  MRKYESVIIVRPGAAAEAEITAVSDKYAAVISEYQGEVASVNHWGLKRLAYPVKKENQGF 60

Query: 60 YVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          Y+ +     P  I EM+R +RID+ +L+ LT+ +D 
Sbjct: 61 YLLLRYLCNPDGIKEMERLLRIDDRILKFLTVRLDD 96


>gi|332800525|ref|YP_004462024.1| 30S ribosomal protein S6 [Tepidanaerobacter sp. Re1]
 gi|332698260|gb|AEE92717.1| 30S ribosomal protein S6 [Tepidanaerobacter sp. Re1]
          Length = 95

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 54/95 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE VF++  +  + ++K  + +++ +I++ GGEV  V+E G   +AY I   R+ +Y
Sbjct: 1  MRQYETVFIIDPEFEADEVKALVEKFKGMIEDQGGEVTEVDEWGKLRLAYPINDKREGHY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            MN  + PA   +++R  +I   ++R L +  + 
Sbjct: 61 FLMNFTANPATAQDLERVYKITNGLMRYLIINKEK 95


>gi|320353928|ref|YP_004195267.1| ribosomal protein S6 [Desulfobulbus propionicus DSM 2032]
 gi|320122430|gb|ADW17976.1| ribosomal protein S6 [Desulfobulbus propionicus DSM 2032]
          Length = 141

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 34/133 (25%), Positives = 69/133 (51%), Gaps = 2/133 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE  F+LR ++   Q  + I +  ++I  + G +  ++  G++ +AY I K  + YY
Sbjct: 1   MRHYETTFILRPNLGEDQFTEIIDRTTAIINGDEGSIICLDRWGIKRLAYEINKEVQGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD- 119
           V++N A+P   + E++R  RID+ VLR LT+ +     +  +  ++    ++     +  
Sbjct: 61  VYLNYAAPGKTVDEIERIFRIDDRVLRYLTVKLGDSMNAAAIEAEKQRIAEKAAAREKAL 120

Query: 120 -RNVDRKQHVSEE 131
             + +  +  SEE
Sbjct: 121 SEDAENDEFDSEE 133


>gi|229496130|ref|ZP_04389851.1| ribosomal protein S6 [Porphyromonas endodontalis ATCC 35406]
 gi|229316961|gb|EEN82873.1| ribosomal protein S6 [Porphyromonas endodontalis ATCC 35406]
          Length = 115

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 57/111 (51%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S QQ+K+T+ ++  L++E G E+      G++ +AY I K    +Y
Sbjct: 1   MNSYETVFILTPVLSDQQMKETVQKFVDLLKEQGSEIVNEENWGLKMLAYPIDKKTTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
            F+   + P+ I +++   R DE VLR LT+  D   +      +    + 
Sbjct: 61  QFVEFNAEPSVIKKLEVNFRRDERVLRFLTIRQDKFAREYAEKRRNLKSNK 111


>gi|186685611|ref|YP_001868807.1| 30S ribosomal protein S6 [Nostoc punctiforme PCC 73102]
 gi|226695106|sp|B2J6T8|RS6_NOSP7 RecName: Full=30S ribosomal protein S6
 gi|186468063|gb|ACC83864.1| ribosomal protein S6 [Nostoc punctiforme PCC 73102]
          Length = 116

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 33/92 (35%), Positives = 55/92 (59%)

Query: 3  LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
           YE +++LR D+  +Q +  I +YQ+L+++ G E   +   G R +AY I+K+R   Y+ 
Sbjct: 4  NYETMYILRPDLGDEQAEQAITKYQNLLRDQGAEDIQIQNRGKRRLAYEIKKHRDGIYIQ 63

Query: 63 MNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          +N  +P  AI   +R MR+ E V+R LT+  D
Sbjct: 64 LNYTAPATAIAPFERAMRLSEEVIRYLTIKQD 95


>gi|302390768|ref|YP_003826589.1| SSU ribosomal protein S6P [Thermosediminibacter oceani DSM 16646]
 gi|302201396|gb|ADL08966.1| SSU ribosomal protein S6P [Thermosediminibacter oceani DSM 16646]
          Length = 95

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/95 (33%), Positives = 57/95 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++L  ++  + I   + ++++LI+E GGEV+ ++  G R +AY I   ++ YY
Sbjct: 1  MREYETMYILDPELDEESINGLVDKFKALIEERGGEVKEIDRWGKRRLAYPISHRKEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V MN ++ P+A  EM+R  +I   VLR +    D 
Sbjct: 61 VVMNFSATPSAAQEMERVFKITTGVLRHIIFRKDK 95


>gi|319938328|ref|ZP_08012724.1| 30S ribosomal protein S6 [Coprobacillus sp. 29_1]
 gi|319806511|gb|EFW03173.1| 30S ribosomal protein S6 [Coprobacillus sp. 29_1]
          Length = 94

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 52/94 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +F+++ D+        I  ++ ++    G V  VNE G+R +AY I+   K YY
Sbjct: 1  MNKYEIMFIVKPDVEEDARNAIIENFKKVLTNTEGTVDNVNEWGLRDLAYEIKDYTKGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V ++  + PA I E +R  RI+ N+LR LTL  D
Sbjct: 61 VVLDTTTTPANIAEFERLSRINANMLRHLTLRRD 94


>gi|255527664|ref|ZP_05394523.1| ribosomal protein S6 [Clostridium carboxidivorans P7]
 gi|296186803|ref|ZP_06855204.1| ribosomal protein S6 [Clostridium carboxidivorans P7]
 gi|255508644|gb|EET85025.1| ribosomal protein S6 [Clostridium carboxidivorans P7]
 gi|296048517|gb|EFG87950.1| ribosomal protein S6 [Clostridium carboxidivorans P7]
          Length = 95

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 50/95 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+L   +  + +K  + +++ +I+  GG V  V+  G R +AY I K  +  Y
Sbjct: 1  MRKYETIFILHPSLDEEAVKANVEKFKGVIENGGGVVDNVDAWGKRKLAYEINKIGEGTY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N ++ P    E+ R  RI + V+R + +  + 
Sbjct: 61 TLINFSAGPELPKELDRVFRITDTVIRHIIVKDEK 95


>gi|288926385|ref|ZP_06420307.1| ribosomal protein S6 [Prevotella buccae D17]
 gi|315608714|ref|ZP_07883692.1| 30S ribosomal protein S6 [Prevotella buccae ATCC 33574]
 gi|288336838|gb|EFC75202.1| ribosomal protein S6 [Prevotella buccae D17]
 gi|315249564|gb|EFU29575.1| 30S ribosomal protein S6 [Prevotella buccae ATCC 33574]
          Length = 114

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 56/96 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S +Q+K+T+ +++ L+ +NG E+      G++ +AY I+K    +Y
Sbjct: 1  MNQYETVFILTPVLSDEQMKETVAKFKKLLTDNGAELVSEETWGLKKLAYNIQKKTSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
                + P+ I +++   R +E V+R +T+ +D +
Sbjct: 61 CLFEFKAEPSVIEKLETGFRREEKVIRYMTVKLDKY 96


>gi|284929659|ref|YP_003422181.1| 30S ribosomal protein S6P [cyanobacterium UCYN-A]
 gi|284810103|gb|ADB95800.1| SSU ribosomal protein S6P [cyanobacterium UCYN-A]
          Length = 141

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 64/135 (47%), Gaps = 2/135 (1%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
            YE +++LR D+S +Q    + +YQ  + +N      VN  G R +AY I+K     YV 
Sbjct: 4   HYEMIYILRPDLSEEQANQAVTKYQDFLIKNNAIDIKVNVWGKRRLAYPIQKKLDGIYVQ 63

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD--R 120
            N  +    I  ++R MR++E+VLR LT+ V+      T  +  ++ +    +   +   
Sbjct: 64  FNYQADGTQIEPLERIMRLEEDVLRYLTIKVEEDLIEQTSELDNNEINPEIVKKSEELDN 123

Query: 121 NVDRKQHVSEEKPLS 135
           N  +       +P++
Sbjct: 124 NNPKTSEAKTVEPIA 138


>gi|148240853|ref|YP_001226240.1| 30S ribosomal protein S6 [Synechococcus sp. WH 7803]
 gi|166227397|sp|A5GPS8|RS6_SYNPW RecName: Full=30S ribosomal protein S6
 gi|147849392|emb|CAK24943.1| 30S ribosomal protein S6 [Synechococcus sp. WH 7803]
          Length = 123

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 56/102 (54%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ ++ E G +V      G R +AY I K+++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVESHLTKYRDILVEAGADVLDNQMRGKRRLAYPIAKHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  +++ MR+ E+V+R LT+  +    +P + 
Sbjct: 65  QLSHNGDGQQVAVLEKVMRLSEDVIRYLTVKQEGPLPAPRVV 106


>gi|67921027|ref|ZP_00514546.1| Ribosomal protein S6 [Crocosphaera watsonii WH 8501]
 gi|67857144|gb|EAM52384.1| Ribosomal protein S6 [Crocosphaera watsonii WH 8501]
          Length = 111

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/91 (32%), Positives = 46/91 (50%)

Query: 4  YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
          YE +F+LR D+S  Q+   +  Y+  +  N      V   G R +AY I+K     YV  
Sbjct: 5  YEMIFILRPDLSEDQVNQALNSYKEFLTTNNATNLEVKIWGKRRLAYPIQKKVDGIYVQF 64

Query: 64 NIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          N  +    I  ++R MR+ E V+R LT+ +D
Sbjct: 65 NYEADGTQIAPLERMMRLGEEVMRYLTIRLD 95


>gi|254526151|ref|ZP_05138203.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9202]
 gi|221537575|gb|EEE40028.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9202]
          Length = 143

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 67/128 (52%), Gaps = 6/128 (4%)

Query: 7   VFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIA 66
           +++LR DI+  ++ + I +Y  L++E GG +      G R +AY+I K+R+  YV ++  
Sbjct: 1   MYILRPDIAEDEVTNHIDKYNKLLEEFGGSILDSQMRGKRRLAYQIAKHREGIYVQLSHQ 60

Query: 67  SPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNVDRKQ 126
                I ++++ MR+ E+V+R +T+  +    +P  + +   + D        +N + K 
Sbjct: 61  GDGQHIFKIEKAMRLSEDVIRYMTVKQEGPLPTPRPSTKSSTQAD------DQKNPETKV 114

Query: 127 HVSEEKPL 134
               E+P+
Sbjct: 115 ESKGEQPV 122


>gi|119513487|ref|ZP_01632511.1| Ribosomal protein S6 [Nodularia spumigena CCY9414]
 gi|119461867|gb|EAW42880.1| Ribosomal protein S6 [Nodularia spumigena CCY9414]
          Length = 113

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/91 (40%), Positives = 54/91 (59%)

Query: 4  YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
          YE +++LR D+  +Q++  I +YQ L+ E G E   +   G R +AY I+K+R   YV M
Sbjct: 5  YETIYILRPDLGEEQVEQAIAKYQGLLTEQGAENIEIQNRGKRRLAYEIKKHRDGIYVQM 64

Query: 64 NIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          N   P  AI  M+R MR+ E V+R LT+  D
Sbjct: 65 NYTGPGTAIAPMERAMRLSEEVIRYLTIKQD 95


>gi|88607094|ref|YP_504775.1| 30S ribosomal protein S6 [Anaplasma phagocytophilum HZ]
 gi|123495753|sp|Q2GLH6|RS6_ANAPZ RecName: Full=30S ribosomal protein S6
 gi|88598157|gb|ABD43627.1| ribosomal protein S6 [Anaplasma phagocytophilum HZ]
          Length = 109

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 55/104 (52%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE  F+ +Q ++  +++       +L+ + G E+      G+    Y I KN K +Y
Sbjct: 1   MPFYEFAFIAQQGLTQYELEGLSKGLTALLVKMGAELVKYEYWGLLDFVYSIAKNNKGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
             M I + PAA+ E KRK++++E+VLR L L VD   +  +  +
Sbjct: 61  CMMYIRAEPAAMDEFKRKVKLNEDVLRFLCLKVDKVPEGRSAMM 104


>gi|189462619|ref|ZP_03011404.1| hypothetical protein BACCOP_03311 [Bacteroides coprocola DSM 17136]
 gi|198276876|ref|ZP_03209407.1| hypothetical protein BACPLE_03081 [Bacteroides plebeius DSM 17135]
 gi|189430780|gb|EDU99764.1| hypothetical protein BACCOP_03311 [Bacteroides coprocola DSM 17136]
 gi|198270401|gb|EDY94671.1| hypothetical protein BACPLE_03081 [Bacteroides plebeius DSM 17135]
          Length = 115

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 57/115 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+ + ++++++ + G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDVQMKEAVEKFKAILTQEGAEIINEENWGLKKLAYPIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
             +   + P+ I +++   R DE V+R LT  +D +        +      + + 
Sbjct: 61  QLIEFKAEPSVIEKLEVNYRRDERVIRFLTFKMDKYAAEYAAKRRNVKSTKKEEN 115


>gi|188997590|ref|YP_001931841.1| ribosomal protein S6 [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188932657|gb|ACD67287.1| ribosomal protein S6 [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 104

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE VF+L+  +S ++IK  +   + LIQ+N GE+      G R +AY I K    YY
Sbjct: 1  MRHYELVFVLKPTLSEEEIKTRVQAIKDLIQQNQGEIYNEENWGRRNLAYPINKFNSGYY 60

Query: 61 VFMNIA-SPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N           ++  +RI+E+V+R L + + 
Sbjct: 61 FLINFKTGNSNLPATLEYNLRINEDVIRFLNMKLK 95


>gi|32491011|ref|NP_871265.1| 30S ribosomal protein S6 [Wigglesworthia glossinidia endosymbiont
           of Glossina brevipalpis]
 gi|31340385|sp|Q8D2U2|RS6_WIGBR RecName: Full=30S ribosomal protein S6
 gi|25166217|dbj|BAC24408.1| rpsF [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 113

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V ++  D  S QI + I  Y  +I+ N G +  + + G R +AY I+K  KA+Y
Sbjct: 1   MRHYEIVLMIHTD-QSDQISNIIEHYTKMIKINKGSIHRLEDWGRRQLAYPIKKLNKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           + MNI +    ++ + + + ++  ++R++ + V +    P+   +  +  +
Sbjct: 60  ILMNIETSTKVLNNIIQDLNLNNFIIRNMIMRVKNAINEPSPMKKTKENKE 110


>gi|32266035|ref|NP_860067.1| 30S ribosomal protein S6 [Helicobacter hepaticus ATCC 51449]
 gi|61215713|sp|Q7VIR8|RS6_HELHP RecName: Full=30S ribosomal protein S6
 gi|32262084|gb|AAP77133.1| ribosomal protein S6 [Helicobacter hepaticus ATCC 51449]
          Length = 137

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 73/132 (55%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE +F+L+  +   +IK  +  ++ +I +NGGE+    ++GMR +AY I+KN++ YY
Sbjct: 1   MKFYETMFILKPTLVEVEIKARLDFFKEVIIKNGGEIETCLDMGMRNLAYEIKKNKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             +   + P+ I E++R  RI+E +LR + +  +S ++        +  +++ +  P   
Sbjct: 61  FVIYFKAQPSLILELERNYRINEEILRFIVIKYESKKEQSAWQSLVNKANNKPEPKPTKA 120

Query: 121 NVDRKQHVSEEK 132
             +     ++E+
Sbjct: 121 KKEDVAPEAKEQ 132


>gi|150019894|ref|YP_001312148.1| 30S ribosomal protein S6 [Clostridium beijerinckii NCIMB 8052]
 gi|189045460|sp|A6M3L2|RS6_CLOB8 RecName: Full=30S ribosomal protein S6
 gi|149906359|gb|ABR37192.1| ribosomal protein S6 [Clostridium beijerinckii NCIMB 8052]
          Length = 95

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 48/92 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+L      + +K  I +++ +I+  GG V  V+  G R +AY I K  + +Y
Sbjct: 1  MRKYETIFILNPSFDEETVKANIEKFKGVIENGGGTVENVDFWGKRKLAYEISKVSEGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
            +N  + P    E+ R  RI + V+R + + 
Sbjct: 61 TLVNFTANPELPRELDRIFRITDGVIRHIIVN 92


>gi|323342370|ref|ZP_08082602.1| 30S ribosomal protein S6 [Erysipelothrix rhusiopathiae ATCC
          19414]
 gi|322463482|gb|EFY08676.1| 30S ribosomal protein S6 [Erysipelothrix rhusiopathiae ATCC
          19414]
          Length = 96

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 51/96 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++++  +  +     I +  +++ +NG  +  VNE G+R +AY I   +K YY
Sbjct: 1  MRKYEVMYIVKPTLDEEARTAVIAKLHAILTDNGATIDEVNEWGLRELAYEIEDFKKGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
          V     S   A++E  R  RI+ +V+R + +  D  
Sbjct: 61 VVTQFTSGDEAVNEFNRLTRINNDVIRHMIVRQDEI 96


>gi|157165390|ref|YP_001467164.1| 30S ribosomal protein S6 [Campylobacter concisus 13826]
 gi|166226813|sp|A7ZEF6|RS6_CAMC1 RecName: Full=30S ribosomal protein S6
 gi|112801440|gb|EAT98784.1| ribosomal protein S6 [Campylobacter concisus 13826]
          Length = 139

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/139 (29%), Positives = 75/139 (53%), Gaps = 9/139 (6%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE +F+L+  ++ +++K  +   + +I +NGGE+  V E+G R +AY I+K  +  Y
Sbjct: 1   MKHYELLFILKPTLTEEEVKAKVDFVKEVITKNGGEIATVIEMGTRKLAYTIKKYERGTY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL---------TIQRHDRDD 111
             +   +PPA + E+ R +RI E+++R L++  ++  +             TI++  R+ 
Sbjct: 61  FVIYYKAPPALLAELTRNVRITEDIIRFLSVKYENKREIAAWERLCKGIKQTIKKEPREP 120

Query: 112 RNDRFPRDRNVDRKQHVSE 130
           R  R PR   VD +    E
Sbjct: 121 RAPREPRVEKVDEQTFTEE 139


>gi|325857464|ref|ZP_08172519.1| ribosomal protein S6 [Prevotella denticola CRIS 18C-A]
 gi|327314150|ref|YP_004329587.1| 30S ribosomal protein S6 [Prevotella denticola F0289]
 gi|325483174|gb|EGC86154.1| ribosomal protein S6 [Prevotella denticola CRIS 18C-A]
 gi|326946235|gb|AEA22120.1| ribosomal protein S6 [Prevotella denticola F0289]
          Length = 114

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 56/96 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S +Q+K+T+ +++ L+ +NG E+      G++ +AY I+K    +Y
Sbjct: 1  MNQYETVFILTPVLSDEQMKETVAKFRKLLADNGAEILNEEAWGLKKLAYNIQKKSSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +   + P+ I+ ++   R DE V+R +T+  D +
Sbjct: 61 ALLEFNAEPSVIYTLETAFRRDEKVIRYITVKQDKY 96


>gi|33864523|ref|NP_896083.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9313]
 gi|61216285|sp|Q7V3T1|RS6_PROMM RecName: Full=30S ribosomal protein S6
 gi|33641303|emb|CAE22433.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9313]
          Length = 124

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 55/102 (53%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ ++ E G EV      G R +AY I  +++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVETHVTKYREMVTEAGAEVLDNQMRGKRRLAYPISNHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  +++ MR+ E+V+R LT+  +    +P + 
Sbjct: 65  QLSHNGNGQQVAVLEKAMRLSEDVIRYLTVKQEGPLPAPRIV 106


>gi|170077069|ref|YP_001733707.1| ribosomal protein S6 [Synechococcus sp. PCC 7002]
 gi|226695134|sp|B1XP08|RS6_SYNP2 RecName: Full=30S ribosomal protein S6
 gi|169884738|gb|ACA98451.1| ribosomal protein S6 [Synechococcus sp. PCC 7002]
          Length = 115

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 55/93 (59%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
            YE +++LR D+S +Q+++   +Y++++Q++G     V   G R +AY I+      Y+
Sbjct: 3  NNYEMMYILRPDLSEEQVQEVSSKYKTMLQDSGASDLQVQVRGKRHLAYPIQNFNDGIYI 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           +N  +  + I  ++R MR+ E V+R LT+ +D
Sbjct: 63 QVNYKADGSQIKAVERDMRLGEMVIRYLTMKLD 95


>gi|16081143|ref|NP_391971.1| 30S ribosomal protein S6 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|221312073|ref|ZP_03593920.1| 30S ribosomal protein S6 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|221316398|ref|ZP_03598203.1| 30S ribosomal protein S6 [Bacillus subtilis subsp. subtilis str.
          NCIB 3610]
 gi|221321311|ref|ZP_03602605.1| 30S ribosomal protein S6 [Bacillus subtilis subsp. subtilis str.
          JH642]
 gi|221325594|ref|ZP_03606888.1| 30S ribosomal protein S6 [Bacillus subtilis subsp. subtilis str.
          SMY]
 gi|321313651|ref|YP_004205938.1| 30S ribosomal protein S6 [Bacillus subtilis BSn5]
 gi|585949|sp|P21468|RS6_BACSU RecName: Full=30S ribosomal protein S6; AltName: Full=BS9
 gi|467375|dbj|BAA05221.1| ribosomal protein S6 [Bacillus subtilis]
 gi|2636638|emb|CAB16128.1| ribosomal protein S6 (BS9) [Bacillus subtilis subsp. subtilis
          str. 168]
 gi|291486728|dbj|BAI87803.1| 30S ribosomal protein S6 [Bacillus subtilis subsp. natto BEST195]
 gi|320019925|gb|ADV94911.1| 30S ribosomal protein S6 [Bacillus subtilis BSn5]
          Length = 95

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 52/95 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R +I  +  K  I ++ +++  NG E+    + G R +AY I   R  +Y
Sbjct: 1  MRKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N+ S  AA+ E  R  +I ++++R + +  + 
Sbjct: 61 QIVNVQSDAAAVQEFDRLAKISDDIIRHIVVKEEE 95


>gi|71083408|ref|YP_266127.1| 30S ribosomal protein S6 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91762169|ref|ZP_01264134.1| ribosomal protein S6 [Candidatus Pelagibacter ubique HTCC1002]
 gi|91207928|sp|Q4FMR5|RS6_PELUB RecName: Full=30S ribosomal protein S6
 gi|71062521|gb|AAZ21524.1| ribosomal protein S6 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717971|gb|EAS84621.1| ribosomal protein S6 [Candidatus Pelagibacter ubique HTCC1002]
          Length = 121

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 64/121 (52%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH  + RQD S  Q+K    +Y  ++++N GE+    + G+  +AY I+KN+K  Y
Sbjct: 1   MNLYEHTIVARQDTSPAQVKQLTEKYSKIVEKNEGEIVQTEDWGLLNLAYIIKKNKKGIY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           +   I  P   I E+++   ID+N+LR +T+ V           ++ + + +  +   +R
Sbjct: 61  MHFKIKGPGKIIDELEKNEAIDKNLLRYMTVKVKKFNLEAKYFSKKDEYEKKEYKKEYNR 120

Query: 121 N 121
           +
Sbjct: 121 D 121


>gi|322379200|ref|ZP_08053591.1| 30S ribosomal protein S6 [Helicobacter suis HS1]
 gi|321148340|gb|EFX42849.1| 30S ribosomal protein S6 [Helicobacter suis HS1]
          Length = 157

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 60/101 (59%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           K YE +F+L+  +  + IKD +  YQ +I ++GGEV    ++G R +AY I+K+++ YY 
Sbjct: 24  KHYETMFILKPTLVEEDIKDKLAFYQEVITKSGGEVVNTLDMGHRNLAYEIQKHKRGYYF 83

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
            +   +    + E++R  RI+E++LR + L  +S ++    
Sbjct: 84  VIYFTAHADVVLELERLYRINEDILRFMILKYESKKEQKAW 124


>gi|81298823|ref|YP_399031.1| 30S ribosomal protein S6 [Synechococcus elongatus PCC 7942]
 gi|123557696|sp|Q31SC5|RS6_SYNE7 RecName: Full=30S ribosomal protein S6
 gi|81167704|gb|ABB56044.1| SSU ribosomal protein S6P [Synechococcus elongatus PCC 7942]
          Length = 107

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/98 (34%), Positives = 57/98 (58%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
            YE +++LR D++ +Q++  I +YQ+L+ E G EV+     G R +AY I K R+  YV 
Sbjct: 5   YYETMYILRADLTEEQVEQAIAKYQTLLTEAGAEVQDTQHRGKRRLAYLINKQREGIYVQ 64

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
           +N     + I  ++R +R+ E VLR LT+  +    +P
Sbjct: 65  INYTGDGSQIAPLERALRLSEEVLRFLTVKQEVRPPAP 102


>gi|56416479|ref|YP_153553.1| 30S ribosomal protein S6 [Anaplasma marginale str. St. Maries]
 gi|222474848|ref|YP_002563263.1| 30S ribosomal protein S6 (rpsF) [Anaplasma marginale str. Florida]
 gi|56387711|gb|AAV86298.1| 30S ribosomal protein S6 [Anaplasma marginale str. St. Maries]
 gi|222418984|gb|ACM49007.1| 30S ribosomal protein S6 (rpsF) [Anaplasma marginale str. Florida]
          Length = 127

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/103 (30%), Positives = 56/103 (54%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
            +YE  F+ +Q ++  +++       +L+ + G E+      G+   AY I KN K +Y 
Sbjct: 20  PIYEFAFIAQQGLTQYELEGLSKGLSALLVKIGAELVKYEYWGLLDFAYSIAKNNKGHYC 79

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
            M I + PAA+ E +R++R++E+VLR L L VD   +  +  +
Sbjct: 80  MMYIRAEPAAMDEFRRRVRLNEDVLRFLCLKVDKVCEGKSAMM 122


>gi|119492201|ref|ZP_01623611.1| Ribosomal protein S6 [Lyngbya sp. PCC 8106]
 gi|119453258|gb|EAW34424.1| Ribosomal protein S6 [Lyngbya sp. PCC 8106]
          Length = 119

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/98 (37%), Positives = 55/98 (56%)

Query: 4   YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
           YE +++LR D+  +Q+   I +YQ L+QE GG+   +  LG R +AY I  +R+  YV M
Sbjct: 6   YETMYILRPDLIDEQVDVAIAKYQDLLQEQGGQNIQIQNLGKRRLAYEIDNHREGVYVLM 65

Query: 64  NIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPT 101
           N   P   I  M+R MRI ++V+R LT    +     T
Sbjct: 66  NYDGPGHQIAVMERAMRISDDVIRYLTTKQPALPVEAT 103


>gi|197119137|ref|YP_002139564.1| 30S ribosomal protein S6 [Geobacter bemidjiensis Bem]
 gi|226703471|sp|B5EHW9|RS6_GEOBB RecName: Full=30S ribosomal protein S6
 gi|197088497|gb|ACH39768.1| ribosomal protein S6 [Geobacter bemidjiensis Bem]
          Length = 134

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 57/101 (56%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           ++YE +++++ D+  ++IK    + Q +I    G+ + V + G R +AY I KN +  Y 
Sbjct: 3   RMYETIYIVQPDLGDEEIKALSTKVQDVIASMNGDFKRVEDWGTRKLAYPINKNPRGRYF 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
           ++        I E++R++R+D+ V+R  ++ +++   +P  
Sbjct: 63  YLRFDGDSGLIAELERRLRLDDKVIRYQSVKLETEVVAPAA 103


>gi|118579196|ref|YP_900446.1| 30S ribosomal protein S6 [Pelobacter propionicus DSM 2379]
 gi|166227361|sp|A1AM18|RS6_PELPD RecName: Full=30S ribosomal protein S6
 gi|118501906|gb|ABK98388.1| SSU ribosomal protein S6P [Pelobacter propionicus DSM 2379]
          Length = 129

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/105 (26%), Positives = 58/105 (55%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +++L+ D+S   IK    + Q +I    G+ + + + G+R +AY I K  +  Y
Sbjct: 1   MRKYETIYILQPDLSEDDIKVVADKVQDVITSYKGDFQRLEDWGIRKLAYPINKCARGRY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ 105
           +++        I E++R++R+DE VLR  ++ + +  + P +  +
Sbjct: 61  LYLRYDGGREMIAELERRLRLDEKVLRFQSVNITNQPEKPVVEKK 105


>gi|157694462|ref|YP_001488924.1| 30S ribosomal protein S6 [Bacillus pumilus SAFR-032]
 gi|194016480|ref|ZP_03055094.1| ribosomal protein S6 [Bacillus pumilus ATCC 7061]
 gi|167011243|sp|A8FJE7|RS6_BACP2 RecName: Full=30S ribosomal protein S6
 gi|157683220|gb|ABV64364.1| ribosomal protein S6 [Bacillus pumilus SAFR-032]
 gi|194011953|gb|EDW21521.1| ribosomal protein S6 [Bacillus pumilus ATCC 7061]
          Length = 95

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 52/94 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R  +  +  K  I ++ +++  NG E+    + G R +AY I   R+ +Y
Sbjct: 1  MRKYEVMYIIRPTVDDEAKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N+ S  AA+ E  R  +I ++++R + +  +
Sbjct: 61 QIVNVQSDAAAVQEFDRLAKISDDIIRHIVVKEE 94


>gi|218441702|ref|YP_002380031.1| ribosomal protein S6 [Cyanothece sp. PCC 7424]
 gi|226703448|sp|B7KD42|RS6_CYAP7 RecName: Full=30S ribosomal protein S6
 gi|218174430|gb|ACK73163.1| ribosomal protein S6 [Cyanothece sp. PCC 7424]
          Length = 176

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/98 (31%), Positives = 55/98 (56%)

Query: 4   YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
           YE V++LR D+  +Q++  I +Y+  + EN  +   +   G R +AY I+K +  +YV M
Sbjct: 5   YEMVYILRPDLLEEQVQQEINRYRDFLTENEAQEVQIKYWGKRRLAYPIKKLQDGFYVQM 64

Query: 64  NIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPT 101
           N       I  ++R MR+ + V+R LT+ +D  + +P 
Sbjct: 65  NYQGDGKQIAPLERMMRLSDEVIRYLTIKLDKDQYTPN 102


>gi|110799639|ref|YP_697332.1| 30S ribosomal protein S6 [Clostridium perfringens ATCC 13124]
 gi|110802528|ref|YP_699891.1| 30S ribosomal protein S6 [Clostridium perfringens SM101]
 gi|24212304|sp|Q8XH43|RS6_CLOPE RecName: Full=30S ribosomal protein S6
 gi|122958624|sp|Q0TM08|RS6_CLOP1 RecName: Full=30S ribosomal protein S6
 gi|123145831|sp|Q0SPR6|RS6_CLOPS RecName: Full=30S ribosomal protein S6
 gi|110674286|gb|ABG83273.1| 30S ribosomal protein S6 [Clostridium perfringens ATCC 13124]
 gi|110683029|gb|ABG86399.1| 30S ribosomal protein S6 [Clostridium perfringens SM101]
          Length = 95

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 47/94 (50%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+    +  + +K  I +++ +I+   G V  V+  G R +AY I K  + YY
Sbjct: 1  MRKYETIFVAHPSLDEEAVKALIEKFKGVIENGNGTVDNVDFWGKRKLAYEIAKVNEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N  + P    E+ R   I + ++R + +  +
Sbjct: 61 TLINFTANPELPKELDRVFGITDGIIRHIIVKEE 94


>gi|258517419|ref|YP_003193641.1| 30S ribosomal protein S6 [Desulfotomaculum acetoxidans DSM 771]
 gi|257781124|gb|ACV65018.1| ribosomal protein S6 [Desulfotomaculum acetoxidans DSM 771]
          Length = 95

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 52/95 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+++ D+  +Q    I +++ +I+ NGGE+  +++ G R +AY I   R  YY
Sbjct: 1  MRNYETLFIIKADLEEEQTTAVIEKFKGIIEANGGEITKLDKWGKRRLAYEINHMRDGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V +   +      E+ R  +I + V+R + +  D 
Sbjct: 61 VCVKFKAGSETSQELDRVFKITDEVIRHVIIREDE 95


>gi|205371928|ref|ZP_03224748.1| 30S ribosomal protein S6 [Bacillus coahuilensis m4-4]
          Length = 97

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 1/96 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R +I  +  K  + ++  +I  NGGE+    E G R +AY I   R  +Y
Sbjct: 1  MRKYEVMYIVRPNIEDEAKKALVERFSGIITTNGGEIIESKEWGKRRLAYEINDFRDGFY 60

Query: 61 VFMNIAS-PPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            MN+ +    A+ E  R  +I ++++R + + VD 
Sbjct: 61 YIMNVQASNTDAVSEFDRLAKISDDIIRHIAVRVDE 96


>gi|300727907|ref|ZP_07061285.1| ribosomal protein S6 [Prevotella bryantii B14]
 gi|299774749|gb|EFI71363.1| ribosomal protein S6 [Prevotella bryantii B14]
          Length = 113

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 58/113 (51%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+ + +++ ++ +NG E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKEAVAKFKKVLTDNGAEILNEEAWGLKKMAYAIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
             +     P  +++++   R DE V+R +T+ +D +        ++   +   
Sbjct: 61  CLVEFKGEPTLVNKLETAYRRDEKVIRYITVKLDKYAAQYAEKRRKKLGNKEA 113


>gi|33867041|ref|NP_898600.1| 30S ribosomal protein S6 [Synechococcus sp. WH 8102]
 gi|61216277|sp|Q7U3C1|RS6_SYNPX RecName: Full=30S ribosomal protein S6
 gi|33639642|emb|CAE09026.1| 30S ribosomal protein S6 [Synechococcus sp. WH 8102]
          Length = 127

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 56/102 (54%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ ++ E G +V      G R +AY I K+++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVESHLTKYRDMLVEAGADVLDNQMRGKRRLAYPIDKHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  +++ MR+ E+V+R LT+  +    +P + 
Sbjct: 65  QLSHNGDGQQVAVLEKAMRLSEDVIRYLTVKQEGPLPAPRVV 106


>gi|296167066|ref|ZP_06849478.1| 30S ribosomal protein S6 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295897623|gb|EFG77217.1| 30S ribosomal protein S6 [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 108

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 58/96 (60%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + +L   +  + +  ++  + ++++++GG V  V+  G R +AY I K+ +  Y
Sbjct: 13  MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGSVDKVDIWGRRRLAYEIAKHAEGIY 72

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
           V +++ + PA + E+ R++ ++E+VLR+  +  D H
Sbjct: 73  VVVDLKAEPATVSELDRQLSLNESVLRTKVMRTDKH 108


>gi|123967130|ref|YP_001012211.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9515]
 gi|166227365|sp|A2BZ93|RS6_PROM5 RecName: Full=30S ribosomal protein S6
 gi|123201496|gb|ABM73104.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9515]
          Length = 155

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 68/128 (53%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
            YE +++LR DI+ +++K+ I +Y  L++E G  +      G R +AY+I K+R+  YV 
Sbjct: 6   YYETMYILRPDIAEEEVKNHIDKYNKLLEEFGATILDSQMRGKRRLAYQIAKHREGIYVQ 65

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNV 122
           ++       I ++++ MR+ E+V+R LT+  +    +P  + +  ++ ++ +    D   
Sbjct: 66  LSHQGDGQHIFKIEKAMRLSEDVIRYLTVKQEGPLPTPRSSNKSSNQAEKKENENIDSAN 125

Query: 123 DRKQHVSE 130
             +    E
Sbjct: 126 KSEPKADE 133


>gi|297618491|ref|YP_003703650.1| ribosomal protein S6 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146328|gb|ADI03085.1| ribosomal protein S6 [Syntrophothermus lipocalidus DSM 12680]
          Length = 97

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLV-NELGMRTIAYRIRKNRKAY 59
          M+ YE +++LR D++ + I+    + +++I   GGE        G R +AY I    + Y
Sbjct: 1  MRPYELMYILRPDLTPEAIEAAKERVRTIIASTGGEFEREAEGWGKRRLAYEIEDFTEGY 60

Query: 60 YVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          YV       P  + E+ R ++I E+ LR + L +D 
Sbjct: 61 YVVCYFKGQPETVRELDRVLKISEDFLRHIILRLDE 96


>gi|330752553|emb|CBL87500.1| Ribosomal protein S6 [uncultured Flavobacteria bacterium]
          Length = 111

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 54/111 (48%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+K+T+ ++ SLI+    ++      G++ + Y I+  R  +Y
Sbjct: 1   MNKYETVFILNPVLSESQVKETVEKFSSLIKGLKSKITHEENWGLKKLKYPIQNKRTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
                 S P    E++ + + DE VLR L++ +D H        ++    +
Sbjct: 61  HMFEHESDPQTTKELEVEFKRDERVLRWLSVKLDKHAVEYAEKRKKKQTKN 111


>gi|227540352|ref|ZP_03970401.1| ribosomal protein S6 [Sphingobacterium spiritivorum ATCC 33300]
 gi|227239676|gb|EEI89691.1| ribosomal protein S6 [Sphingobacterium spiritivorum ATCC 33300]
          Length = 122

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 61/119 (51%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V +L   +S    K+ I ++++++ E G E+   +  G++ +AY I+K    +Y
Sbjct: 1   MQQYESVIILTPLLSDDVAKEVIAKFKNILTEGGAEIVAEDNWGLKKLAYPIQKKTTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
                 +P   I +++ ++R DE V+R LT+ +D H  + +   +    + + +    +
Sbjct: 61  HLTEFKAPGELIRKIEIELRRDERVMRFLTIALDKHAIAYSEKKRSGAFNKKAETKTEE 119


>gi|300771166|ref|ZP_07081042.1| 30S ribosomal protein S6 [Sphingobacterium spiritivorum ATCC 33861]
 gi|300761836|gb|EFK58656.1| 30S ribosomal protein S6 [Sphingobacterium spiritivorum ATCC 33861]
          Length = 122

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 61/119 (51%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V +L   +S    K+ I ++++++ E G E+   +  G++ +AY I+K    +Y
Sbjct: 1   MQQYESVIILTPLLSDDVAKEVIAKFKNILTEGGAEIVAEDNWGLKKLAYPIQKKTTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
                 +P   I +++ ++R DE V+R LT+ +D H  + +   +    + + +    +
Sbjct: 61  HLTEFKAPGELIKKIEIELRRDERVMRFLTIALDKHAIAYSEKKRSGAFNKKAETKTEE 119


>gi|109946866|ref|YP_664094.1| 30S ribosomal protein S6 [Helicobacter acinonychis str. Sheeba]
 gi|123362772|sp|Q17Z31|RS6_HELAH RecName: Full=30S ribosomal protein S6
 gi|109714087|emb|CAJ99095.1| 30S ribosomal protein S6 [Helicobacter acinonychis str. Sheeba]
          Length = 142

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 74/134 (55%), Gaps = 2/134 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHNGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
             M   + P+ I E++R  RI+E+VLR + +  DS ++       + R ++   + +   
Sbjct: 61  YVMYFKAEPSMILELERLYRINEDVLRFIVIKYDSKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEK 132
           ++      H +EE 
Sbjct: 121 EKTEHAHSHHTEEA 134


>gi|18311624|ref|NP_563558.1| 30S ribosomal protein S6 [Clostridium perfringens str. 13]
 gi|169343464|ref|ZP_02864464.1| ribosomal protein S6 [Clostridium perfringens C str. JGS1495]
 gi|170764006|ref|ZP_02900189.1| ribosomal protein S6 [Clostridium perfringens B str. ATCC 3626]
 gi|170764180|ref|ZP_02900237.1| ribosomal protein S6 [Clostridium perfringens E str. JGS1987]
 gi|170764288|ref|ZP_02900252.1| ribosomal protein S6 [Clostridium perfringens CPE str. F4969]
 gi|182420538|ref|ZP_02951674.1| ribosomal protein S6 [Clostridium perfringens NCTC 8239]
 gi|182626414|ref|ZP_02954167.1| ribosomal protein S6 [Clostridium perfringens D str. JGS1721]
 gi|18146308|dbj|BAB82348.1| 30S ribosomal protein S6 [Clostridium perfringens str. 13]
 gi|169298416|gb|EDS80505.1| ribosomal protein S6 [Clostridium perfringens C str. JGS1495]
 gi|170660921|gb|EDT13604.1| ribosomal protein S6 [Clostridium perfringens E str. JGS1987]
 gi|170710436|gb|EDT22618.1| ribosomal protein S6 [Clostridium perfringens B str. ATCC 3626]
 gi|170713733|gb|EDT25915.1| ribosomal protein S6 [Clostridium perfringens CPE str. F4969]
 gi|177908288|gb|EDT70841.1| ribosomal protein S6 [Clostridium perfringens D str. JGS1721]
 gi|182379946|gb|EDT77425.1| ribosomal protein S6 [Clostridium perfringens NCTC 8239]
          Length = 96

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 47/94 (50%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+    +  + +K  I +++ +I+   G V  V+  G R +AY I K  + YY
Sbjct: 2  MRKYETIFVAHPSLDEEAVKALIEKFKGVIENGNGTVDNVDFWGKRKLAYEIAKVNEGYY 61

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N  + P    E+ R   I + ++R + +  +
Sbjct: 62 TLINFTANPELPKELDRVFGITDGIIRHIIVKEE 95


>gi|292670200|ref|ZP_06603626.1| 30S ribosomal protein S6 [Selenomonas noxia ATCC 43541]
 gi|292648152|gb|EFF66124.1| 30S ribosomal protein S6 [Selenomonas noxia ATCC 43541]
          Length = 124

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           +LYE +F+++  +  +     I ++  LIQ NGG +   +  G + +AY I+ N + YYV
Sbjct: 29  RLYEVIFIVKP-MEEEATNAVIEKFTKLIQANGGTIEKEDRWGKKRLAYEIKDNTEGYYV 87

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQ 98
            + + + PA + E  R M+I + +L+ + +  D  E+
Sbjct: 88  LLYVNAEPACVAECDRVMKITDELLKHMIVRADGVEE 124


>gi|220933168|ref|YP_002510076.1| ribosomal protein S6 [Halothermothrix orenii H 168]
 gi|219994478|gb|ACL71081.1| ribosomal protein S6 [Halothermothrix orenii H 168]
          Length = 95

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 49/95 (51%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE  F+++ D+  +   + + + + +I  NGG+V  V+E G R +AY I+     YY
Sbjct: 1  MRAYETTFIIKPDLEEEARNNILDRVKEIIDTNGGKVNEVDEWGDRNLAYEIKNYNTGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +        I EM+R   + ++VLR L +  D 
Sbjct: 61 TLIKFEGEAETIDEMERYFNLTDSVLRYLVIREDK 95


>gi|116074259|ref|ZP_01471521.1| ribosomal protein S6 [Synechococcus sp. RS9916]
 gi|116069564|gb|EAU75316.1| ribosomal protein S6 [Synechococcus sp. RS9916]
          Length = 123

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 54/102 (52%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ ++ E G EV      G R +AY I KN++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVESHLTKYRDILVEAGAEVLDNQMRGKRRLAYAINKNKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  +++ MR+ E+V+  LT+  D     P + 
Sbjct: 65  QLSHNGDGQQVAVLEKAMRLSEDVIHYLTVKQDGPLPEPRVM 106


>gi|159026117|emb|CAO88785.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 129

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/100 (30%), Positives = 52/100 (52%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR D+  + ++  + +Y++LI E+      V   G + +AY I+K     YV
Sbjct: 3   NNYETLYILRPDLGEEVVQQQVERYRTLITEHSATDIEVKVWGKKRLAYPIKKLNDGVYV 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPT 101
            MN  +    +  M+R MR+ + V+R LTL +D     P 
Sbjct: 63  QMNYQASGKQVAPMERAMRLSDEVIRYLTLKLDRVMPPPA 102


>gi|237757032|ref|ZP_04585484.1| ribosomal protein S6 [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237690812|gb|EEP59968.1| ribosomal protein S6 [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 104

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE VF+L+  +S ++IK  +   + LIQ+N GE+      G R +AY I K    YY
Sbjct: 1  MRHYELVFVLKPTLSEEEIKTRVQAIRDLIQQNQGEIYNEENWGRRNLAYPINKFNSGYY 60

Query: 61 VFMNIA-SPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N           ++  +RI+E+V+R L + + 
Sbjct: 61 FLINYKTGNSNLPAILEYNLRINEDVIRFLNMKLK 95


>gi|242310275|ref|ZP_04809430.1| 30S ribosomal protein S6 [Helicobacter pullorum MIT 98-5489]
 gi|239523572|gb|EEQ63438.1| 30S ribosomal protein S6 [Helicobacter pullorum MIT 98-5489]
          Length = 145

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 77/136 (56%), Gaps = 4/136 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+++  ++ ++I   I  Y++ I  NGGE+    ++GMR +AY I+KN++ YY
Sbjct: 1   MRFYETMFVVKPTLTQEEIVQKIDFYKTAILNNGGEISATLDMGMRNLAYEIKKNKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI----QRHDRDDRNDRF 116
             +   + P  + E++R  RI+E++LR + +  DS ++            +++     + 
Sbjct: 61  FVIYFKAEPKLVLELERLYRINEDILRFIVIKYDSKKEQKAWETLVDRAINNKKATPLKE 120

Query: 117 PRDRNVDRKQHVSEEK 132
           P+++ V+++   ++E 
Sbjct: 121 PKEKAVEKEAPKAQEA 136


>gi|124026894|ref|YP_001016009.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. NATL1A]
 gi|166227363|sp|A2C5I5|RS6_PROM1 RecName: Full=30S ribosomal protein S6
 gi|123961962|gb|ABM76745.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. NATL1A]
          Length = 138

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 65/130 (50%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  +++   + +Y ++++++  EV      G R +AY I K+++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVDSHLKKYSAILEKSETEVLDSQMRGKRRLAYPIAKHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            ++       +  ++R MR+ E+V+R +T+  D    +P  T +  + +    +   D+ 
Sbjct: 65  QLSHKGNGQQVATLERAMRLSEDVIRYITVKQDGPLPTPKPTSKEDETEKEEVKPTEDKT 124

Query: 122 VDRKQHVSEE 131
               Q   +E
Sbjct: 125 ESPAQEEKKE 134


>gi|308064026|gb|ADO05913.1| 30S ribosomal protein S6 [Helicobacter pylori Sat464]
          Length = 142

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKANPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 121 EKTEHTHSHHTEEAE 135


>gi|255035776|ref|YP_003086397.1| 30S ribosomal protein S6 [Dyadobacter fermentans DSM 18053]
 gi|254948532|gb|ACT93232.1| ribosomal protein S6 [Dyadobacter fermentans DSM 18053]
          Length = 126

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 58/124 (46%), Gaps = 1/124 (0%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           K YE VF+L   +S  Q KD + ++ ++I  NG ++      G+R +AY I+K    +Y 
Sbjct: 3   KQYETVFILTPILSEAQAKDAVEKFTTIITSNGAQIVHEENWGLRKLAYPIQKKNSGFYH 62

Query: 62  FMNIAS-PPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
            +   +     +  ++ + R DE VLR +T+ +D H  +     ++     + +     +
Sbjct: 63  VVEYTANEGNVVDVLETEFRRDERVLRFMTIALDKHSIAYNEKKRKGLVGKKKEEATESK 122

Query: 121 NVDR 124
             + 
Sbjct: 123 TENA 126


>gi|257461421|ref|ZP_05626517.1| 30S ribosomal protein S6 [Campylobacter gracilis RM3268]
 gi|257441144|gb|EEV16291.1| 30S ribosomal protein S6 [Campylobacter gracilis RM3268]
          Length = 137

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 65/132 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+++  ++  ++K  +   + +I +NGGE+  V E+G R +AY+I K  +  Y
Sbjct: 1   MRNYEVLFIVKPTLTDDEVKTKVDFVKEIITKNGGEIASVIEMGARKLAYKIDKYERGVY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             +   + P+ I E+ R +RI E+++R LT+  ++  +                +  R+ 
Sbjct: 61  FVIYFKAEPSLISELVRNLRITEDIIRFLTVKYETKREISAWDKLSKGIKLSPAKKEREP 120

Query: 121 NVDRKQHVSEEK 132
               +    EE 
Sbjct: 121 KAPVEPKEPEEA 132


>gi|281420809|ref|ZP_06251808.1| ribosomal protein S6 [Prevotella copri DSM 18205]
 gi|281405101|gb|EFB35781.1| ribosomal protein S6 [Prevotella copri DSM 18205]
          Length = 114

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 61/116 (52%), Gaps = 2/116 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ +++ ++ +NG E+      G++ +AY I K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKETVAKFEKVLTDNGAEILNKEAWGLKKLAYNIEKKTSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
             +   + P  I +++   R DE V+R +T+ +D +  +     +R  +  + +  
Sbjct: 61  SLVEFKAEPTVIAKLETAYRRDEKVIRYMTVKLDKY--AAAYAEKRRAKLGKKEEA 114


>gi|255530651|ref|YP_003091023.1| 30S ribosomal protein S6 [Pedobacter heparinus DSM 2366]
 gi|255343635|gb|ACU02961.1| ribosomal protein S6 [Pedobacter heparinus DSM 2366]
          Length = 119

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 58/122 (47%), Gaps = 4/122 (3%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE V +L   +S +  K+ I ++  +I ++G E+   +  G+R +AY I K    ++
Sbjct: 1   MNQYETVIVLTPLLSEEVAKEAIAKFSKIIADSGAEIVQEDNWGLRKLAYPIEKKASGFF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
                 S    I++++ +++ DE VLR LT+ +D H     +      R    ++ P+  
Sbjct: 61  HLTEYKSSGELINKLELELKRDERVLRFLTIRLDRH----AVAYNEKKRSGAFNKKPKQE 116

Query: 121 NV 122
             
Sbjct: 117 AA 118


>gi|124024695|ref|YP_001019002.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9303]
 gi|166227364|sp|A2CE27|RS6_PROM3 RecName: Full=30S ribosomal protein S6
 gi|123964981|gb|ABM79737.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9303]
          Length = 124

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 26/102 (25%), Positives = 55/102 (53%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ ++ E G EV      G R +AY I  +++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVETHVTKYREMVTEAGAEVLDNQMRGKRRLAYPISNHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  +++ MR+ E+V+R LT+  +    +P + 
Sbjct: 65  QLSHNGNGQQVAVLEKAMRLSEDVIRYLTVKQEGPLPAPRIV 106


>gi|282898434|ref|ZP_06306424.1| Ribosomal protein S6 [Raphidiopsis brookii D9]
 gi|281196600|gb|EFA71506.1| Ribosomal protein S6 [Raphidiopsis brookii D9]
          Length = 108

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/89 (38%), Positives = 52/89 (58%)

Query: 4  YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
          YE  ++LR D+   Q+   I +YQ+L+ E G E   V   G R +AY I ++R   YV  
Sbjct: 5  YETTYILRSDLGDDQVDQAIVKYQNLLNEQGAENLEVQNRGKRRLAYEINRHRDGVYVQF 64

Query: 64 NIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          N  +P +AI   +R MR++E+V+R LT+ 
Sbjct: 65 NYTAPASAIAVFERSMRLNEDVIRYLTVK 93


>gi|256370869|ref|YP_003108693.1| ribosomal protein S6 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007453|gb|ACU53020.1| ribosomal protein S6 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 112

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/96 (23%), Positives = 42/96 (43%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE   +    +  +       + +S++ + GG +      G R +AY I       Y
Sbjct: 1  MREYELALITSPALDEEARTALFDRIRSIVNQGGGAITQEAHWGRRMLAYPIAHRTDGAY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
           F+ + + PA I E+ R + I + VLR  T+ +   
Sbjct: 61 SFLRLHAEPATIDELDRVLSIADGVLRHKTIRLPDA 96


>gi|323345546|ref|ZP_08085769.1| 30S ribosomal protein S6 [Prevotella oralis ATCC 33269]
 gi|323093660|gb|EFZ36238.1| 30S ribosomal protein S6 [Prevotella oralis ATCC 33269]
          Length = 114

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 59/113 (52%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ +++ L+ +NG E+      G++ +AY+I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKETVAKFKKLLTDNGAEIVNEEAWGLKKMAYQIQKKTSGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
                   P  +++++   R DE V+R +T+ +D +        ++     + 
Sbjct: 61  CLFEFKGEPTIVNKLETGYRRDEKVIRYITVSLDKYAVQYAEKRKQKYAKKQE 113


>gi|302877155|ref|YP_003845788.1| 30S ribosomal protein S6 [Clostridium cellulovorans 743B]
 gi|307687854|ref|ZP_07630300.1| 30S ribosomal protein S6 [Clostridium cellulovorans 743B]
 gi|302580012|gb|ADL54024.1| ribosomal protein S6 [Clostridium cellulovorans 743B]
          Length = 95

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 48/95 (50%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +F+    +  +  K  I +++ +I+  GG V  V+  G R +AY I K  + +Y
Sbjct: 1  MNKYETLFIQNPSLDEEATKANIEKFKGIIENGGGTVENVDVWGRRKLAYEIAKVNEGHY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N +S      E+ R  RI + ++R + + ++ 
Sbjct: 61 TLINFSSDAQLPKELDRVFRITDGIIRHIIVNLEK 95


>gi|253681311|ref|ZP_04862109.1| ribosomal protein S6 [Clostridium botulinum D str. 1873]
 gi|253562549|gb|EES92000.1| ribosomal protein S6 [Clostridium botulinum D str. 1873]
          Length = 95

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 54/95 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+L+  +  + IK TI +++ +I+  GG V  V+E G R +AY I K  + YY
Sbjct: 1  MRNYETLFILQPSLEEEVIKATIEKFKGVIENEGGVVENVDEWGKRKLAYPINKVSEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N  + P    E++R  RI + V+R + +  + 
Sbjct: 61 TLINFKANPELPRELERVFRITDGVMRFMVVNPEK 95


>gi|154175471|ref|YP_001407996.1| 30S ribosomal protein S6 [Campylobacter curvus 525.92]
 gi|166226814|sp|A7GXQ4|RS6_CAMC5 RecName: Full=30S ribosomal protein S6
 gi|112803344|gb|EAU00688.1| 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
           (Polyprenylp-hydroxybenzoate decarboxylase)
           [Campylobacter curvus 525.92]
          Length = 142

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/138 (26%), Positives = 75/138 (54%), Gaps = 9/138 (6%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE +F+L+  ++ +++K  +   + +I +NGGE+  V E+G R +AY I+K  +  Y
Sbjct: 1   MKHYELLFILKPTLTEEEVKAKVDFVKEVITKNGGEIATVVEMGTRKLAYTIKKYERGTY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL---------TIQRHDRDD 111
             +   +PP  + E+ R +RI E+++R L++  ++  +             TI++  R+ 
Sbjct: 61  FVIYYKAPPTLLAELTRNIRITEDIIRFLSVKYENKREIAAWERLCKGIKQTIKKEPREP 120

Query: 112 RNDRFPRDRNVDRKQHVS 129
           R  R PR+   ++ +  +
Sbjct: 121 REPRAPREPKAEKIEEQT 138


>gi|261839965|gb|ACX99730.1| 30S ribosomal protein S6 [Helicobacter pylori 52]
          Length = 142

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 72/135 (53%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y  +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYSEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 121 EKTEHTHSHHTEEAE 135


>gi|116626135|ref|YP_828291.1| 30S ribosomal protein S6 [Candidatus Solibacter usitatus
          Ellin6076]
 gi|122251817|sp|Q01QR4|RS6_SOLUE RecName: Full=30S ribosomal protein S6
 gi|116229297|gb|ABJ88006.1| SSU ribosomal protein S6P [Candidatus Solibacter usitatus
          Ellin6076]
          Length = 153

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 55/94 (58%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          ++YE +F+++ D S +++   +   ++ +   G  V  +++ G R +AYR+ K R+  YV
Sbjct: 3  RIYEELFIVKPDASDEEVDAFVETLRTQLTAAGATVDKIDKWGKRRLAYRVDKYREGTYV 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
               S P  + E++R++R+ + VL+ LT+ +D 
Sbjct: 63 LFQFTSEPTGVKELERRLRVSDIVLKFLTVRIDE 96


>gi|226315509|ref|YP_002775405.1| 30S ribosomal protein S6 [Brevibacillus brevis NBRC 100599]
 gi|254765223|sp|C0ZA47|RS6_BREBN RecName: Full=30S ribosomal protein S6
 gi|226098459|dbj|BAH46901.1| 30S ribosomal protein S6 [Brevibacillus brevis NBRC 100599]
          Length = 95

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 59/95 (62%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++LR D+  +++K  + +Y  ++   GGE+  + E+G R +AY I K R+ YY
Sbjct: 1  MRQYEVMYVLRPDLEEEKVKSNVARYSDVVTNYGGEISKLQEMGKRRLAYEINKFREGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V MN  +   A+ E +R M+I+++V+R + +  + 
Sbjct: 61 VLMNFKANSDAVAEAERLMKINDDVIRFMFVRDEK 95


>gi|207110026|ref|ZP_03244188.1| 30S ribosomal protein S6 [Helicobacter pylori HPKX_438_CA4C1]
          Length = 136

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 68/120 (56%), Gaps = 1/120 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 7   MRHYETMFILKPTLVEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 66

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
                 + P+ I E++R  RI+E+VLR + +  +S ++         DR ++     +++
Sbjct: 67  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHAL-VDRANKKPSHAKEK 125


>gi|188528036|ref|YP_001910723.1| 30S ribosomal protein S6 [Helicobacter pylori Shi470]
 gi|226703476|sp|B2UV11|RS6_HELPS RecName: Full=30S ribosomal protein S6
 gi|188144276|gb|ACD48693.1| 30S ribosomal protein S6 [Helicobacter pylori Shi470]
          Length = 142

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKANPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 121 EKTEHTHSHHTEETE 135


>gi|298372705|ref|ZP_06982695.1| ribosomal protein S6 [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275609|gb|EFI17160.1| ribosomal protein S6 [Bacteroidetes oral taxon 274 str. F0058]
          Length = 135

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/133 (21%), Positives = 61/133 (45%), Gaps = 2/133 (1%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE  F+L   +S  Q+K+ + +++ ++ + G  +      G+R +AY I K    +YV
Sbjct: 3   NHYEAAFILTPVLSDVQMKEAVEKFKVVLTDAGATIENEELWGLRKLAYTIDKKSTGFYV 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQS--PTLTIQRHDRDDRNDRFPRD 119
            +  +  P  +  ++ + R DE V+R L   +D +          +  ++ D   +  ++
Sbjct: 63  ILQFSGEPTLVETLETQFRRDERVIRFLVFRLDKYAYEYASKRIKKNAEQADIKAKANKE 122

Query: 120 RNVDRKQHVSEEK 132
             VD +    EE+
Sbjct: 123 AFVDVETENLEEE 135


>gi|224418788|ref|ZP_03656794.1| 30S ribosomal protein S6 [Helicobacter canadensis MIT 98-5491]
 gi|253826689|ref|ZP_04869574.1| 30S ribosomal protein S6 [Helicobacter canadensis MIT 98-5491]
 gi|313142305|ref|ZP_07804498.1| 30S ribosomal protein S6 [Helicobacter canadensis MIT 98-5491]
 gi|253510095|gb|EES88754.1| 30S ribosomal protein S6 [Helicobacter canadensis MIT 98-5491]
 gi|313131336|gb|EFR48953.1| 30S ribosomal protein S6 [Helicobacter canadensis MIT 98-5491]
          Length = 142

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/138 (26%), Positives = 70/138 (50%), Gaps = 6/138 (4%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+++  ++ ++I   I  Y++ I  NGGE+    ++GMR +AY I+KN++ YY
Sbjct: 1   MRFYETMFVVKPTLTQEEITQKIDFYKAAILNNGGEISATLDMGMRNLAYEIKKNKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL------TIQRHDRDDRND 114
             +   + P  + E++R  RI+E++LR + +  DS ++           I         +
Sbjct: 61  FVIYFKAEPKLVLELERLYRINEDILRFIVIKYDSKKEQKAWEVLVDRAIHNKKAAPLKE 120

Query: 115 RFPRDRNVDRKQHVSEEK 132
                    +++  SEE 
Sbjct: 121 AREAKETAPKEEAKSEEA 138


>gi|121535341|ref|ZP_01667153.1| ribosomal protein S6 [Thermosinus carboxydivorans Nor1]
 gi|121306033|gb|EAX46963.1| ribosomal protein S6 [Thermosinus carboxydivorans Nor1]
          Length = 94

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+++  +  +     I ++++LI+ NGG V  ++  G R +AY ++   + YY
Sbjct: 1  MRKYEVIFIVKP-LDEEATNAVIAKFENLIKNNGGNVEKIDRWGKRRLAYPVKDFTEGYY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +   + P A+ E++R M+I + +LR + +  D 
Sbjct: 60 CVIYFDAEPKAVFELERVMKITDEILRHMVVKEDE 94


>gi|189425663|ref|YP_001952840.1| 30S ribosomal protein S6 [Geobacter lovleyi SZ]
 gi|226703472|sp|B3E6H3|RS6_GEOLS RecName: Full=30S ribosomal protein S6
 gi|189421922|gb|ACD96320.1| ribosomal protein S6 [Geobacter lovleyi SZ]
          Length = 122

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 54/100 (54%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+ D++   +K    + Q ++    G+   +++ G R +AY IRK  +  Y
Sbjct: 1   MRKYETIFILQPDLAEDDVKSVTDKVQDVVASLKGDFHRLDDWGTRKLAYAIRKFPRGRY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
            ++        + E++R++R+DE VLR L++ +    +  
Sbjct: 61  YYLRFDGGAQLVAELERRLRLDEKVLRFLSVNITDEPEKK 100


>gi|260911680|ref|ZP_05918260.1| 30S ribosomal protein S6 [Prevotella sp. oral taxon 472 str. F0295]
 gi|260634228|gb|EEX52338.1| 30S ribosomal protein S6 [Prevotella sp. oral taxon 472 str. F0295]
          Length = 115

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 55/107 (51%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ +++ L+ + G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKETVAKFKKLLTDKGAEIVNEEAWGLKKMAYAIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH 107
             +   + P  I  ++   R DE V+R +T+ +D +        +  
Sbjct: 61  CLLEFKAEPEVIKSLETGYRRDEKVIRHMTVKLDKYAVQYAEKRKHK 107


>gi|158520027|ref|YP_001527897.1| ribosomal protein S6 [Desulfococcus oleovorans Hxd3]
 gi|226703453|sp|A8ZRQ3|RS6_DESOH RecName: Full=30S ribosomal protein S6
 gi|158508853|gb|ABW65820.1| ribosomal protein S6 [Desulfococcus oleovorans Hxd3]
          Length = 168

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 57/115 (49%), Gaps = 1/115 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+   D+S +       +  +LI  N G +   +E G R +AY IRK  + +Y
Sbjct: 1   MRRYETIFIADPDLSPENQAQLFEKATTLIDANSGVLVEFDEWGTRRLAYEIRKKPRGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLV-DSHEQSPTLTIQRHDRDDRND 114
           V ++     A +  ++   RIDE VL+ +T+ + ++ +          +++ + +
Sbjct: 61  VRLDFCGDGATVQGLENAFRIDERVLKFMTVFLSENADPEALRQAIAEEKEKKAE 115


>gi|299135704|ref|ZP_07028888.1| ribosomal protein S6 [Acidobacterium sp. MP5ACTX8]
 gi|298601828|gb|EFI57982.1| ribosomal protein S6 [Acidobacterium sp. MP5ACTX8]
          Length = 157

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 62/128 (48%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE +F++R D+   ++   +  +   +   GG V+   ++G R +AY ++K    +YV
Sbjct: 3   RTYEIMFIVRPDVEEAELDKLVETFSGYVTTGGGVVKTTEKMGRRRLAYTVQKFNDGFYV 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            + + +P + I E++R++R+ E V++ +T+ +D  ++         D   +    P    
Sbjct: 63  LLIVDAPASLISEIERRLRVSEPVIKFITVRMDEEDKRVAKIKAHRDSHVKRSALPTSSP 122

Query: 122 VDRKQHVS 129
              +   +
Sbjct: 123 EAAQVAET 130


>gi|124009488|ref|ZP_01694164.1| ribosomal protein S6 [Microscilla marina ATCC 23134]
 gi|123984937|gb|EAY24900.1| ribosomal protein S6 [Microscilla marina ATCC 23134]
          Length = 124

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 62/120 (51%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE VF+L   +S +QIKDT+ ++Q ++ +NG E+  V+  GM+ +AY I+K     Y 
Sbjct: 4   NNYETVFILTPVLSDEQIKDTVEKFQKILADNGAEIVHVDHWGMKKLAYPIKKKTSGVYT 63

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            +   +P   +  ++ + R DE V+R + +++D H  +     +R   D + D       
Sbjct: 64  VVEFKAPSTIVKALETEYRRDERVMRHICIVLDKHAVAYNEKKRRKLSDKKVDEAATTEE 123


>gi|78185873|ref|YP_378307.1| 30S ribosomal protein S6 [Synechococcus sp. CC9902]
 gi|123580903|sp|Q3AVM1|RS6_SYNS9 RecName: Full=30S ribosomal protein S6
 gi|78170167|gb|ABB27264.1| SSU ribosomal protein S6P [Synechococcus sp. CC9902]
          Length = 126

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 56/102 (54%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ +I E G EV      G R +AY I K+++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVESHVTKYRDMIVEAGAEVLDNQMRGKRRLAYPIAKHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  +++ MRI E+V+R LT+  +    +P + 
Sbjct: 65  QLSHNGDGQQVEVLEKAMRISEDVIRYLTVKQEGPLPAPRVV 106


>gi|226309318|ref|YP_002769278.1| 30S ribosomal protein S6 [Rhodococcus erythropolis PR4]
 gi|229489891|ref|ZP_04383746.1| ribosomal protein S6 [Rhodococcus erythropolis SK121]
 gi|259495342|sp|C0ZV45|RS6_RHOE4 RecName: Full=30S ribosomal protein S6
 gi|226188435|dbj|BAH36539.1| 30S ribosomal protein S6 [Rhodococcus erythropolis PR4]
 gi|229323187|gb|EEN88953.1| ribosomal protein S6 [Rhodococcus erythropolis SK121]
          Length = 95

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 56/95 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++++++GG +  V+  G R +AY I K+ +  Y
Sbjct: 1  MRHYELMVILDPSLDERTVAPSLDTFLNVVRQHGGTIDKVDVWGKRRLAYEILKHAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            ++I + PA + E+ R++ ++E+VLR+  L  + 
Sbjct: 61 AVIDINATPATVAELDRQLGLNESVLRTKVLRHNK 95


>gi|294501976|ref|YP_003565676.1| 30S ribosomal protein S6 [Bacillus megaterium QM B1551]
 gi|295707327|ref|YP_003600402.1| 30S ribosomal protein S6 [Bacillus megaterium DSM 319]
 gi|294351913|gb|ADE72242.1| 30S ribosomal protein S6 [Bacillus megaterium QM B1551]
 gi|294804986|gb|ADF42052.1| 30S ribosomal protein S6 [Bacillus megaterium DSM 319]
          Length = 95

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 54/94 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R  I  +  K  + ++  ++ +NG E+  V E G R +AY I   R  YY
Sbjct: 1  MRKYEVMYIIRPSIDDEAKKALVERFNGVLTDNGAEIANVKEWGKRRLAYEINDFRDGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          + +++A+   A+ E  R  +I+E+++R + +  +
Sbjct: 61 MILDVAATSEAVSEFDRLAKINEDIIRHIVVKQE 94


>gi|311070631|ref|YP_003975554.1| 30S ribosomal protein S6 [Bacillus atrophaeus 1942]
 gi|310871148|gb|ADP34623.1| 30S ribosomal protein S6 [Bacillus atrophaeus 1942]
          Length = 95

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 53/95 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R ++  +  K  + ++ +++  NG E+    + G R +AY I   R+ +Y
Sbjct: 1  MRKYEVMYIIRPNVDDESKKAVVERFNNVLTSNGAEITGTKDWGKRRLAYEINDFREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N+ S  AA+ E  R  +I ++++R + +  + 
Sbjct: 61 QIVNVQSDAAAVQEFDRLAKISDDIIRHVVVKEEE 95


>gi|325955200|ref|YP_004238860.1| 30S ribosomal protein S6 [Weeksella virosa DSM 16922]
 gi|323437818|gb|ADX68282.1| 30S ribosomal protein S6 [Weeksella virosa DSM 16922]
          Length = 114

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S  Q+++ + ++   I  N  E+      G++ +AY I+  R  +Y
Sbjct: 1   MTHYETVFILTPVLSDSQVEEAVKKFHDYITANEAEIVATENWGLKKLAYPIQNKRNGFY 60

Query: 61  VFMNIASPP-AAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
             +   +     + +++   + DE V+R L++ +D H        +R  +    ++
Sbjct: 61  HLIEFKTDNTDLVSQLELVFKRDERVIRYLSVKLDKHGVE--WAEKRRTKLKTANK 114


>gi|52082636|ref|YP_081427.1| 30S ribosomal protein S6 [Bacillus licheniformis ATCC 14580]
 gi|52788035|ref|YP_093864.1| 30S ribosomal protein S6 [Bacillus licheniformis ATCC 14580]
 gi|319648502|ref|ZP_08002718.1| 30S ribosomal protein S6 [Bacillus sp. BT1B_CT2]
 gi|81690793|sp|Q65CP3|RS6_BACLD RecName: Full=30S ribosomal protein S6
 gi|52005847|gb|AAU25789.1| ribosomal protein S6 (BS9) [Bacillus licheniformis ATCC 14580]
 gi|52350537|gb|AAU43171.1| RpsF [Bacillus licheniformis ATCC 14580]
 gi|317389581|gb|EFV70392.1| 30S ribosomal protein S6 [Bacillus sp. BT1B_CT2]
          Length = 95

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 51/95 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R D+  +  K  + ++ +++  NG E+    + G R +AY I   R  +Y
Sbjct: 1  MRKYEIMYIIRPDVDEESKKAVVERFNNILTTNGAEITETKDWGKRRLAYEINDFRDGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N+ +   A+ E  R  +I ++++R + +  + 
Sbjct: 61 QILNVQAGAEAVQEFDRLAKISDDIIRHIVVKEEE 95


>gi|308062529|gb|ADO04417.1| 30S ribosomal protein S6 [Helicobacter pylori Cuz20]
          Length = 142

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 72/135 (53%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKADPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H  EE  
Sbjct: 121 EKTEHTHSHHLEEAE 135


>gi|217032305|ref|ZP_03437801.1| hypothetical protein HPB128_132g3 [Helicobacter pylori B128]
 gi|217033567|ref|ZP_03438995.1| hypothetical protein HP9810_899g3 [Helicobacter pylori 98-10]
 gi|298735730|ref|YP_003728255.1| 30S ribosomal protein S6 [Helicobacter pylori B8]
 gi|308183356|ref|YP_003927483.1| 30S ribosomal protein S6 [Helicobacter pylori PeCan4]
 gi|216943913|gb|EEC23347.1| hypothetical protein HP9810_899g3 [Helicobacter pylori 98-10]
 gi|216945971|gb|EEC24585.1| hypothetical protein HPB128_132g3 [Helicobacter pylori B128]
 gi|261838569|gb|ACX98335.1| ribosomal protein S6 [Helicobacter pylori 51]
 gi|298354919|emb|CBI65791.1| small subunit ribosomal protein S6 [Helicobacter pylori B8]
 gi|308065541|gb|ADO07433.1| 30S ribosomal protein S6 [Helicobacter pylori PeCan4]
 gi|317009930|gb|ADU80510.1| 30S ribosomal protein S6 [Helicobacter pylori India7]
 gi|317178460|dbj|BAJ56248.1| 30S ribosomal protein S6 [Helicobacter pylori F30]
 gi|317180972|dbj|BAJ58758.1| 30S ribosomal protein S6 [Helicobacter pylori F32]
          Length = 142

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 121 EKTEHTHSHHTEEAE 135


>gi|320528727|ref|ZP_08029879.1| ribosomal protein S6 [Solobacterium moorei F0204]
 gi|320130937|gb|EFW23515.1| ribosomal protein S6 [Solobacterium moorei F0204]
          Length = 137

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 50/94 (53%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE ++++ + + +++  + I     +I +NGG++   +E GMR  AY I   +K YY
Sbjct: 37  MKKYEVMYIINESVETEKRAELIETLSKIITDNGGKIAKTDEWGMREFAYHIDDMKKGYY 96

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           V     +  A + E  R M I+ NV+R +    +
Sbjct: 97  VVTAFEADNACVKEFDRLMGINANVVRFMITRDE 130


>gi|301062690|ref|ZP_07203308.1| ribosomal protein S6 [delta proteobacterium NaphS2]
 gi|300443213|gb|EFK07360.1| ribosomal protein S6 [delta proteobacterium NaphS2]
          Length = 137

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 26/101 (25%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE ++++  +++ +  +  + ++  ++++NGG V  V+E G +T+AY I+K  K +Y
Sbjct: 1   MRYYETLYIINPNLADEDYRAVVAKFTDVVEKNGGVVTKVDEWGKKTLAYDIKKFDKGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLV-DSHEQSP 100
           V +          E+KR++ +D+ VL+  T+ + D+ +   
Sbjct: 61  VLLQFCGEAGLTAELKRELGLDDRVLKYQTIKLSDNADLEK 101


>gi|210634871|ref|ZP_03298346.1| hypothetical protein COLSTE_02275 [Collinsella stercoris DSM
          13279]
 gi|210158586|gb|EEA89557.1| hypothetical protein COLSTE_02275 [Collinsella stercoris DSM
          13279]
          Length = 97

 Score =  101 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 51/97 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE +F +  ++  +     + +  + I E  G+V  V+E G R +AY I K  +  Y
Sbjct: 1  MKAYELLFFVDPNLDPETRLAVMKRIDTTIAEGNGKVDNVDEWGKRKLAYAIDKLTEGDY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97
            +N  + PA+I E+ R +RI + V+R + +  D  E
Sbjct: 61 TLINFHADPASIAELDRVLRITDAVIRHMIVRRDDQE 97


>gi|153824152|ref|ZP_01976819.1| ribosomal protein S6 [Vibrio cholerae B33]
 gi|126518329|gb|EAZ75552.1| ribosomal protein S6 [Vibrio cholerae B33]
          Length = 102

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 54/102 (52%)

Query: 22  TIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRI 81
            I +Y   I E GG++  + + G R +AY I K  KA+YV MN+ +  A + E++   R 
Sbjct: 1   MIERYTGSITEAGGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEADQAVVDELETAFRF 60

Query: 82  DENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNVD 123
           ++ VLR++ +   +    P++ ++  +   + D    D +V+
Sbjct: 61  NDAVLRNMIMRTKAAITEPSIMLKAREERVKRDEMKFDADVE 102


>gi|116071824|ref|ZP_01469092.1| Ribosomal protein S6 [Synechococcus sp. BL107]
 gi|116065447|gb|EAU71205.1| Ribosomal protein S6 [Synechococcus sp. BL107]
          Length = 126

 Score =  100 bits (250), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/102 (28%), Positives = 56/102 (54%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  ++++  + +Y+ +I E G EV      G R +AY I K+++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVESHVTKYRDMIVEAGAEVLDNQMRGKRRLAYPIAKHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLT 103
            ++       +  +++ MRI E+V+R LT+  +    +P + 
Sbjct: 65  QLSHNGDGQQVEVLEKAMRISEDVIRYLTVKQEGPLPAPRVV 106


>gi|317177988|dbj|BAJ55777.1| 30S ribosomal protein S6 [Helicobacter pylori F16]
          Length = 142

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKRSSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 121 EKTEHTHSHHTEEAE 135


>gi|56422017|ref|YP_149335.1| 30S ribosomal protein S6 [Geobacillus kaustophilus HTA426]
 gi|261420891|ref|YP_003254573.1| 30S ribosomal protein S6 [Geobacillus sp. Y412MC61]
 gi|297531676|ref|YP_003672951.1| ribosomal protein S6 [Geobacillus sp. C56-T3]
 gi|319768562|ref|YP_004134063.1| ribosomal protein S6 [Geobacillus sp. Y412MC52]
 gi|61215358|sp|Q5KU69|RS6_GEOKA RecName: Full=30S ribosomal protein S6
 gi|56381859|dbj|BAD77767.1| 30S ribosomal protein S6 (BS9) [Geobacillus kaustophilus HTA426]
 gi|261377348|gb|ACX80091.1| ribosomal protein S6 [Geobacillus sp. Y412MC61]
 gi|297254928|gb|ADI28374.1| ribosomal protein S6 [Geobacillus sp. C56-T3]
 gi|317113428|gb|ADU95920.1| ribosomal protein S6 [Geobacillus sp. Y412MC52]
          Length = 95

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 58/95 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R ++  +  +  + ++ ++++ENG E+  V + G R +AY I+K R  YY
Sbjct: 1  MRKYEIMYIIRPNMDDEARQALVERFNNVLKENGAEITNVTDWGKRRLAYEIQKYRDGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ S P A+ E  R  RI E+++R + +  + 
Sbjct: 61 MIVNVVSEPKAVQEFDRLARISEDIIRHIVVKEEE 95


>gi|332983148|ref|YP_004464589.1| 30S ribosomal protein S6P [Mahella australiensis 50-1 BON]
 gi|332700826|gb|AEE97767.1| SSU ribosomal protein S6P [Mahella australiensis 50-1 BON]
          Length = 96

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 57/95 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F++   + ++  +  I ++++LI E GGEVR V+E G R +AY I+   + YY
Sbjct: 1  MREYETMFVINPTLDAEATQAVIERFKNLISEQGGEVRNVDEWGRRKLAYEIKDFNEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V M  A+ P    E++R  +I ++++R L +  + 
Sbjct: 61 VLMEFAANPDLPAELERVYKITDDIIRYLIISKED 95


>gi|207092387|ref|ZP_03240174.1| 30S ribosomal protein S6 [Helicobacter pylori HPKX_438_AG0C1]
          Length = 142

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 121 EKTEHTHSHHTEEAE 135


>gi|78224040|ref|YP_385787.1| 30S ribosomal protein S6 [Geobacter metallireducens GS-15]
 gi|91207916|sp|Q39RR2|RS6_GEOMG RecName: Full=30S ribosomal protein S6
 gi|78195295|gb|ABB33062.1| SSU ribosomal protein S6P [Geobacter metallireducens GS-15]
          Length = 118

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 52/94 (55%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE V +++ D+   ++K    +   +I    G++  + + G+R +AY I K+ +  Y 
Sbjct: 3  RKYETVVIVQPDLGDDELKGLNAKVTDIIATMKGDLHRLEDWGVRKLAYPINKSARGRYY 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          ++      A I E++R++R+D+ VLR  ++ ++ 
Sbjct: 63 YVRFDGDAALIAELERRLRLDDKVLRYQSVKIEK 96


>gi|297627499|ref|YP_003689262.1| 30S ribosomal protein S6 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
 gi|296923264|emb|CBL57861.1| 30S ribosomal protein S6 [Propionibacterium freudenreichii subsp.
           shermanii CIRM-BIA1]
          Length = 104

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 56/94 (59%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + ++  D+  +Q++  + +Y ++I + GG V  V+  G R +AY I+K  +  Y
Sbjct: 10  MRKYEVMAIISPDVDERQLQPIVDKYTAIITKEGGTVDNVDIWGRRHLAYPIQKKTEGLY 69

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
             +++   PA++ EM R M IDE V+R+  + +D
Sbjct: 70  AVIDLTCEPASVSEMNRLMGIDEQVMRTKVMRID 103


>gi|317050836|ref|YP_004111952.1| 30S ribosomal protein S6 [Desulfurispirillum indicum S5]
 gi|316945920|gb|ADU65396.1| ribosomal protein S6 [Desulfurispirillum indicum S5]
          Length = 145

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 25/99 (25%), Positives = 49/99 (49%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE +F+L+ ++  QQ+ D I +   +I    G +      G + +AY I      +Y
Sbjct: 1  MKKYELMFILKPELDEQQLADYIARVDGIIARYEGTIDKFENWGKKKLAYEIDNKSFGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQS 99
             +++   A I E++R  +I + ++R ++L +D     
Sbjct: 61 YLYHLSCASALIDELERNFKISDEMMRFISLRLDKKALE 99


>gi|210624076|ref|ZP_03294176.1| hypothetical protein CLOHIR_02128 [Clostridium hiranonis DSM
          13275]
 gi|210153209|gb|EEA84215.1| hypothetical protein CLOHIR_02128 [Clostridium hiranonis DSM
          13275]
          Length = 94

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 53/94 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE V++++  +  +  +    + + +I+ NGGEV  V+  G R +AY I K  + +Y
Sbjct: 1  MRDYELVYVVKPVLDEETREGVQNKIKEIIETNGGEVTKVDAWGNRKLAYPIAKFTEGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N  +      E+ R ++I+ENV+R + ++ D
Sbjct: 61 TLVNFKASVELPKELDRNLKINENVIRHMVVVCD 94


>gi|254455872|ref|ZP_05069301.1| ribosomal protein S6 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082874|gb|EDZ60300.1| ribosomal protein S6 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 117

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 58/116 (50%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M LYEH  + RQD S  +IK    +Y  ++++N GE+      G+  ++Y I+KN+K  +
Sbjct: 1   MNLYEHTIIARQDTSPSEIKQLTEKYSKIVEKNEGEIVKTENWGLINLSYLIKKNKKGSF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
           +   I      I E+++   ID+ +LR LT+ V   +       +R D D +    
Sbjct: 61  IHFKIKGKGNVIEELEKNEAIDKKLLRYLTVKVKKFDLDTNYFTKREDDDKKESYK 116


>gi|261410092|ref|YP_003246333.1| 30S ribosomal protein S6 [Paenibacillus sp. Y412MC10]
 gi|329925059|ref|ZP_08280003.1| ribosomal protein S6 [Paenibacillus sp. HGF5]
 gi|261286555|gb|ACX68526.1| ribosomal protein S6 [Paenibacillus sp. Y412MC10]
 gi|328940178|gb|EGG36510.1| ribosomal protein S6 [Paenibacillus sp. HGF5]
          Length = 94

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 55/90 (61%), Gaps = 1/90 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R DI  + ++  + ++Q +I  NGGE+   + +G R +AY I+K R   Y
Sbjct: 1  MRKYEVMYIIRPDIEQEAVQAAVDKFQGII-SNGGEITKHDVMGKRRLAYEIKKFRDGVY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLT 90
          V +N  + P  + E++R M+I + V+R L 
Sbjct: 60 VLVNFNATPEVVAELERLMKISDEVIRYLI 89


>gi|146301224|ref|YP_001195815.1| 30S ribosomal protein S6 [Flavobacterium johnsoniae UW101]
 gi|189045468|sp|A5FE77|RS6_FLAJO RecName: Full=30S ribosomal protein S6
 gi|146155642|gb|ABQ06496.1| 30S ribosomal protein S6 [Flavobacterium johnsoniae UW101]
          Length = 113

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 49/96 (51%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE VF+L   +S  Q+K+T+ +++  +   G E+    + G++ +AY I+  +  +Y
Sbjct: 1  MNHYETVFILNPVLSEVQVKETVTKFEEFLTSRGAEMVSKEDWGLKKMAYEIQNKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
                     +   + + R DE V+R LT+ +D H
Sbjct: 61 HLFEFKVAGEVLIAFETEFRRDERVMRFLTVSLDKH 96


>gi|15645860|ref|NP_208038.1| 30S ribosomal protein S6 [Helicobacter pylori 26695]
 gi|2500411|sp|P56013|RS6_HELPY RecName: Full=30S ribosomal protein S6
 gi|2314412|gb|AAD08292.1| ribosomal protein S6 (rps6) [Helicobacter pylori 26695]
          Length = 142

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMIVELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 121 EKTEHTHSHHTEEAE 135


>gi|288927612|ref|ZP_06421459.1| ribosomal protein S6 [Prevotella sp. oral taxon 317 str. F0108]
 gi|288330446|gb|EFC69030.1| ribosomal protein S6 [Prevotella sp. oral taxon 317 str. F0108]
          Length = 115

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 54/107 (50%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ +++ L+ + G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKETVAKFKKLLTDKGAEIVNEEAWGLKKMAYAIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRH 107
             +   + P  I  ++   R DE V+R + + +D +        +  
Sbjct: 61  CLLEFKAEPEVIKSLETGYRRDEKVIRHMVVKLDKYAVQYAEKRKHK 107


>gi|110638977|ref|YP_679186.1| 30S ribosomal protein S6 [Cytophaga hutchinsonii ATCC 33406]
 gi|110281658|gb|ABG59844.1| SSU ribosomal protein S6P [Cytophaga hutchinsonii ATCC 33406]
          Length = 121

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 59/118 (50%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           K YE VF+L   +S  Q+KD   +++ ++ +NG ++      G+R +AY I+K    +Y 
Sbjct: 4   KQYETVFILTPVLSDSQMKDAAQKFKQVLVDNGAKIVNEESWGLRKLAYPIQKKNTGFYH 63

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
            +   +  + I+ ++ + R DE ++R LT  +D H  +  +  ++ +         + 
Sbjct: 64  LVEFEAATSVINTLETEYRRDERIMRFLTTALDKHAVAYNIKRKKGEFKKSEKVEEKA 121


>gi|240168783|ref|ZP_04747442.1| 30S ribosomal protein S6 [Mycobacterium kansasii ATCC 12478]
          Length = 96

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 59/96 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++++++GG+V  V+  G R +AY I K+ +  Y
Sbjct: 1  MRPYEIMIILDPTLDERTVAPSLETFLNVVRKDGGKVEKVDIWGRRRLAYEIAKHSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
          V +++ + PA + E+ R++ ++E+VLR+  +  D H
Sbjct: 61 VVVDLKAAPATVSELDRQLSLNESVLRTKVMRADKH 96


>gi|308175797|ref|YP_003922502.1| 30S ribosomal protein S6 (BS9) [Bacillus amyloliquefaciens DSM 7]
 gi|307608661|emb|CBI45032.1| ribosomal protein S6 (BS9) [Bacillus amyloliquefaciens DSM 7]
 gi|328555773|gb|AEB26265.1| 30S ribosomal protein S6 [Bacillus amyloliquefaciens TA208]
 gi|328914162|gb|AEB65758.1| ribosomal protein S6 (BS9) [Bacillus amyloliquefaciens LL3]
          Length = 95

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 52/95 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++++R +I  +  K  I ++ +++  NG E+    + G R +AY I   R  +Y
Sbjct: 1  MKKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N+ S  AA+ E  R  +I ++++R + +  + 
Sbjct: 61 QILNVQSDAAAVSEFDRLAKISDDIIRHIVVKEEE 95


>gi|254779789|ref|YP_003057895.1| 30S ribosomal protein S6 [Helicobacter pylori B38]
 gi|254001701|emb|CAX29932.1| 30S ribosomal subunit protein S6 [Helicobacter pylori B38]
          Length = 142

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEIEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 121 EKTEHTHSHHAEEAE 135


>gi|254492099|ref|ZP_05105274.1| ribosomal protein S6 [Methylophaga thiooxidans DMS010]
 gi|224462651|gb|EEF78925.1| ribosomal protein S6 [Methylophaga thiooxydans DMS010]
          Length = 92

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 24/90 (26%), Positives = 43/90 (47%)

Query: 22  TIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRI 81
            I +Y   +   GG +    + G R +AY I K  KA+YV MN+      ++E+    R 
Sbjct: 1   MIERYTQTLTSQGGTIHRQEDWGRRQLAYPINKVHKAHYVLMNVECDVEQLNEVTTAFRF 60

Query: 82  DENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           ++ V+R L + +D     P+  +Q+ +   
Sbjct: 61  NDAVIRHLVVNMDEAATEPSPMMQKDEEKK 90


>gi|187777388|ref|ZP_02993861.1| hypothetical protein CLOSPO_00944 [Clostridium sporogenes ATCC
          15579]
 gi|187774316|gb|EDU38118.1| hypothetical protein CLOSPO_00944 [Clostridium sporogenes ATCC
          15579]
          Length = 94

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 50/94 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE VF+L   +  +  K  + +++ +I+  GG V  V+  G R +AY ++K  + YY
Sbjct: 1  MRKYETVFILNPALDEEGYKANVEKFKGVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            MN  +      E+ R  RI ++V+R + +  +
Sbjct: 61 TLMNFTADTELPKELDRVFRITDSVIRHMIITQE 94


>gi|268316169|ref|YP_003289888.1| 30S ribosomal protein S6 [Rhodothermus marinus DSM 4252]
 gi|262333703|gb|ACY47500.1| ribosomal protein S6 [Rhodothermus marinus DSM 4252]
          Length = 144

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 61/116 (52%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE  +++   +S  QIK+ I +    I+E+GGE+  ++E G R +AY I+K R  YYV
Sbjct: 6   NFYELTYIINAALSDDQIKEVIRRVNQYIEEHGGEIVEIDEWGTRRLAYPIQKRRNGYYV 65

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFP 117
            M   +P + I  ++R + IDE VLR LTL +D+         ++   +    R  
Sbjct: 66  NMYFRAPASLIAALERFLEIDEQVLRYLTLRMDAKMLRHYERRKQQAAEAARPRPK 121


>gi|237750843|ref|ZP_04581323.1| ribosomal protein S6 [Helicobacter bilis ATCC 43879]
 gi|229373288|gb|EEO23679.1| ribosomal protein S6 [Helicobacter bilis ATCC 43879]
          Length = 145

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 39/142 (27%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE  F+L+  +  ++IK  I  ++ +I +NGG +    ++GMR +AY+I+KN + YY
Sbjct: 1   MRHYETAFVLKPTLVEEEIKAKIDFFKEVILKNGGHIETCLDMGMRNLAYQIKKNSRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQR------------HD 108
             +   + P  I E++R   I+E VLR + +  +S ++                      
Sbjct: 61  FCIYFKADPTLIAELERLYGINEEVLRFIVIKYESKKEQEAWKTLVERAKKPEKPRTLKK 120

Query: 109 RDDRNDRFPRDRNVDRKQHVSE 130
            +DR +R P+  NV  ++  S+
Sbjct: 121 DEDRAERTPKKENVQNEEQSSQ 142


>gi|120406964|ref|YP_956793.1| 30S ribosomal protein S6 [Mycobacterium vanbaalenii PYR-1]
 gi|119959782|gb|ABM16787.1| SSU ribosomal protein S6P [Mycobacterium vanbaalenii PYR-1]
          Length = 96

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++I+++GG V  V+  G R +AY I K+ +  Y
Sbjct: 1  MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGTVDKVDIWGRRRLAYEIAKHAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R++ ++E+VLR+  +  D H
Sbjct: 61 AIVDVKAEPATVSELDRQLNLNESVLRTKVMRTDKH 96


>gi|195536239|ref|ZP_03079246.1| ribosomal protein S6 [Francisella tularensis subsp. novicida FTE]
 gi|208779342|ref|ZP_03246688.1| ribosomal protein S6 [Francisella novicida FTG]
 gi|194372716|gb|EDX27427.1| ribosomal protein S6 [Francisella tularensis subsp. novicida FTE]
 gi|208745142|gb|EDZ91440.1| ribosomal protein S6 [Francisella novicida FTG]
          Length = 103

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 58/102 (56%), Gaps = 1/102 (0%)

Query: 9   LLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASP 68
           ++  D  S Q+   +G+Y+ +I+E GG++    + G R +AY I K  KA+YV  NI  P
Sbjct: 1   MIHPD-QSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVLFNIECP 59

Query: 69  PAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
             ++ +++  +R ++ +LR L +        P++ ++ ++++
Sbjct: 60  TESLEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKE 101


>gi|148381565|ref|YP_001256106.1| ribosomal protein S6 [Clostridium botulinum A str. ATCC 3502]
 gi|153934321|ref|YP_001385942.1| 30S ribosomal protein S6 [Clostridium botulinum A str. ATCC
          19397]
 gi|153934983|ref|YP_001389349.1| 30S ribosomal protein S6 [Clostridium botulinum A str. Hall]
 gi|166226821|sp|A7FZH1|RS6_CLOB1 RecName: Full=30S ribosomal protein S6
 gi|166226822|sp|A5I801|RS6_CLOBH RecName: Full=30S ribosomal protein S6
 gi|148291049|emb|CAL85186.1| 30S ribosomal protein S6 [Clostridium botulinum A str. ATCC 3502]
 gi|152930365|gb|ABS35865.1| 30S ribosomal protein S6 [Clostridium botulinum A str. ATCC
          19397]
 gi|152930897|gb|ABS36396.1| 30S ribosomal protein S6 [Clostridium botulinum A str. Hall]
          Length = 94

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 49/94 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE VF+L   +  +  K  + +++ +I+  GG V  V+  G R +AY ++K  + YY
Sbjct: 1  MRKYETVFILNPTLDEEGYKANVEKFKGVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            MN  +      E+ R  RI + V+R + +  +
Sbjct: 61 TLMNFTADTELPKELDRVFRITDTVIRHMIITQE 94


>gi|111020421|ref|YP_703393.1| 30S ribosomal protein S6 [Rhodococcus jostii RHA1]
 gi|226362639|ref|YP_002780417.1| 30S ribosomal protein S6 [Rhodococcus opacus B4]
 gi|123340395|sp|Q0SB51|RS6_RHOSR RecName: Full=30S ribosomal protein S6
 gi|254765449|sp|C1B719|RS6_RHOOB RecName: Full=30S ribosomal protein S6
 gi|110819951|gb|ABG95235.1| 30S ribosomal protein S6 [Rhodococcus jostii RHA1]
 gi|226241124|dbj|BAH51472.1| 30S ribosomal protein S6 [Rhodococcus opacus B4]
          Length = 95

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 58/95 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++++++GG++  V+  G R +AY I K+ +  Y
Sbjct: 1  MRHYELMVILDPSLDERTVAPSLDTFLNVVRQDGGKIDKVDVWGKRRLAYEILKHSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            ++I++ PA + E+ R++ ++E+VLR+  L  + 
Sbjct: 61 AVIDISATPATVAELDRQLGLNESVLRTKVLRHNK 95


>gi|253700101|ref|YP_003021290.1| 30S ribosomal protein S6 [Geobacter sp. M21]
 gi|259495335|sp|C6E503|RS6_GEOSM RecName: Full=30S ribosomal protein S6
 gi|251774951|gb|ACT17532.1| ribosomal protein S6 [Geobacter sp. M21]
          Length = 134

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 23/101 (22%), Positives = 57/101 (56%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           ++YE +++++ D+  ++IK    + Q ++    G+ + + + G R +AY I KN +  Y 
Sbjct: 3   RMYETIYIVQPDLGDEEIKALSTKVQDVVAGMNGDFKRLEDWGTRKLAYPINKNPRGRYF 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
           ++        I E++R++R+D+ V+R  ++ +++   +P  
Sbjct: 63  YLRFDGDSGLIAELERRLRLDDKVIRYQSVKLETEVVAPAA 103


>gi|167629779|ref|YP_001680278.1| 30S ribosomal protein s6 [Heliobacterium modesticaldum Ice1]
 gi|226703473|sp|B0TE72|RS6_HELMI RecName: Full=30S ribosomal protein S6
 gi|167592519|gb|ABZ84267.1| 30S ribosomal protein s6 [Heliobacterium modesticaldum Ice1]
          Length = 96

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 58/95 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE V L+R ++  + ++  I ++ +L+ + GGEV  V++ G R + Y ++K ++A+Y
Sbjct: 1  MREYEAVVLVRPNLEEEALQGVIDKFVNLVPQQGGEVVKVDKWGKRRLQYEVKKFKEAFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N    PA   E++R M+I ++++R L +  D 
Sbjct: 61 FLLNFKGEPAVAQELERVMKISDDIIRFLVVRKDE 95


>gi|303228730|ref|ZP_07315550.1| ribosomal protein S6 [Veillonella atypica ACS-134-V-Col7a]
 gi|303231522|ref|ZP_07318251.1| ribosomal protein S6 [Veillonella atypica ACS-049-V-Sch6]
 gi|302513768|gb|EFL55781.1| ribosomal protein S6 [Veillonella atypica ACS-049-V-Sch6]
 gi|302516604|gb|EFL58526.1| ribosomal protein S6 [Veillonella atypica ACS-134-V-Col7a]
          Length = 94

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 1/94 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE + +++     +     I + ++LI   GG V  V+  G R +AY ++K    +Y
Sbjct: 1  MNKYEVMVIVKPA-EEEATNAVIEKVEALIARVGGTVEKVDRWGKRRLAYAVKKFTDGFY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V +N  + PA I E+ R ++I+++VLR L +  D
Sbjct: 60 VLVNFEADPAEIKEIDRVLKINDDVLRHLIVKHD 93


>gi|294630310|ref|ZP_06708870.1| 30S ribosomal protein S6 [Streptomyces sp. e14]
 gi|292833643|gb|EFF91992.1| 30S ribosomal protein S6 [Streptomyces sp. e14]
          Length = 96

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 58/96 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S++++ GG+V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERSVSPLIENFLSVVRDGGGKVEKVDTWGRRRLAYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPETH 96


>gi|253573876|ref|ZP_04851218.1| 30S ribosomal protein S6 [Paenibacillus sp. oral taxon 786 str.
          D14]
 gi|251846353|gb|EES74359.1| 30S ribosomal protein S6 [Paenibacillus sp. oral taxon 786 str.
          D14]
          Length = 94

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 30/92 (32%), Positives = 55/92 (59%), Gaps = 1/92 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R D+  + ++ T+ ++Q +I +NGGE+     LG R +AY I K R   Y
Sbjct: 1  MRKYEVMYIIRPDVEQEAVQATVEKFQGII-QNGGEITKHEVLGKRRLAYEINKVRDGIY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          V +N  + P  + E++R ++I + V+R L   
Sbjct: 60 VLVNFTAAPEVVAELERILKISDEVIRYLITK 91


>gi|302393058|ref|YP_003828878.1| ribosomal protein S6 [Acetohalobium arabaticum DSM 5501]
 gi|302205135|gb|ADL13813.1| ribosomal protein S6 [Acetohalobium arabaticum DSM 5501]
          Length = 95

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 51/94 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F++  D+     ++ + +    I EN GE+  +++ G + +AY +  ++  YY
Sbjct: 1  MRKYETMFIVNPDLEDDATEEIVEKITDTIDENKGEISNIDKWGTKNLAYELDDHKAGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N       I E++R  R+D+N+LR + L  +
Sbjct: 61 TVVNFEGESETIDELERAYRLDDNILRFIILRDE 94


>gi|147679227|ref|YP_001213442.1| 30S ribosomal protein S6 [Pelotomaculum thermopropionicum SI]
 gi|189045485|sp|A5CY52|RS6_PELTS RecName: Full=30S ribosomal protein S6
 gi|146275324|dbj|BAF61073.1| ribosomal protein S6 [Pelotomaculum thermopropionicum SI]
          Length = 95

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 58/95 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+LR D+  ++  + I ++++LI+ +GGE+  +++ G R +AY ++  R+ +Y
Sbjct: 1  MRKYEVIFILRPDLEEEKNAEVIEKFKNLIESHGGEIIKIDKWGKRRLAYEVKDFREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + + I + P    E+ R  +I + VLR + +  + 
Sbjct: 61 IVIQINAEPKLAAELDRVFKITDEVLRHMIVRENE 95


>gi|254818593|ref|ZP_05223594.1| 30S ribosomal protein S6 [Mycobacterium intracellulare ATCC
          13950]
          Length = 96

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 58/96 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++++++GG V  V+  G R +AY I K+ +  Y
Sbjct: 1  MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGSVDKVDIWGRRRLAYEIAKHAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
          V +++ + PA + E+ R++ ++E+VLR+  +  D H
Sbjct: 61 VVVDLKAEPATVSELDRQLSLNESVLRTKVMRTDKH 96


>gi|210135405|ref|YP_002301844.1| 30S ribosomal protein S6 [Helicobacter pylori P12]
 gi|226703474|sp|B6JN86|RS6_HELP2 RecName: Full=30S ribosomal protein S6
 gi|210133373|gb|ACJ08364.1| 30S ribosomal protein S6 [Helicobacter pylori P12]
          Length = 142

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMIVELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 121 EKTEHTHSHHAEEAE 135


>gi|223982849|ref|ZP_03633070.1| hypothetical protein HOLDEFILI_00344 [Holdemania filiformis DSM
          12042]
 gi|223965171|gb|EEF69462.1| hypothetical protein HOLDEFILI_00344 [Holdemania filiformis DSM
          12042]
          Length = 96

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 50/95 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++++   +     +  I    ++I +NGG++  V++ G++  AYRI    K YY
Sbjct: 1  MKKYEVMYIVNASLDDAARQQVIDGLHAIITDNGGKILKVDDWGVKEFAYRIEDMTKGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +   +  A + E  R  RI+ N++R + +  D 
Sbjct: 61 MVVTFEADNATVKEFDRLSRINANIVRYMIIKQDE 95


>gi|169631972|ref|YP_001705621.1| 30S ribosomal protein S6 [Mycobacterium abscessus ATCC 19977]
 gi|226695103|sp|B1MMI2|RS6_MYCA9 RecName: Full=30S ribosomal protein S6
 gi|169243939|emb|CAM64967.1| 30S ribosomal protein S6 [Mycobacterium abscessus]
          Length = 96

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 53/93 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++++ +GG V  V   G R +AY I K+ +  Y
Sbjct: 1  MRQYEIMVILDPTLDERTVAPSLDTFLNVVRGDGGTVSKVEVWGKRRLAYEIAKHTEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLV 93
            +++ + PA + E+ R++ ++E+VLR+  L  
Sbjct: 61 AVIDVVAAPATVSELDRQLGLNESVLRTKVLRT 93


>gi|254448153|ref|ZP_05061616.1| ribosomal protein S6 [gamma proteobacterium HTCC5015]
 gi|198262279|gb|EDY86561.1| ribosomal protein S6 [gamma proteobacterium HTCC5015]
          Length = 94

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 51/93 (54%), Gaps = 1/93 (1%)

Query: 22  TIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRI 81
            I +Y+++I++ GG +    + G R +AY I K  KA+YV MN+    + + E+    R 
Sbjct: 1   MIERYRAIIEQ-GGNIHRQEDWGRRQLAYPINKIHKAHYVLMNVECEQSVLDELTSTFRF 59

Query: 82  DENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
           ++ ++R++ + +D     P+   +  D+DD  D
Sbjct: 60  NDAIIRNMVVQLDEAVTEPSPLAKSSDKDDSAD 92


>gi|170761522|ref|YP_001788970.1| 30S ribosomal protein S6 [Clostridium botulinum A3 str. Loch
          Maree]
 gi|226703443|sp|B1KU97|RS6_CLOBM RecName: Full=30S ribosomal protein S6
 gi|169408511|gb|ACA56922.1| 30S ribosomal protein S6 [Clostridium botulinum A3 str. Loch
          Maree]
          Length = 94

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 50/94 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE VF+L   +  +  K  + +++ +I+ +GG V  V+  G R +AY ++K  + YY
Sbjct: 1  MRKYETVFILNPALDEEGYKANVEKFKGVIENSGGTVDNVDLWGKRKLAYEVKKVSEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            MN  +      E+ R  RI + V+R + +  +
Sbjct: 61 TLMNFTADTELPKELDRVFRITDTVIRHMIITQE 94


>gi|317014637|gb|ADU82073.1| 30S ribosomal protein S6 [Helicobacter pylori Gambia94/24]
          Length = 142

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/137 (25%), Positives = 74/137 (54%), Gaps = 2/137 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKADPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKPLS 135
           ++      H +EE   +
Sbjct: 121 EKTEHAHSHHAEEAKSA 137


>gi|317013032|gb|ADU83640.1| 30S ribosomal protein S6 [Helicobacter pylori Lithuania75]
          Length = 142

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 72/135 (53%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H  EE  
Sbjct: 121 EKTEHTHSHHVEEAE 135


>gi|317164471|gb|ADV08012.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 105

 Score =   99 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 47/93 (50%)

Query: 19  IKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRK 78
           +   + +Y+++I E  G++  + + G R +AY I K  KA+YV MNI + P  + E++  
Sbjct: 1   MPAMVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIETTPEVVGELETA 60

Query: 79  MRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
            R ++ VLR LT+         +  +      +
Sbjct: 61  FRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 93


>gi|89100932|ref|ZP_01173779.1| ribosomal protein S6 (BS9) [Bacillus sp. NRRL B-14911]
 gi|89084341|gb|EAR63495.1| ribosomal protein S6 (BS9) [Bacillus sp. NRRL B-14911]
          Length = 95

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 53/95 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R +I  +  K  + ++ S++ +NG E+    + G R +AY I   R  YY
Sbjct: 1  MRKYEIMYVIRPNIEDEAKKALVERFNSILTDNGAELTESKDWGKRRLAYEINDFRDGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +++ +  AA+ E  R  +I E+++R + +  + 
Sbjct: 61 QLIHLNAEAAAVDEFTRLAKISEDIIRHMVVKDEK 95


>gi|238061879|ref|ZP_04606588.1| 30S ribosomal protein S6 [Micromonospora sp. ATCC 39149]
 gi|237883690|gb|EEP72518.1| 30S ribosomal protein S6 [Micromonospora sp. ATCC 39149]
          Length = 96

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 54/94 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  Y ++I+  GG V   +  G R +AY I K  +  Y
Sbjct: 1  MRHYEIMVILDPSLEERTVAPSLDTYLNVIRTAGGSVEKTDVWGRRRLAYEINKKAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +++ + PAA+ E+ R++R++E+VLR+  +  +
Sbjct: 61 AVVDLQATPAAVAELDRQLRLNESVLRTKVIRPE 94


>gi|108563614|ref|YP_627930.1| 30S ribosomal protein S6 [Helicobacter pylori HPAG1]
 gi|123073733|sp|Q1CS16|RS6_HELPH RecName: Full=30S ribosomal protein S6
 gi|107837387|gb|ABF85256.1| ribosomal protein S6 [Helicobacter pylori HPAG1]
 gi|317182495|dbj|BAJ60279.1| 30S ribosomal protein S6 [Helicobacter pylori F57]
          Length = 142

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 72/135 (53%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H  EE  
Sbjct: 121 EKTEHTHSHHLEEAE 135


>gi|72383153|ref|YP_292508.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. NATL2A]
 gi|91207930|sp|Q46I73|RS6_PROMT RecName: Full=30S ribosomal protein S6
 gi|72003003|gb|AAZ58805.1| SSU ribosomal protein S6P [Prochlorococcus marinus str. NATL2A]
          Length = 138

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 65/130 (50%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR DI  +++   + +Y  +++++  EV      G R +AY I K+++  YV
Sbjct: 5   PYYETMYILRPDIPEEEVDSHLKKYSEILEKSETEVLDSQMRGKRRLAYPIAKHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            ++       +  ++R MR+ E+V+R +T+  D    +P  T + ++ +    +   ++ 
Sbjct: 65  QLSHKGNGQQVATLERAMRLSEDVIRYITVKQDGPLPTPKPTSKENEPEKEEVKPTEEKT 124

Query: 122 VDRKQHVSEE 131
               +   +E
Sbjct: 125 ESPSKDEKKE 134


>gi|317011446|gb|ADU85193.1| 30S ribosomal protein S6 [Helicobacter pylori SouthAfrica7]
          Length = 142

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/134 (26%), Positives = 73/134 (54%), Gaps = 2/134 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKTKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEK 132
           ++      H +EE 
Sbjct: 121 EKTEHTHSHHTEEA 134


>gi|297380426|gb|ADI35313.1| ribosomal protein S6 [Helicobacter pylori v225d]
          Length = 137

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEVGAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 121 EKTEHTHSHHTEEAE 135


>gi|153941470|ref|YP_001392984.1| 30S ribosomal protein S6 [Clostridium botulinum F str. Langeland]
 gi|168181095|ref|ZP_02615759.1| ribosomal protein S6 [Clostridium botulinum NCTC 2916]
 gi|170755574|ref|YP_001783263.1| 30S ribosomal protein S6 [Clostridium botulinum B1 str. Okra]
 gi|226951080|ref|YP_002806171.1| ribosomal protein S6 [Clostridium botulinum A2 str. Kyoto]
 gi|166226823|sp|A7GJM4|RS6_CLOBL RecName: Full=30S ribosomal protein S6
 gi|226703442|sp|B1IHQ4|RS6_CLOBK RecName: Full=30S ribosomal protein S6
 gi|254765230|sp|C1FP16|RS6_CLOBJ RecName: Full=30S ribosomal protein S6
 gi|152937366|gb|ABS42864.1| 30S ribosomal protein S6 [Clostridium botulinum F str. Langeland]
 gi|169120786|gb|ACA44622.1| 30S ribosomal protein S6 [Clostridium botulinum B1 str. Okra]
 gi|182668139|gb|EDT80118.1| ribosomal protein S6 [Clostridium botulinum NCTC 2916]
 gi|226843146|gb|ACO85812.1| ribosomal protein S6 [Clostridium botulinum A2 str. Kyoto]
 gi|295320959|gb|ADG01337.1| 30S ribosomal protein S6 [Clostridium botulinum F str. 230613]
 gi|322807952|emb|CBZ05527.1| SSU ribosomal protein S6p [Clostridium botulinum H04402 065]
          Length = 94

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 49/94 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE VF+L   +  +  K  + +++ +I+  GG V  V+  G R +AY ++K  + YY
Sbjct: 1  MRKYETVFILNPALDEEGYKANVEKFKGVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            MN  +      E+ R  RI + V+R + +  +
Sbjct: 61 TLMNFTADTELPKELDRVFRITDTVIRHMIITQE 94


>gi|300857398|ref|YP_003782382.1| 30S ribosomal protein S6 [Clostridium ljungdahlii DSM 13528]
 gi|300437513|gb|ADK17280.1| 30S ribosomal protein S6 [Clostridium ljungdahlii DSM 13528]
          Length = 95

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 49/95 (51%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +F+L+  +  +  K  I +++ +I+  GG +  V+  G R +AY I K  + YY
Sbjct: 1  MSKYETIFILQPSLDEEACKANIEKFKGVIENGGGVIENVDVWGKRKLAYEINKVNEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N  + P    E+ R  RI + V+R + +  + 
Sbjct: 61 TLINFNADPKLPKELDRVFRITDTVIRHIIVKDEK 95


>gi|15612232|ref|NP_223885.1| 30S ribosomal protein S6 [Helicobacter pylori J99]
 gi|7388226|sp|Q9ZJY1|RS6_HELPJ RecName: Full=30S ribosomal protein S6
 gi|4155764|gb|AAD06741.1| 30S RIBOSOMAL PROTEIN S6 [Helicobacter pylori J99]
          Length = 142

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/134 (26%), Positives = 73/134 (54%), Gaps = 2/134 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKADPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEK 132
           ++      H +EE 
Sbjct: 121 EKTEHTHSHHAEEA 134


>gi|108802329|ref|YP_642526.1| 30S ribosomal protein S6 [Mycobacterium sp. MCS]
 gi|119871482|ref|YP_941434.1| 30S ribosomal protein S6 [Mycobacterium sp. KMS]
 gi|126438309|ref|YP_001074000.1| 30S ribosomal protein S6 [Mycobacterium sp. JLS]
 gi|108772748|gb|ABG11470.1| SSU ribosomal protein S6P [Mycobacterium sp. MCS]
 gi|119697571|gb|ABL94644.1| SSU ribosomal protein S6P [Mycobacterium sp. KMS]
 gi|126238109|gb|ABO01510.1| SSU ribosomal protein S6P [Mycobacterium sp. JLS]
          Length = 96

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++I+++GG V  V+  G R +AY I K+ +  Y
Sbjct: 1  MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGSVDKVDIWGRRRLAYEIAKHAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R++ ++E+VLR+  +  D H
Sbjct: 61 AVIDVKAAPATVTELDRQLSLNESVLRTKVMRTDKH 96


>gi|294813713|ref|ZP_06772356.1| 30S ribosomal protein S6 [Streptomyces clavuligerus ATCC 27064]
 gi|294326312|gb|EFG07955.1| 30S ribosomal protein S6 [Streptomyces clavuligerus ATCC 27064]
          Length = 107

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 57/96 (59%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R +AY I+K  +  Y
Sbjct: 12  MRHYEVMVILDPDLEERAVAPLIENFLSVVREGNGKVEKVDTWGRRRLAYEIKKKPEGIY 71

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
             +++ + PA + E+ R+M ++E+VLR+  L  ++H
Sbjct: 72  SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPETH 107


>gi|154688195|ref|YP_001423356.1| 30S ribosomal protein S6 [Bacillus amyloliquefaciens FZB42]
 gi|166226800|sp|A7ZAU9|RS6_BACA2 RecName: Full=30S ribosomal protein S6
 gi|154354046|gb|ABS76125.1| RpsF [Bacillus amyloliquefaciens FZB42]
          Length = 95

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 52/95 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++++R +I  +  K  I ++ +++  NG E+    + G R +AY I   R  +Y
Sbjct: 1  MKKYEVMYIIRPNIDEESKKAVIERFNNVLTSNGAEITGTKDWGKRRLAYEINDFRDGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N+ S  AA+ E  R  +I ++++R + +  + 
Sbjct: 61 QILNVQSEAAAVAEFDRLAKISDDIIRHIVVKEEE 95


>gi|284036034|ref|YP_003385964.1| ribosomal protein S6 [Spirosoma linguale DSM 74]
 gi|283815327|gb|ADB37165.1| ribosomal protein S6 [Spirosoma linguale DSM 74]
          Length = 124

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 4/125 (3%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE VF+L   +S  Q+KD + +++ ++ +NG E+   + +G+R +AY I+     YY 
Sbjct: 4   NNYETVFILTPVLSEAQMKDAVDKFRKVLTDNGAELVHEDHMGLRKLAYPIQHKNTGYYQ 63

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
                +P   I ++  +   DE ++R LT+ +D H     +      R+    +  +  N
Sbjct: 64  LFEFKAPGTIIEKLNTEYLRDERIIRHLTVSLDKH----AVAYNDRKRNGLVGKKKQTEN 119

Query: 122 VDRKQ 126
               +
Sbjct: 120 AGEAK 124


>gi|85859720|ref|YP_461922.1| 30S ribosomal protein S6P [Syntrophus aciditrophicus SB]
 gi|85722811|gb|ABC77754.1| SSU ribosomal protein S6P [Syntrophus aciditrophicus SB]
          Length = 173

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 57/116 (49%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE V + + ++    +   I +Y S+I +  G V  ++  G+R +AY IRK  +  YV
Sbjct: 22  RRYETVVIAQANLPEDDMTGLIERYNSIIADRKGTVVKIDRWGVRKLAYDIRKQTRGAYV 81

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFP 117
             + A     + E++R ++ID+NVL+ +T+L D    +  +  +      +     
Sbjct: 82  IYDFAGTSDVVAELERNLKIDDNVLKYMTVLTDPETTAENIMKEITALAKKETEEK 137


>gi|308184993|ref|YP_003929126.1| 30S ribosomal protein S6 [Helicobacter pylori SJM180]
 gi|308060913|gb|ADO02809.1| 30S ribosomal protein S6 [Helicobacter pylori SJM180]
          Length = 142

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 73/135 (54%), Gaps = 2/135 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYREVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMIVELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPPHAKEKH 120

Query: 119 DRNVDRKQHVSEEKP 133
           ++      H +EE  
Sbjct: 121 EKTEHTHSHHAEEAE 135


>gi|41406165|ref|NP_959001.1| 30S ribosomal protein S6 [Mycobacterium avium subsp.
          paratuberculosis K-10]
 gi|118465214|ref|YP_879374.1| 30S ribosomal protein S6 [Mycobacterium avium 104]
 gi|254773120|ref|ZP_05214636.1| 30S ribosomal protein S6 [Mycobacterium avium subsp. avium ATCC
          25291]
 gi|61215645|sp|Q744V6|RS6_MYCPA RecName: Full=30S ribosomal protein S6
 gi|41394513|gb|AAS02384.1| RpsF [Mycobacterium avium subsp. paratuberculosis K-10]
 gi|118166501|gb|ABK67398.1| ribosomal protein S6 [Mycobacterium avium 104]
          Length = 96

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 58/96 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++++++GG V  V+  G R +AY I K+ +  Y
Sbjct: 1  MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGSVEKVDIWGRRRLAYEIAKHAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
          V +++ + PA + E+ R++ ++E+VLR+  +  D H
Sbjct: 61 VVIDLKAEPATVSELDRQLSLNESVLRTKVMRTDKH 96


>gi|220907101|ref|YP_002482412.1| 30S ribosomal protein S6 [Cyanothece sp. PCC 7425]
 gi|254765234|sp|B8HR63|RS6_CYAP4 RecName: Full=30S ribosomal protein S6
 gi|219863712|gb|ACL44051.1| ribosomal protein S6 [Cyanothece sp. PCC 7425]
          Length = 106

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/97 (34%), Positives = 54/97 (55%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
           LYE ++++R D+  + +   I QYQSL+++ G E       G R +AY IRK R+  YV 
Sbjct: 4   LYETMYIIRPDLGEETVDQVINQYQSLLRDQGAEDVQTQHRGKRRLAYEIRKFREGIYVQ 63

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQS 99
           MN  +    +  ++R MR+ + V+R LT+  D  +  
Sbjct: 64  MNYKAAGPLVANLQRAMRLSDEVIRYLTICQDEPDTD 100


>gi|30265492|ref|NP_847869.1| 30S ribosomal protein S6 [Bacillus anthracis str. Ames]
 gi|47531060|ref|YP_022409.1| 30S ribosomal protein S6 [Bacillus anthracis str. 'Ames
          Ancestor']
 gi|49188311|ref|YP_031564.1| 30S ribosomal protein S6 [Bacillus anthracis str. Sterne]
 gi|49481194|ref|YP_039464.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar
          konkukian str. 97-27]
 gi|52145282|ref|YP_086739.1| 30S ribosomal protein S6 [Bacillus cereus E33L]
 gi|165873021|ref|ZP_02217642.1| ribosomal protein S6 [Bacillus anthracis str. A0488]
 gi|167635107|ref|ZP_02393424.1| ribosomal protein S6 [Bacillus anthracis str. A0442]
 gi|167641752|ref|ZP_02399995.1| ribosomal protein S6 [Bacillus anthracis str. A0193]
 gi|170689457|ref|ZP_02880647.1| ribosomal protein S6 [Bacillus anthracis str. A0465]
 gi|170707585|ref|ZP_02898038.1| ribosomal protein S6 [Bacillus anthracis str. A0389]
 gi|177655277|ref|ZP_02936831.1| ribosomal protein S6 [Bacillus anthracis str. A0174]
 gi|190569298|ref|ZP_03022192.1| ribosomal protein S6 [Bacillus anthracis Tsiankovskii-I]
 gi|196036113|ref|ZP_03103513.1| ribosomal protein S6 [Bacillus cereus W]
 gi|196041953|ref|ZP_03109240.1| ribosomal protein S6 [Bacillus cereus NVH0597-99]
 gi|196045561|ref|ZP_03112792.1| ribosomal protein S6 [Bacillus cereus 03BB108]
 gi|206975820|ref|ZP_03236731.1| 30S ribosomal protein S6 [Bacillus cereus H3081.97]
 gi|217962967|ref|YP_002341545.1| 30S ribosomal protein S6 [Bacillus cereus AH187]
 gi|218906666|ref|YP_002454500.1| ribosomal protein S6 [Bacillus cereus AH820]
 gi|222098951|ref|YP_002533009.1| 30S ribosomal protein s6 [Bacillus cereus Q1]
 gi|225867455|ref|YP_002752833.1| 30S ribosomal protein S6 [Bacillus cereus 03BB102]
 gi|227818243|ref|YP_002818252.1| 30S ribosomal protein S6 [Bacillus anthracis str. CDC 684]
 gi|228918086|ref|ZP_04081614.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|228949196|ref|ZP_04111464.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|229094585|ref|ZP_04225652.1| 30S ribosomal protein S6 [Bacillus cereus Rock3-42]
 gi|229124977|ref|ZP_04254151.1| 30S ribosomal protein S6 [Bacillus cereus 95/8201]
 gi|229142223|ref|ZP_04270747.1| 30S ribosomal protein S6 [Bacillus cereus BDRD-ST26]
 gi|229187703|ref|ZP_04314839.1| 30S ribosomal protein S6 [Bacillus cereus BGSC 6E1]
 gi|229602976|ref|YP_002869683.1| 30S ribosomal protein S6 [Bacillus anthracis str. A0248]
 gi|254687085|ref|ZP_05150943.1| 30S ribosomal protein S6 [Bacillus anthracis str. CNEVA-9066]
 gi|254724132|ref|ZP_05185917.1| 30S ribosomal protein S6 [Bacillus anthracis str. A1055]
 gi|254735149|ref|ZP_05192859.1| 30S ribosomal protein S6 [Bacillus anthracis str. Western North
          America USA6153]
 gi|254742142|ref|ZP_05199829.1| 30S ribosomal protein S6 [Bacillus anthracis str. Kruger B]
 gi|254755948|ref|ZP_05207980.1| 30S ribosomal protein S6 [Bacillus anthracis str. Vollum]
 gi|254761372|ref|ZP_05213394.1| 30S ribosomal protein S6 [Bacillus anthracis str. Australia 94]
 gi|300118824|ref|ZP_07056544.1| 30S ribosomal protein S6 [Bacillus cereus SJ1]
 gi|301056948|ref|YP_003795159.1| 30S ribosomal protein S6 [Bacillus anthracis CI]
 gi|61215455|sp|Q630C8|RS6_BACCZ RecName: Full=30S ribosomal protein S6
 gi|61215550|sp|Q6HAG2|RS6_BACHK RecName: Full=30S ribosomal protein S6
 gi|61215741|sp|Q81JI2|RS6_BACAN RecName: Full=30S ribosomal protein S6
 gi|226703417|sp|B7JIK1|RS6_BACC0 RecName: Full=30S ribosomal protein S6
 gi|226703420|sp|B7HZG1|RS6_BACC7 RecName: Full=30S ribosomal protein S6
 gi|254765218|sp|C3P3E5|RS6_BACAA RecName: Full=30S ribosomal protein S6
 gi|254765219|sp|C3LGT1|RS6_BACAC RecName: Full=30S ribosomal protein S6
 gi|254765220|sp|C1ER67|RS6_BACC3 RecName: Full=30S ribosomal protein S6
 gi|254765221|sp|B9IT32|RS6_BACCQ RecName: Full=30S ribosomal protein S6
 gi|30260170|gb|AAP29355.1| 30S ribosomal protein S6 [Bacillus anthracis str. Ames]
 gi|47506208|gb|AAT34884.1| ribosomal protein S6 [Bacillus anthracis str. 'Ames Ancestor']
 gi|49182238|gb|AAT57614.1| ribosomal protein S6 [Bacillus anthracis str. Sterne]
 gi|49332750|gb|AAT63396.1| ribosomal protein S6 (30S ribosomal protein S6) [Bacillus
          thuringiensis serovar konkukian str. 97-27]
 gi|51978751|gb|AAU20301.1| ribosomal protein S6 (30S ribosomal protein S6) [Bacillus cereus
          E33L]
 gi|164711233|gb|EDR16789.1| ribosomal protein S6 [Bacillus anthracis str. A0488]
 gi|167510306|gb|EDR85709.1| ribosomal protein S6 [Bacillus anthracis str. A0193]
 gi|167529581|gb|EDR92331.1| ribosomal protein S6 [Bacillus anthracis str. A0442]
 gi|170127581|gb|EDS96455.1| ribosomal protein S6 [Bacillus anthracis str. A0389]
 gi|170666559|gb|EDT17332.1| ribosomal protein S6 [Bacillus anthracis str. A0465]
 gi|172080204|gb|EDT65296.1| ribosomal protein S6 [Bacillus anthracis str. A0174]
 gi|190559605|gb|EDV13596.1| ribosomal protein S6 [Bacillus anthracis Tsiankovskii-I]
 gi|195991280|gb|EDX55248.1| ribosomal protein S6 [Bacillus cereus W]
 gi|196023768|gb|EDX62444.1| ribosomal protein S6 [Bacillus cereus 03BB108]
 gi|196027208|gb|EDX65828.1| ribosomal protein S6 [Bacillus cereus NVH0597-99]
 gi|206745914|gb|EDZ57310.1| 30S ribosomal protein S6 [Bacillus cereus H3081.97]
 gi|217064055|gb|ACJ78305.1| ribosomal protein S6 [Bacillus cereus AH187]
 gi|218538036|gb|ACK90434.1| ribosomal protein S6 [Bacillus cereus AH820]
 gi|221243010|gb|ACM15720.1| ribosomal protein S6 (30S ribosomal protein S6) [Bacillus cereus
          Q1]
 gi|225786761|gb|ACO26978.1| 30S ribosomal protein S6 [Bacillus cereus 03BB102]
 gi|227005886|gb|ACP15629.1| 30S ribosomal protein S6 [Bacillus anthracis str. CDC 684]
 gi|228595771|gb|EEK53455.1| 30S ribosomal protein S6 [Bacillus cereus BGSC 6E1]
 gi|228641241|gb|EEK97548.1| 30S ribosomal protein S6 [Bacillus cereus BDRD-ST26]
 gi|228658478|gb|EEL14144.1| 30S ribosomal protein S6 [Bacillus cereus 95/8201]
 gi|228688832|gb|EEL42663.1| 30S ribosomal protein S6 [Bacillus cereus Rock3-42]
 gi|228810479|gb|EEM56832.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228841566|gb|EEM86682.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|229267384|gb|ACQ49021.1| 30S ribosomal protein S6 [Bacillus anthracis str. A0248]
 gi|298723792|gb|EFI64514.1| 30S ribosomal protein S6 [Bacillus cereus SJ1]
 gi|300379117|gb|ADK08021.1| 30S ribosomal protein S6 [Bacillus cereus biovar anthracis str.
          CI]
          Length = 96

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 53/95 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R  +  +  K  + ++  ++  NG E+    E G R +AY I   R+ +Y
Sbjct: 1  MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ +   AI+E  R  +I+E++LR + +  + 
Sbjct: 61 MILNVNANAEAINEFDRLAKINEDILRHIVVKEEE 95


>gi|322420135|ref|YP_004199358.1| 30S ribosomal protein S6 [Geobacter sp. M18]
 gi|320126522|gb|ADW14082.1| ribosomal protein S6 [Geobacter sp. M18]
          Length = 133

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/109 (22%), Positives = 59/109 (54%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           ++YE +++++ D+  ++IK    + Q +I    G+ + + + G R +AY I KN +  Y 
Sbjct: 3   RMYETIYIVQPDLGDEEIKALSTKVQDVIASMNGDFKRLEDWGTRKLAYPINKNPRGRYF 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRD 110
           ++   +    I E++R++R+D+ V+R  ++ ++    +P     +   +
Sbjct: 63  YLRFDADAPLIAELERRLRLDDKVIRYQSVKLEQEVVAPAAAPVKSAEE 111


>gi|56751494|ref|YP_172195.1| 30S ribosomal protein S6 [Synechococcus elongatus PCC 6301]
 gi|61216125|sp|Q5N1Z5|RS6_SYNP6 RecName: Full=30S ribosomal protein S6
 gi|56686453|dbj|BAD79675.1| 30S ribosomal protein S6 [Synechococcus elongatus PCC 6301]
          Length = 107

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/98 (33%), Positives = 55/98 (56%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
            YE  ++LR D++ +Q++  I +YQ+ + E G EV+     G R +AY I K R+  YV 
Sbjct: 5   YYETTYILRADLTEEQVEQAIAKYQTPLTEAGAEVQDTQHRGKRRLAYLINKQREGIYVQ 64

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
           +N     + I  ++R +R+ E VLR LT+  +    +P
Sbjct: 65  INYTGDGSQIAPLERALRLSEEVLRFLTVKQEVRPPAP 102


>gi|302552667|ref|ZP_07305009.1| ribosomal protein S6 [Streptomyces viridochromogenes DSM 40736]
 gi|302470285|gb|EFL33378.1| ribosomal protein S6 [Streptomyces viridochromogenes DSM 40736]
          Length = 96

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 58/96 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S++++ GG+V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDVEERAVSPLIENFLSVVRDGGGKVEKVDTWGRRRLAYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPETH 96


>gi|317968334|ref|ZP_07969724.1| 30S ribosomal protein S6 [Synechococcus sp. CB0205]
          Length = 114

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 52/94 (55%)

Query: 7   VFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIA 66
           +++LR DI  ++++  I +Y+ L+ E G EV      G R +AY I K+++  YV +   
Sbjct: 1   MYILRPDIPEEEVETHITKYRDLVTEAGAEVLDCQMRGKRRLAYTIAKHKEGIYVQLAHN 60

Query: 67  SPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
                +  +++ MR+ E+V+R LT+  D    +P
Sbjct: 61  GDGQQVAALEKAMRLSEDVIRYLTVKQDGPLPAP 94


>gi|239930202|ref|ZP_04687155.1| 30S ribosomal protein S6 [Streptomyces ghanaensis ATCC 14672]
 gi|291438546|ref|ZP_06577936.1| 30S ribosomal protein S6 [Streptomyces ghanaensis ATCC 14672]
 gi|291341441|gb|EFE68397.1| 30S ribosomal protein S6 [Streptomyces ghanaensis ATCC 14672]
          Length = 96

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 58/96 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S++++ GG+V  V+  G R ++Y I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVSPLIENFLSVVRDGGGKVEKVDTWGRRRLSYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPETH 96


>gi|254673113|emb|CBA07856.1| 30S ribosomal protein S6 [Neisseria meningitidis alpha275]
          Length = 110

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 47/93 (50%)

Query: 19  IKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRK 78
           +   + +Y+++I E  G++  + + G R +AY I K  KA+YV MNI + P  + E++  
Sbjct: 1   MPAMVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIETTPEVVEELETA 60

Query: 79  MRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
            R ++ VLR LT+         +  +      +
Sbjct: 61  FRFNDAVLRHLTIKTKHAVTEASPMLGGEKAKN 93


>gi|326383851|ref|ZP_08205535.1| 30S ribosomal protein S6 [Gordonia neofelifaecis NRRL B-59395]
 gi|326197310|gb|EGD54500.1| 30S ribosomal protein S6 [Gordonia neofelifaecis NRRL B-59395]
          Length = 93

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 53/92 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++++  GG+V  V   G R +AY I K+ +  Y
Sbjct: 1  MRHYELMVILDPSLDERTVAPSLDTFLNVVRNEGGKVDDVEIWGKRRLAYEIAKHNEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
            + + + PA + E+ R+++++E+VLR+  L 
Sbjct: 61 AVVQLNATPATVSELDRQLKLNESVLRTKVLR 92


>gi|300866122|ref|ZP_07110847.1| 30S ribosomal protein S6 [Oscillatoria sp. PCC 6506]
 gi|300335883|emb|CBN56005.1| 30S ribosomal protein S6 [Oscillatoria sp. PCC 6506]
          Length = 114

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/91 (34%), Positives = 54/91 (59%)

Query: 4  YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
          YE +++LR D+  +  +  I +YQ+++++ G +       G R +AY I+K R   Y+ M
Sbjct: 6  YETMYILRPDLGEELTEAAIAKYQTILRDQGAQNLETQHRGKRRLAYEIQKQRDGIYIQM 65

Query: 64 NIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          N  +P  AI  ++R MR+ E+V+R LT+  D
Sbjct: 66 NYTAPGTAIAILERAMRLSEDVIRYLTIKQD 96


>gi|294673369|ref|YP_003573985.1| 30S ribosomal protein S6 [Prevotella ruminicola 23]
 gi|294472198|gb|ADE81587.1| ribosomal protein S6 [Prevotella ruminicola 23]
          Length = 114

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 2/116 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T  +++ ++ + G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKETAAKFKKVLTDKGAEIINEEAWGLKKMAYAIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRF 116
             +   + P  I  ++   R DE V+R  T+ +D +        +R  +  + +  
Sbjct: 61  CLVEFKAEPEVIKTLETAFRRDEKVIRFQTVKLDKYAVE--YAEKRRAKLGKKEEA 114


>gi|298243925|ref|ZP_06967732.1| ribosomal protein S6 [Ktedonobacter racemifer DSM 44963]
 gi|297556979|gb|EFH90843.1| ribosomal protein S6 [Ktedonobacter racemifer DSM 44963]
          Length = 180

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 56/95 (58%), Gaps = 1/95 (1%)

Query: 1  MKL-YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAY 59
          M+  YE  F+L  ++S ++ +  + + + ++   GG++  VN  G R +AY I ++R   
Sbjct: 1  MRRDYELAFILNPEVSEEETRTILDRVEQIVANYGGQIVKVNNWGRRRLAYPIERHRDGI 60

Query: 60 YVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          YVF+++   P  + E++R +++ E+VLR +T   D
Sbjct: 61 YVFIDMILTPETVAEIERTLKVSESVLRYMTKKRD 95


>gi|291297663|ref|YP_003508941.1| 30S ribosomal protein S6 [Stackebrandtia nassauensis DSM 44728]
 gi|290566883|gb|ADD39848.1| ribosomal protein S6 [Stackebrandtia nassauensis DSM 44728]
          Length = 96

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 56/94 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  +Q+  ++  +  +I E GG V  ++  G R +AY I K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERQVTPSLENFLKVISEAGGAVENLDIWGRRRLAYEINKKSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
             N+ S PAA+ EM+R+MR++E+++R+  L  +
Sbjct: 61 AVANLQSEPAAVAEMERQMRLNESIMRTKVLRPE 94


>gi|182416762|ref|ZP_02948159.1| ribosomal protein S6 [Clostridium butyricum 5521]
 gi|237669664|ref|ZP_04529642.1| ribosomal protein S6 [Clostridium butyricum E4 str. BoNT E
          BL5262]
 gi|182379419|gb|EDT76914.1| ribosomal protein S6 [Clostridium butyricum 5521]
 gi|237654898|gb|EEP52460.1| ribosomal protein S6 [Clostridium butyricum E4 str. BoNT E
          BL5262]
          Length = 95

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 47/92 (51%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+L      + +K  I +++ +I+  GG V  V+  G R +AY I K  + YY
Sbjct: 1  MRKYETIFILNPSFDEETVKANIEKFKGVIENGGGTVENVDFWGKRKLAYEIAKVNEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
            +N  +      E+ R  RI + V+R + + 
Sbjct: 61 TLVNFTAGTELPRELDRIFRITDGVIRHIIVN 92


>gi|148265698|ref|YP_001232404.1| 30S ribosomal protein S6 [Geobacter uraniireducens Rf4]
 gi|189045470|sp|A5G7R3|RS6_GEOUR RecName: Full=30S ribosomal protein S6
 gi|146399198|gb|ABQ27831.1| SSU ribosomal protein S6P [Geobacter uraniireducens Rf4]
          Length = 128

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 55/95 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M++YE +F+++ D+  +++K    + Q +I    G+ + + + G R +AY I K  +  Y
Sbjct: 1  MRMYETIFIVQPDLGEEEMKGISTKVQDVIASMKGDFKRLEDWGPRKLAYPINKFARGRY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           ++      A I E++R++R+D+ V+R  ++ ++ 
Sbjct: 61 YYLRFDGDSALIAELERRLRLDDKVIRYQSVKLEK 95


>gi|319957605|ref|YP_004168868.1| SSU ribosomal protein s6p [Nitratifractor salsuginis DSM 16511]
 gi|319420009|gb|ADV47119.1| SSU ribosomal protein S6P [Nitratifractor salsuginis DSM 16511]
          Length = 154

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/137 (25%), Positives = 71/137 (51%), Gaps = 4/137 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE +F+++  +++++I+  I + + +I ENGGE++  +E+GMR +AY I K  + YY
Sbjct: 1   MNCYETLFVVKPTLTAEEIEGQIARVKEIIAENGGELKATDEMGMRRLAYPIEKQERGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQ----SPTLTIQRHDRDDRNDRF 116
             +   +P   + E++R++R +E +LR +T+   + ++       +              
Sbjct: 61  TVVYYTAPSEMVIELERQLRYNEEILRFMTVKYTNKKELAVFEKMVEAANKKPAPEKSEA 120

Query: 117 PRDRNVDRKQHVSEEKP 133
           P        +  +EEKP
Sbjct: 121 PVAEEAPAVEAPAEEKP 137


>gi|330470802|ref|YP_004408545.1| ribosomal protein s6 [Verrucosispora maris AB-18-032]
 gi|328813773|gb|AEB47945.1| ribosomal protein s6 [Verrucosispora maris AB-18-032]
          Length = 96

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 53/94 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  Y ++I+  GG V   +  G R +AY I K  +  Y
Sbjct: 1  MRHYEIMVILDPSLEERTVAPSLDTYLNVIRTAGGSVEKTDVWGRRRLAYEINKKAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +++ + P A+ E+ R++R++E+VLR+  +  +
Sbjct: 61 AVVDLQATPEAVAELDRQLRLNESVLRTKVIRPE 94


>gi|168183706|ref|ZP_02618370.1| 30S ribosomal protein S6 [Clostridium botulinum Bf]
 gi|237797085|ref|YP_002864637.1| 30S ribosomal protein S6 [Clostridium botulinum Ba4 str. 657]
 gi|259495327|sp|C3KWI0|RS6_CLOB6 RecName: Full=30S ribosomal protein S6
 gi|182673234|gb|EDT85195.1| 30S ribosomal protein S6 [Clostridium botulinum Bf]
 gi|229262336|gb|ACQ53369.1| 30S ribosomal protein S6 [Clostridium botulinum Ba4 str. 657]
          Length = 94

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 50/94 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE VF+L   +  +  K  + +++S+I+  GG V  V+  G R +AY ++K  + YY
Sbjct: 1  MRKYETVFILNPALDEEGYKANVEKFKSVIENAGGTVDNVDLWGKRKLAYEVKKVSEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            MN  +      E+ R  RI + V+R + +  +
Sbjct: 61 TLMNFTADTELPKELDRVFRITDTVIRHMIITQE 94


>gi|260881439|ref|ZP_05404415.2| ribosomal protein S6 [Mitsuokella multacida DSM 20544]
 gi|260848789|gb|EEX68796.1| ribosomal protein S6 [Mitsuokella multacida DSM 20544]
          Length = 95

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+++  +        I ++ +LIQ NGG +   +  G + +AY I+   + YY
Sbjct: 1  MRKYEVIFIVKP-MEEDATNAVIEKFSNLIQNNGGTIDKEDRWGKKRLAYEIKDCTEGYY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
             N+   PA + E  R M+I + +L+ + +  D 
Sbjct: 60 CLFNVTCEPACVAECDRVMKITDELLKHMIVKSDE 94


>gi|326799757|ref|YP_004317576.1| 30S ribosomal protein S6 [Sphingobacterium sp. 21]
 gi|326550521|gb|ADZ78906.1| 30S ribosomal protein S6 [Sphingobacterium sp. 21]
          Length = 122

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 60/119 (50%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V +L   +S +  K+ I ++++++ ENG E+   +  G++ +AY I K    +Y
Sbjct: 1   MQQYETVVILTPLLSEEVAKEVIAKFKNILTENGAEIIHEDNWGLKKLAYPIEKKTTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRD 119
                 +P   I +++ + + DE V+R LT+ +D H  +     +    + + +    +
Sbjct: 61  HLTEFKAPGELISKLELEYKRDERVMRFLTISLDKHAIAYNEKKRSGAFNKKPETKTEE 119


>gi|218900615|ref|YP_002449026.1| ribosomal protein S6 [Bacillus cereus G9842]
 gi|228905418|ref|ZP_04069373.1| 30S ribosomal protein S6 [Bacillus thuringiensis IBL 4222]
 gi|228911313|ref|ZP_04075117.1| 30S ribosomal protein S6 [Bacillus thuringiensis IBL 200]
 gi|228942623|ref|ZP_04105155.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar berliner
          ATCC 10792]
 gi|228968626|ref|ZP_04129609.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228975553|ref|ZP_04136105.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228982189|ref|ZP_04142478.1| 30S ribosomal protein S6 [Bacillus thuringiensis Bt407]
 gi|229035132|ref|ZP_04189078.1| 30S ribosomal protein S6 [Bacillus cereus AH1271]
 gi|229099901|ref|ZP_04230824.1| 30S ribosomal protein S6 [Bacillus cereus Rock3-29]
 gi|229106066|ref|ZP_04236681.1| 30S ribosomal protein S6 [Bacillus cereus Rock3-28]
 gi|226703418|sp|B7IS18|RS6_BACC2 RecName: Full=30S ribosomal protein S6
 gi|218541892|gb|ACK94286.1| ribosomal protein S6 [Bacillus cereus G9842]
 gi|228677352|gb|EEL31614.1| 30S ribosomal protein S6 [Bacillus cereus Rock3-28]
 gi|228683516|gb|EEL37471.1| 30S ribosomal protein S6 [Bacillus cereus Rock3-29]
 gi|228728198|gb|EEL79228.1| 30S ribosomal protein S6 [Bacillus cereus AH1271]
 gi|228777541|gb|EEM25819.1| 30S ribosomal protein S6 [Bacillus thuringiensis Bt407]
 gi|228784163|gb|EEM32190.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228791055|gb|EEM38673.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228817049|gb|EEM63142.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar berliner
          ATCC 10792]
 gi|228848331|gb|EEM93181.1| 30S ribosomal protein S6 [Bacillus thuringiensis IBL 200]
 gi|228854238|gb|EEM98941.1| 30S ribosomal protein S6 [Bacillus thuringiensis IBL 4222]
 gi|326943272|gb|AEA19168.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar
          chinensis CT-43]
          Length = 96

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 53/95 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R  +  +  K  + ++  ++  NG E+    E G R +AY I   R+ +Y
Sbjct: 1  MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ S   AI+E  R  +I+E++LR + +  + 
Sbjct: 61 MILNVNSNAEAINEFDRLAKINEDILRHIVVKEEE 95


>gi|47568673|ref|ZP_00239370.1| ribosomal protein S6 [Bacillus cereus G9241]
 gi|228988702|ref|ZP_04148787.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|47554661|gb|EAL13015.1| ribosomal protein S6 [Bacillus cereus G9241]
 gi|228771014|gb|EEM19495.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
          Length = 96

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 53/95 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R  +  +  K  + ++  ++  NG E+    E G R +AY I   R+ +Y
Sbjct: 1  MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ S   AI+E  R  +I+E++LR + +  + 
Sbjct: 61 MILNVNSNAEAINEFDRLAKINEDILRHIIVKEEE 95


>gi|329938666|ref|ZP_08288062.1| 30S ribosomal protein S6 [Streptomyces griseoaurantiacus M045]
 gi|329302157|gb|EGG46049.1| 30S ribosomal protein S6 [Streptomyces griseoaurantiacus M045]
          Length = 96

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S++++ GG+V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDVEERAVSPLIENFLSVVRDGGGKVEKVDTWGRRRLAYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + P  + E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPGVVKELDRQMNLNESVLRTKVLRPETH 96


>gi|208435141|ref|YP_002266807.1| ribosomal protein S6 [Helicobacter pylori G27]
 gi|226703475|sp|B5Z8P2|RS6_HELPG RecName: Full=30S ribosomal protein S6
 gi|208433070|gb|ACI27941.1| ribosomal protein S6 [Helicobacter pylori G27]
          Length = 142

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/134 (26%), Positives = 73/134 (54%), Gaps = 2/134 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYKEVITKHHGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKAEPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEK 132
           ++      H +EE 
Sbjct: 121 EKTEHAHSHHAEEA 134


>gi|229816200|ref|ZP_04446510.1| hypothetical protein COLINT_03247 [Collinsella intestinalis DSM
          13280]
 gi|229808208|gb|EEP44000.1| hypothetical protein COLINT_03247 [Collinsella intestinalis DSM
          13280]
          Length = 97

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 50/97 (51%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE +F +   +  +     + +  + I E  G+V  V+E G R +AY I K  +  Y
Sbjct: 1  MKAYELLFFVDPSLDPETRLAVMKRIDNTIAEGNGKVDNVDEWGKRKLAYEIDKLTEGDY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97
            +N  + PA+I E+ R +RI + V+R + +  D  E
Sbjct: 61 TLINFHADPASIAELDRVLRITDAVIRHMIVRRDDQE 97


>gi|304436797|ref|ZP_07396765.1| 30S ribosomal protein S6 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
 gi|304370277|gb|EFM23934.1| 30S ribosomal protein S6 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
          Length = 97

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 55/98 (56%), Gaps = 1/98 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+LYE +F+++  +        I ++  LIQ NGG++   +  G + +AY I+   + YY
Sbjct: 1  MRLYEVIFIVKP-MEEDVTNAVIEKFTKLIQANGGKIEKEDRWGKKRLAYEIKDMTEGYY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQ 98
          V + + + PA + E  R M+I +++L+ + +  D  E+
Sbjct: 60 VLLYVNAEPACVAECDRVMKITDDLLKHMIVRADGIEE 97


>gi|269216496|ref|ZP_06160350.1| ribosomal protein S6 [Slackia exigua ATCC 700122]
 gi|269130025|gb|EEZ61107.1| ribosomal protein S6 [Slackia exigua ATCC 700122]
          Length = 110

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 47/97 (48%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE +F +   I  +     + + ++ I +N G +  V + G R +AY I    +  Y
Sbjct: 14  MKAYELLFFVSPTIEDEVRLAAMKRVETAINDNNGTIDNVEDWGRRKLAYEIAGLTEGDY 73

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97
             ++  + P +I E+ R +RI + V+R   +  D  +
Sbjct: 74  TLIDFHADPESIAELDRILRITDAVVRHKIVRRDDRD 110


>gi|15828450|ref|NP_302713.1| 30S ribosomal protein S6 [Mycobacterium leprae TN]
 gi|221230927|ref|YP_002504343.1| 30S ribosomal protein S6 [Mycobacterium leprae Br4923]
 gi|1173272|sp|P46389|RS6_MYCLE RecName: Full=30S ribosomal protein S6
 gi|886305|gb|AAB53121.1| 30S ribosomal protein S6 [Mycobacterium leprae]
 gi|2959412|emb|CAA17954.1| 30s ribosomal protein s6 [Mycobacterium leprae]
 gi|13093880|emb|CAC32217.1| 30S ribosomal protein S6 [Mycobacterium leprae]
 gi|219934034|emb|CAR72785.1| 30S ribosomal protein S6 [Mycobacterium leprae Br4923]
          Length = 96

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +    +  ++  + ++++++GG +  V+  G R +AY I K+ +  Y
Sbjct: 1  MRPYEIMVILDPTLDECTVGPSLETFLNVVRKDGGAIDKVDIWGRRRLAYEISKHAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
          V +++ + PA + E+ R++ ++E+VLR+  +  D H
Sbjct: 61 VVIDLKAAPATVSELDRQLSLNESVLRTKVMRTDKH 96


>gi|312200939|ref|YP_004021000.1| ribosomal protein S6 [Frankia sp. EuI1c]
 gi|311232275|gb|ADP85130.1| ribosomal protein S6 [Frankia sp. EuI1c]
          Length = 113

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 57/97 (58%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE + +L  D+  + +  ++ Q+ S+++  GG V  V+  G R +AY IRK+ +  Y 
Sbjct: 7   RHYELMVILDPDLEERTVSPSLDQFLSVVRNGGGAVEKVDVWGRRRLAYEIRKSHEGIYA 66

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQ 98
            +++ + P  + E+ R++ ++E+V+R+  + +   ++
Sbjct: 67  VIDLHAEPDVVAELDRQLTLNESVIRTKVIRLPEAKK 103


>gi|260885357|ref|ZP_05734878.2| ribosomal protein S6 [Prevotella tannerae ATCC 51259]
 gi|260852777|gb|EEX72646.1| ribosomal protein S6 [Prevotella tannerae ATCC 51259]
          Length = 114

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 62/114 (54%), Gaps = 2/114 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S QQ+K+T+ +++ ++   G E+    E G++ +AY I+K    +Y
Sbjct: 2   MNQYETVFILTPVLSDQQMKETVEKFKDVLTAEGAEIINEEEWGLKHLAYPIQKKSTGFY 61

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
           V +   + P  I +++   R DE V+R LT  +D +        +R +R ++ +
Sbjct: 62  VLIEFKAEPTVIKKLEVAYRRDERVIRDLTTKLDKYAIQ--YAEKRRNRKNQKE 113


>gi|163943154|ref|YP_001648038.1| 30S ribosomal protein S6 [Bacillus weihenstephanensis KBAB4]
 gi|229026915|ref|ZP_04183238.1| 30S ribosomal protein S6 [Bacillus cereus AH1272]
 gi|229164425|ref|ZP_04292353.1| 30S ribosomal protein S6 [Bacillus cereus R309803]
 gi|226703421|sp|A9VTL0|RS6_BACWK RecName: Full=30S ribosomal protein S6
 gi|163865351|gb|ABY46410.1| ribosomal protein S6 [Bacillus weihenstephanensis KBAB4]
 gi|228619030|gb|EEK75928.1| 30S ribosomal protein S6 [Bacillus cereus R309803]
 gi|228734373|gb|EEL85044.1| 30S ribosomal protein S6 [Bacillus cereus AH1272]
          Length = 96

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 53/95 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R  +  +  K  + ++  ++  NG E+    E G R +AY I   R+ +Y
Sbjct: 1  MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ S   AI+E  R  +I+E++LR + +  + 
Sbjct: 61 MILNVNSNSEAINEFDRLAKINEDILRHIVVKEEE 95


>gi|237753479|ref|ZP_04583959.1| 30S ribosomal protein S6 [Helicobacter winghamensis ATCC BAA-430]
 gi|229375746|gb|EEO25837.1| 30S ribosomal protein S6 [Helicobacter winghamensis ATCC BAA-430]
          Length = 128

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/128 (26%), Positives = 66/128 (51%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+++  ++ ++I   I  Y++ I  NGGE+    ++GMR +AY I+KN++ YY
Sbjct: 1   MRFYETMFVVKPTLTQEEITQKIDFYKAAILNNGGEISATLDMGMRNLAYEIKKNKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             +   + P  + E++R  RI+E +LR + +  +S ++            +     P   
Sbjct: 61  FVIYFKAEPKLVLELERLYRINEEILRFIVIKYESKKEQKAWETLVDRAINNKKSTPLKE 120

Query: 121 NVDRKQHV 128
             D+ Q  
Sbjct: 121 VEDKPQDA 128


>gi|257470799|ref|ZP_05634889.1| SSU ribosomal protein S6P [Fusobacterium ulcerans ATCC 49185]
 gi|317065003|ref|ZP_07929488.1| SSU ribosomal protein S6P [Fusobacterium ulcerans ATCC 49185]
 gi|313690679|gb|EFS27514.1| SSU ribosomal protein S6P [Fusobacterium ulcerans ATCC 49185]
          Length = 94

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++++   I  +     + +   ++   G  V    + G R +AY I K +  +Y
Sbjct: 1  MKKYEIMYIINPTILEEGRDAVVEKVTGILTAAGATVAKSEKWGERKLAYPIDKKKTGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V          +  ++ K+ I E V+R + +  D
Sbjct: 61 VLATFDIDGTQLSAVEGKLNITEEVIRYIIVKQD 94


>gi|284047423|ref|YP_003397762.1| ribosomal protein S6 [Acidaminococcus fermentans DSM 20731]
 gi|283951644|gb|ADB46447.1| ribosomal protein S6 [Acidaminococcus fermentans DSM 20731]
          Length = 94

 Score = 98.8 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 47/92 (51%), Gaps = 1/92 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +++++  +        + ++  L+  NG  +   ++ G + +AY I+      Y
Sbjct: 1  MNNYEVMYIVKP-VEEDAFNAVVKKFDDLLVANGATIEKTDKWGKKRLAYAIQDFNDGLY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          V    A+ PAA+ E+ R M+I +++LR + + 
Sbjct: 60 VLTTFAAEPAAVKELDRVMKITDDILRHMIIR 91


>gi|325996521|gb|ADZ51926.1| 30S ribosomal protein S6 [Helicobacter pylori 2018]
 gi|325998109|gb|ADZ50317.1| 30S ribosomal protein S6 [Helicobacter pylori 2017]
          Length = 142

 Score = 98.8 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/134 (26%), Positives = 73/134 (54%), Gaps = 2/134 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  +  ++IK  I  Y+ +I ++ G +    ++GMR +AY I+K+++ YY
Sbjct: 1   MRHYETMFILKPTLVEEEIKSKIEFYREVITKHYGVIETSLDMGMRNLAYEIKKHKRGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL--TIQRHDRDDRNDRFPR 118
                 + P+ I E++R  RI+E+VLR + +  +S ++       + R ++   + +   
Sbjct: 61  YVAYFKADPSMILELERLYRINEDVLRFIVIKYESKKEVEAWHALVDRANKKPSHAKEKH 120

Query: 119 DRNVDRKQHVSEEK 132
           ++      H +EE 
Sbjct: 121 EKTEHAHSHHAEEA 134


>gi|307721626|ref|YP_003892766.1| 30S ribosomal protein S6P [Sulfurimonas autotrophica DSM 16294]
 gi|306979719|gb|ADN09754.1| SSU ribosomal protein S6P [Sulfurimonas autotrophica DSM 16294]
          Length = 153

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/102 (34%), Positives = 65/102 (63%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE++ +++   ++++I+ +I   + +I  NGGE+   N +GMR +AY I KN + YY
Sbjct: 1   MRHYENLVIVKPTFTAEEIQASIKAVEEVITSNGGEIAATNAMGMRKLAYPIDKNERGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
             +  +  PAAI E++R+ RI+E++LR +T+  DS+ +    
Sbjct: 61  YVIYYSVAPAAIAEIERRFRINEDLLRFVTIKYDSNREIKAW 102


>gi|15607195|ref|NP_214567.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis H37Rv]
 gi|15839430|ref|NP_334467.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis CDC1551]
 gi|31791230|ref|NP_853723.1| 30S ribosomal protein S6 [Mycobacterium bovis AF2122/97]
 gi|121635963|ref|YP_976186.1| 30S ribosomal protein S6 [Mycobacterium bovis BCG str. Pasteur
          1173P2]
 gi|148659813|ref|YP_001281336.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis H37Ra]
 gi|148821243|ref|YP_001285997.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis F11]
 gi|167970579|ref|ZP_02552856.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis H37Ra]
 gi|215406043|ref|ZP_03418224.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis 02_1987]
 gi|215413914|ref|ZP_03422576.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis 94_M4241A]
 gi|215425247|ref|ZP_03423166.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis T92]
 gi|215432962|ref|ZP_03430881.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis EAS054]
 gi|215448329|ref|ZP_03435081.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis T85]
 gi|218755776|ref|ZP_03534572.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis GM 1503]
 gi|219555832|ref|ZP_03534908.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis T17]
 gi|224988436|ref|YP_002643103.1| 30S ribosomal protein S6 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253796968|ref|YP_003029969.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis KZN
          1435]
 gi|254366511|ref|ZP_04982555.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis str.
          Haarlem]
 gi|254548985|ref|ZP_05139432.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis '98-R604
          INH-RIF-EM']
 gi|260184909|ref|ZP_05762383.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis CPHL_A]
 gi|260199046|ref|ZP_05766537.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis T46]
 gi|260203194|ref|ZP_05770685.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis K85]
 gi|289441420|ref|ZP_06431164.1| SSU ribosomal protein S6 [Mycobacterium tuberculosis T46]
 gi|289445579|ref|ZP_06435323.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis CPHL_A]
 gi|289552302|ref|ZP_06441512.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis KZN
          605]
 gi|289567939|ref|ZP_06448166.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis T17]
 gi|289572629|ref|ZP_06452856.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis K85]
 gi|289747822|ref|ZP_06507200.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          02_1987]
 gi|289748518|ref|ZP_06507896.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis T92]
 gi|289756112|ref|ZP_06515490.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis EAS054]
 gi|289760151|ref|ZP_06519529.1| ribosomal protein S6 [Mycobacterium tuberculosis T85]
 gi|289764167|ref|ZP_06523545.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis GM
          1503]
 gi|294995669|ref|ZP_06801360.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis 210]
 gi|297632524|ref|ZP_06950304.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis KZN 4207]
 gi|297729495|ref|ZP_06958613.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis KZN R506]
 gi|298527451|ref|ZP_07014860.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis 94_M4241A]
 gi|306778344|ref|ZP_07416681.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu001]
 gi|306778875|ref|ZP_07417212.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu002]
 gi|306782664|ref|ZP_07420986.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu003]
 gi|306787030|ref|ZP_07425352.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu004]
 gi|306791588|ref|ZP_07429890.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu005]
 gi|306795651|ref|ZP_07433953.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu006]
 gi|306801626|ref|ZP_07438294.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu008]
 gi|306805835|ref|ZP_07442503.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu007]
 gi|306970232|ref|ZP_07482893.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu009]
 gi|306974465|ref|ZP_07487126.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu010]
 gi|307082173|ref|ZP_07491343.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu011]
 gi|307082513|ref|ZP_07491626.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu012]
 gi|313656824|ref|ZP_07813704.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis KZN V2475]
 gi|54039531|sp|P66592|RS6_MYCBO RecName: Full=30S ribosomal protein S6
 gi|54041974|sp|P66591|RS6_MYCTU RecName: Full=30S ribosomal protein S6
 gi|166227352|sp|A1KEM1|RS6_MYCBP RecName: Full=30S ribosomal protein S6
 gi|166227353|sp|A5TYC4|RS6_MYCTA RecName: Full=30S ribosomal protein S6
 gi|254765446|sp|C1AJ76|RS6_MYCBT RecName: Full=30S ribosomal protein S6
 gi|1568592|emb|CAB02531.1| PROBABLE 30S RIBOSOMAL PROTEIN S6 RPSF [Mycobacterium
          tuberculosis H37Rv]
 gi|13879102|gb|AAK44281.1| ribosomal protein S6 [Mycobacterium tuberculosis CDC1551]
 gi|31616815|emb|CAD92916.1| PROBABLE 30S RIBOSOMAL PROTEIN S6 RPSF [Mycobacterium bovis
          AF2122/97]
 gi|121491610|emb|CAL70068.1| Probable 30s ribosomal protein s6 rpsF [Mycobacterium bovis BCG
          str. Pasteur 1173P2]
 gi|134152023|gb|EBA44068.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis str.
          Haarlem]
 gi|148503965|gb|ABQ71774.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis H37Ra]
 gi|148719770|gb|ABR04395.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis F11]
 gi|224771549|dbj|BAH24355.1| 30S ribosomal protein S6 [Mycobacterium bovis BCG str. Tokyo 172]
 gi|253318471|gb|ACT23074.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis KZN
          1435]
 gi|289414339|gb|EFD11579.1| SSU ribosomal protein S6 [Mycobacterium tuberculosis T46]
 gi|289418537|gb|EFD15738.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis CPHL_A]
 gi|289436934|gb|EFD19427.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis KZN
          605]
 gi|289537060|gb|EFD41638.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis K85]
 gi|289541692|gb|EFD45341.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis T17]
 gi|289688350|gb|EFD55838.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          02_1987]
 gi|289689105|gb|EFD56534.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis T92]
 gi|289696699|gb|EFD64128.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis EAS054]
 gi|289711673|gb|EFD75689.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis GM
          1503]
 gi|289715715|gb|EFD79727.1| ribosomal protein S6 [Mycobacterium tuberculosis T85]
 gi|298497245|gb|EFI32539.1| 30S ribosomal protein S6 [Mycobacterium tuberculosis 94_M4241A]
 gi|308213487|gb|EFO72886.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu001]
 gi|308328204|gb|EFP17055.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu002]
 gi|308332510|gb|EFP21361.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu003]
 gi|308336322|gb|EFP25173.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu004]
 gi|308339925|gb|EFP28776.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu005]
 gi|308343941|gb|EFP32792.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu006]
 gi|308347724|gb|EFP36575.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu007]
 gi|308351641|gb|EFP40492.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu008]
 gi|308352348|gb|EFP41199.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu009]
 gi|308356248|gb|EFP45099.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu010]
 gi|308360239|gb|EFP49090.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu011]
 gi|308367740|gb|EFP56591.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          SUMu012]
 gi|323717392|gb|EGB26597.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis
          CDC1551A]
 gi|326905813|gb|EGE52746.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis W-148]
 gi|328456758|gb|AEB02181.1| 30S ribosomal protein S6 rpsF [Mycobacterium tuberculosis KZN
          4207]
          Length = 96

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 59/96 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++++++GG+V  V+  G R +AY I K+ +  Y
Sbjct: 1  MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGKVEKVDIWGKRRLAYEIAKHAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
          V +++ + PA + E+ R++ ++E+VLR+  +  D H
Sbjct: 61 VVIDVKAAPATVSELDRQLSLNESVLRTKVMRTDKH 96


>gi|187934196|ref|YP_001887721.1| 30S ribosomal protein S6 [Clostridium botulinum B str. Eklund
          17B]
 gi|188589519|ref|YP_001922704.1| 30S ribosomal protein S6 [Clostridium botulinum E3 str. Alaska
          E43]
 gi|251780573|ref|ZP_04823493.1| 30S ribosomal protein S6 [Clostridium botulinum E1 str. 'BoNT E
          Beluga']
 gi|187722349|gb|ACD23570.1| 30S ribosomal protein S6 [Clostridium botulinum B str. Eklund
          17B]
 gi|188499800|gb|ACD52936.1| 30S ribosomal protein S6 [Clostridium botulinum E3 str. Alaska
          E43]
 gi|243084888|gb|EES50778.1| 30S ribosomal protein S6 [Clostridium botulinum E1 str. 'BoNT E
          Beluga']
          Length = 96

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 47/94 (50%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+       + +K  I +++ +I+  GG +  V+  G R +AY I K    YY
Sbjct: 2  MRKYETIFIQHPSFDEETVKTNIEKFKGVIENGGGTIENVDFWGKRKLAYEISKVSDGYY 61

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            ++  + P    E+ R  RI + ++R + +  +
Sbjct: 62 TLVSFNAGPELPKELDRVFRITDGIIRHIIVKEE 95


>gi|331268204|ref|YP_004394696.1| 30S ribosomal protein S6 [Clostridium botulinum BKT015925]
 gi|329124754|gb|AEB74699.1| ribosomal protein S6 [Clostridium botulinum BKT015925]
          Length = 95

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 54/95 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +F+L+  +  + IK TI +++ +I+  GG V  V+E G R +AY I K  + YY
Sbjct: 1  MRNYETLFILQTSLEEEAIKATIEKFKGVIENEGGVVENVDEWGKRKLAYPINKVSEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N  + P    E++R  RI + V+R + +  + 
Sbjct: 61 TLINFKANPELPRELERVFRITDGVMRFMVVNPEK 95


>gi|196249875|ref|ZP_03148571.1| ribosomal protein S6 [Geobacillus sp. G11MC16]
 gi|196210751|gb|EDY05514.1| ribosomal protein S6 [Geobacillus sp. G11MC16]
          Length = 95

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 56/95 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R ++  +  +  + ++ ++++E G E+  V + G R +AY I K R  YY
Sbjct: 1  MRKYEIMYIIRPNMDDEARQAVVERFNNVLKEKGAEITNVTDWGKRRLAYEIEKYRDGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ + P A+ E  R  RI E+++R + +  + 
Sbjct: 61 MILNVMAEPQAVQEFDRLARISEDIIRHIVVKEEK 95


>gi|117929340|ref|YP_873891.1| SSU ribosomal protein S6P [Acidothermus cellulolyticus 11B]
 gi|166226791|sp|A0LWU5|RS6_ACIC1 RecName: Full=30S ribosomal protein S6
 gi|117649803|gb|ABK53905.1| SSU ribosomal protein S6P [Acidothermus cellulolyticus 11B]
          Length = 96

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 59/94 (62%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + LL  D+  + ++ ++ Q+ ++++++GG V+ ++  G R +AY IRK  +  Y
Sbjct: 1  MRHYELMVLLDPDVEERSVEPSLDQFLNVVRQDGGTVQKIDVWGRRRLAYEIRKKSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +++ + P  + E+ R++ ++ENVLR+  +  D
Sbjct: 61 AVIDLIANPQTVKELDRQLNLNENVLRTKLVRPD 94


>gi|325105011|ref|YP_004274665.1| SSU ribosomal protein S6P [Pedobacter saltans DSM 12145]
 gi|324973859|gb|ADY52843.1| SSU ribosomal protein S6P [Pedobacter saltans DSM 12145]
          Length = 121

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 52/121 (42%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE   +L   +S +  K+ I  +  ++ +NG E+   +  G++ +AY I K    YY
Sbjct: 1   MGQYETTIILTPLLSEEAAKEVIANFSKILTDNGAEIVQEDNWGLKKLAYPIEKKSTGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
                      I + + +++ DE V+R LT+ +D H  +     +    + +        
Sbjct: 61  HITEYKVSGEVIGKYELELKRDERVMRFLTVKLDKHAVAYNEKKRSGAFNKKKSEKAEAA 120

Query: 121 N 121
           N
Sbjct: 121 N 121


>gi|319651083|ref|ZP_08005217.1| ribosomal protein S6 [Bacillus sp. 2_A_57_CT2]
 gi|317397253|gb|EFV77957.1| ribosomal protein S6 [Bacillus sp. 2_A_57_CT2]
          Length = 95

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 52/95 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R +I  +  K  + ++ +++ +NG EV    + G R +AY I   R  YY
Sbjct: 1  MRKYEVMYIIRPNIEDEAKKALVERFNTILTDNGAEVSESKDWGKRRLAYEINDFRDGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            MN+ +   A+ E  R  +I E+++R + +  + 
Sbjct: 61 QLMNVNAEAKAVDEFTRLAKISEDIIRYIVVKDEK 95


>gi|304383091|ref|ZP_07365566.1| 30S ribosomal protein S6 [Prevotella marshii DSM 16973]
 gi|304335777|gb|EFM02032.1| 30S ribosomal protein S6 [Prevotella marshii DSM 16973]
          Length = 115

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 60/114 (52%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ ++++L+ E G E+      G++ +AY I+K    +Y
Sbjct: 1   MNQYETVFILTPVLSDEQMKETVAKFRNLLVEKGAEIVNEETWGLKKMAYAIQKKSTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRND 114
             +   + P  I+ ++ + R +E V+R +T+ +D +        +    +   +
Sbjct: 61  CLLEFKAEPEVINTLETQFRREEKVIRFMTVKLDKYAIQYAEKRKNKWTEKLKE 114


>gi|307151356|ref|YP_003886740.1| 30S ribosomal protein S6 [Cyanothece sp. PCC 7822]
 gi|306981584|gb|ADN13465.1| ribosomal protein S6 [Cyanothece sp. PCC 7822]
          Length = 143

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/139 (23%), Positives = 66/139 (47%), Gaps = 11/139 (7%)

Query: 4   YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
           YE ++++R D+  +Q++  I +Y+  + E+  E   +  LG R +AY I+K    +YV M
Sbjct: 5   YEMMYIMRPDLLDEQVQQQINKYRDFLSEHKAEEIQIKNLGKRRLAYPIKKYTDGFYVQM 64

Query: 64  NIASPPAAIHEMKRKMRIDENVLRSLTLLV-----------DSHEQSPTLTIQRHDRDDR 112
           N       +  ++R MR+ + V+R LT+ +           D+ E + +  +        
Sbjct: 65  NYKGDGKQVAPIERAMRLSDEVIRYLTIKLRDEQVAAIAPTDAIEPAESPKLVETKPMAP 124

Query: 113 NDRFPRDRNVDRKQHVSEE 131
           + + P +   +  +  +EE
Sbjct: 125 SPKPPVEEIPEADEISAEE 143


>gi|194098900|ref|YP_002001965.1| 30S ribosomal protein S6 [Neisseria gonorrhoeae NCCP11945]
 gi|193934190|gb|ACF30014.1| ribosomal protein S6 [Neisseria gonorrhoeae NCCP11945]
          Length = 102

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 46/90 (51%)

Query: 22  TIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRI 81
            + +Y+++I E  G++  + + G R +AY I K  KA+YV MNI + P  + E++   R 
Sbjct: 1   MVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIETTPEVVGELETAFRF 60

Query: 82  DENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           ++ VLR LT+         +  +      +
Sbjct: 61  NDAVLRHLTIKTKHAVTEASPMLGGEKAKN 90


>gi|262204544|ref|YP_003275752.1| 30S ribosomal protein S6 [Gordonia bronchialis DSM 43247]
 gi|262087891|gb|ACY23859.1| ribosomal protein S6 [Gordonia bronchialis DSM 43247]
          Length = 93

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 56/92 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  ++  + +  ++  + ++++ +GG+V  V+  G R +AY I K+ +  Y
Sbjct: 1  MRHYELMVILDPNLDERTVAPSLDTFLNVVRNDGGKVDGVDIWGKRRLAYEIAKHSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
            +++ + P  + E+ R+++++E+VLR+  L 
Sbjct: 61 AVIDLNAEPKTVTELDRQLKLNESVLRTKVLR 92


>gi|139439451|ref|ZP_01772892.1| Hypothetical protein COLAER_01912 [Collinsella aerofaciens ATCC
          25986]
 gi|133775230|gb|EBA39050.1| Hypothetical protein COLAER_01912 [Collinsella aerofaciens ATCC
          25986]
          Length = 97

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/97 (28%), Positives = 46/97 (47%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE +F +   +  +     + +  + I E  G+V  V+E G R +AY I       Y
Sbjct: 1  MKAYELLFFVDPSLDPETRLAVMKRIDTTIAEGAGKVDSVDEWGKRKLAYEINDLTDGDY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97
            +N  + P  I E+ R +RI + V+R + +  D  E
Sbjct: 61 TLINFHADPTQIAELDRVLRITDAVVRHMIVRRDDQE 97


>gi|317130991|ref|YP_004097273.1| ribosomal protein S6 [Bacillus cellulosilyticus DSM 2522]
 gi|315475939|gb|ADU32542.1| ribosomal protein S6 [Bacillus cellulosilyticus DSM 2522]
          Length = 96

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 57/95 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R ++     K+ + ++  ++ +NG EV  V E G R +AY I   ++ +Y
Sbjct: 1  MRKYEIMYIVRPNLEEAATKEVVERFNKVLTDNGAEVENVEEKGKRRLAYEINDFKEGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V +N+ +P  AI E  R ++I++NVLR L +  + 
Sbjct: 61 VLLNVNAPTVAIDEFNRLIKINDNVLRHLVVREEE 95


>gi|30023498|ref|NP_835129.1| 30S ribosomal protein S6 [Bacillus cereus ATCC 14579]
 gi|42784670|ref|NP_981917.1| 30S ribosomal protein S6 [Bacillus cereus ATCC 10987]
 gi|206970119|ref|ZP_03231072.1| 30S ribosomal protein S6 [Bacillus cereus AH1134]
 gi|218233563|ref|YP_002370249.1| 30S ribosomal protein S6 [Bacillus cereus B4264]
 gi|228955725|ref|ZP_04117720.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar kurstaki
          str. T03a001]
 gi|229072939|ref|ZP_04206135.1| 30S ribosomal protein S6 [Bacillus cereus F65185]
 gi|229082683|ref|ZP_04215137.1| 30S ribosomal protein S6 [Bacillus cereus Rock4-2]
 gi|229112887|ref|ZP_04242418.1| 30S ribosomal protein S6 [Bacillus cereus Rock1-15]
 gi|229130720|ref|ZP_04259673.1| 30S ribosomal protein S6 [Bacillus cereus BDRD-Cer4]
 gi|229148024|ref|ZP_04276363.1| 30S ribosomal protein S6 [Bacillus cereus BDRD-ST24]
 gi|229153633|ref|ZP_04281809.1| 30S ribosomal protein S6 [Bacillus cereus m1550]
 gi|229181720|ref|ZP_04309043.1| 30S ribosomal protein S6 [Bacillus cereus 172560W]
 gi|229193725|ref|ZP_04320666.1| 30S ribosomal protein S6 [Bacillus cereus ATCC 10876]
 gi|296505902|ref|YP_003667602.1| 30S ribosomal protein S6 [Bacillus thuringiensis BMB171]
 gi|61215625|sp|Q72WV3|RS6_BACC1 RecName: Full=30S ribosomal protein S6
 gi|61215739|sp|Q814G5|RS6_BACCR RecName: Full=30S ribosomal protein S6
 gi|226703419|sp|B7HGD4|RS6_BACC4 RecName: Full=30S ribosomal protein S6
 gi|29899059|gb|AAP12330.1| SSU ribosomal protein S6P [Bacillus cereus ATCC 14579]
 gi|42740602|gb|AAS44525.1| ribosomal protein S6 [Bacillus cereus ATCC 10987]
 gi|206734696|gb|EDZ51865.1| 30S ribosomal protein S6 [Bacillus cereus AH1134]
 gi|218161520|gb|ACK61512.1| ribosomal protein S6 [Bacillus cereus B4264]
 gi|228589750|gb|EEK47628.1| 30S ribosomal protein S6 [Bacillus cereus ATCC 10876]
 gi|228601753|gb|EEK59251.1| 30S ribosomal protein S6 [Bacillus cereus 172560W]
 gi|228629819|gb|EEK86472.1| 30S ribosomal protein S6 [Bacillus cereus m1550]
 gi|228635449|gb|EEK91940.1| 30S ribosomal protein S6 [Bacillus cereus BDRD-ST24]
 gi|228652737|gb|EEL08622.1| 30S ribosomal protein S6 [Bacillus cereus BDRD-Cer4]
 gi|228670566|gb|EEL25879.1| 30S ribosomal protein S6 [Bacillus cereus Rock1-15]
 gi|228700628|gb|EEL53160.1| 30S ribosomal protein S6 [Bacillus cereus Rock4-2]
 gi|228710185|gb|EEL62163.1| 30S ribosomal protein S6 [Bacillus cereus F65185]
 gi|228803953|gb|EEM50577.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar kurstaki
          str. T03a001]
 gi|296326954|gb|ADH09882.1| 30S ribosomal protein S6 [Bacillus thuringiensis BMB171]
 gi|324329425|gb|ADY24685.1| 30S ribosomal protein S6 [Bacillus thuringiensis serovar
          finitimus YBT-020]
          Length = 96

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 53/95 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R  +  +  K  + ++  ++  NG E+    E G R +AY I   R+ +Y
Sbjct: 1  MRKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ S   AI+E  R  +I+E++LR + +  + 
Sbjct: 61 MILNVKSNAEAINEFDRLAKINEDILRHIVVKEEE 95


>gi|145221468|ref|YP_001132146.1| 30S ribosomal protein S6 [Mycobacterium gilvum PYR-GCK]
 gi|315446780|ref|YP_004079659.1| 30S ribosomal protein S6P [Mycobacterium sp. Spyr1]
 gi|145213954|gb|ABP43358.1| SSU ribosomal protein S6P [Mycobacterium gilvum PYR-GCK]
 gi|315265083|gb|ADU01825.1| SSU ribosomal protein S6P [Mycobacterium sp. Spyr1]
          Length = 96

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++I+++GG V  V+  G R +AY I K+ +  Y
Sbjct: 1  MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGSVDKVDIWGRRRLAYEIAKHAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R++ ++E+VLR+  +  + H
Sbjct: 61 AIIDVKAEPATVSELDRQLNLNESVLRTKVMRTEKH 96


>gi|254303427|ref|ZP_04970785.1| ribosomal protein S6 [Fusobacterium nucleatum subsp. polymorphum
          ATCC 10953]
 gi|148323619|gb|EDK88869.1| ribosomal protein S6 [Fusobacterium nucleatum subsp. polymorphum
          ATCC 10953]
          Length = 94

 Score = 98.0 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 47/94 (50%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++   +  +  ++ I Q  +L+  NG  +    + G R +AY I K +  +Y
Sbjct: 1  MRKYEIMYIINPTVLEEGREELINQVNALLTSNGATIAKTEKWGERKLAYPIDKKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V          + E++ K+ I E+V+R + +  D
Sbjct: 61 VLTTFEIDGTKLAEVESKLNIMESVMRYIVVKQD 94


>gi|153956492|ref|YP_001397257.1| 30S ribosomal protein S6 [Clostridium kluyveri DSM 555]
 gi|219856795|ref|YP_002473917.1| hypothetical protein CKR_3452 [Clostridium kluyveri NBRC 12016]
 gi|189045461|sp|A5N440|RS6_CLOK5 RecName: Full=30S ribosomal protein S6
 gi|254765231|sp|B9DXR0|RS6_CLOK1 RecName: Full=30S ribosomal protein S6
 gi|146349350|gb|EDK35886.1| RpsF [Clostridium kluyveri DSM 555]
 gi|219570519|dbj|BAH08503.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 95

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 48/95 (50%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +F+L   +  +  K  + +++ +I+  GG +  V+  G R +AY I+K  + YY
Sbjct: 1  MGKYETIFILHPSLDEEGYKANVEKFKGVIENGGGVIENVDIWGKRKLAYEIKKVNEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +   + P    E+ R  RI + V+R + +  + 
Sbjct: 61 TLITFNADPTLPKELDRVFRITDTVVRHIIVKDEK 95


>gi|145597065|ref|YP_001161362.1| 30S ribosomal protein S6 [Salinispora tropica CNB-440]
 gi|189045493|sp|A4XDG8|RS6_SALTO RecName: Full=30S ribosomal protein S6
 gi|145306402|gb|ABP56984.1| SSU ribosomal protein S6P [Salinispora tropica CNB-440]
          Length = 96

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 54/94 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  Y ++I+  GG V   +  G R +AY I K  +  Y
Sbjct: 1  MRHYEIMVILDSSLEERTVAPSLDTYLNVIRTAGGSVEKTDVWGRRRLAYEIDKKTEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +++ + PAA+ E+ R++R++E+VLR+  +  +
Sbjct: 61 AVIDLQATPAAVAELDRQLRLNESVLRTKVIRPE 94


>gi|75908293|ref|YP_322589.1| 30S ribosomal protein S6 [Anabaena variabilis ATCC 29413]
 gi|91207901|sp|Q3MBE2|RS6_ANAVT RecName: Full=30S ribosomal protein S6
 gi|75702018|gb|ABA21694.1| SSU ribosomal protein S6P [Anabaena variabilis ATCC 29413]
          Length = 108

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/101 (34%), Positives = 58/101 (57%)

Query: 4   YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
           YE +++LR D++ +Q++  I +YQ+L+QE G     V   G R +AY I+K R  +YV  
Sbjct: 5   YETLYILRPDLTDEQVELAIAKYQNLLQEQGATDIEVQNRGKRRLAYEIKKQRDGFYVQF 64

Query: 64  NIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
           N  +P  AI  ++R MR+ E V+R LT+  +  ++      
Sbjct: 65  NYNAPGKAIAILERAMRLSEEVIRYLTVKQEVTKEKEDKVA 105


>gi|16330273|ref|NP_441001.1| 30S ribosomal protein S6 [Synechocystis sp. PCC 6803]
 gi|2500413|sp|P73636|RS6_SYNY3 RecName: Full=30S ribosomal protein S6
 gi|1652762|dbj|BAA17681.1| 30S ribosomal protein S6 [Synechocystis sp. PCC 6803]
          Length = 113

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 49/92 (53%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
            YE + +LR D++ +++   + +YQ  +  N  E   V   G R +AY+IR+     YV
Sbjct: 4  NSYELMVILRPDLNEERVSQEVTKYQEFLTNNAAEEVSVKVWGKRRLAYQIRRFNDGIYV 63

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLV 93
            N       I  ++R MR+++NV+R L++ +
Sbjct: 64 LFNFNGEGQQIALIERDMRLNDNVMRFLSIKL 95


>gi|118615983|ref|YP_904315.1| 30S ribosomal protein S6 [Mycobacterium ulcerans Agy99]
 gi|183980107|ref|YP_001848398.1| 30S ribosomal protein S6 RpsF [Mycobacterium marinum M]
 gi|118568093|gb|ABL02844.1| 30S ribosomal protein S6 RpsF [Mycobacterium ulcerans Agy99]
 gi|183173433|gb|ACC38543.1| 30S ribosomal protein S6 RpsF [Mycobacterium marinum M]
          Length = 96

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 56/95 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++I+++GG V  V+  G R +AY I K+ +  Y
Sbjct: 1  MRPYEIMVILDPTLDERTVAPSLETFLNVIRKDGGTVDKVDIWGRRRLAYEIAKHAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +++ + PA + E+ R++ ++E+VLR+  +  D 
Sbjct: 61 AVIDVKAAPATVSELDRQLSLNESVLRTKVMRADK 95


>gi|114568045|ref|YP_755199.1| 30S ribosomal protein S6 [Syntrophomonas wolfei subsp. wolfei
          str. Goettingen]
 gi|122317111|sp|Q0ATX6|RS6_SYNWW RecName: Full=30S ribosomal protein S6
 gi|114338980|gb|ABI69828.1| SSU ribosomal protein S6P [Syntrophomonas wolfei subsp. wolfei
          str. Goettingen]
          Length = 97

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 48/96 (50%), Gaps = 1/96 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNE-LGMRTIAYRIRKNRKAY 59
          M+ YE +F+LR D+  +Q+ +T  + Q +I + GGE     +  G + +AY I    +  
Sbjct: 1  MRTYEMMFVLRPDLEEEQVLETKERLQKIIADFGGEFINAADGWGKKRLAYAIDDYVEGI 60

Query: 60 YVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          Y        P  + E+ R ++I EN LR + +  D 
Sbjct: 61 YSLWYFKGKPETVDELDRIIKISENFLRHIIIRQDE 96


>gi|159040549|ref|YP_001539802.1| 30S ribosomal protein S6 [Salinispora arenicola CNS-205]
 gi|189045490|sp|A8LXG3|RS6_SALAI RecName: Full=30S ribosomal protein S6
 gi|157919384|gb|ABW00812.1| ribosomal protein S6 [Salinispora arenicola CNS-205]
          Length = 96

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 55/94 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  Y ++I+  GG V   +  G R +AY I K  +  Y
Sbjct: 1  MRHYEIMVILDSSLEERTVAPSLDTYLNVIRTAGGSVEKTDVWGRRRLAYEIDKKTEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +++ + PAA+ E++R++R++E+VLR+  +  +
Sbjct: 61 AVIDLQATPAAVAELERQLRLNESVLRTKVIRPE 94


>gi|322433962|ref|YP_004216174.1| ribosomal protein S6 [Acidobacterium sp. MP5ACTX9]
 gi|321161689|gb|ADW67394.1| ribosomal protein S6 [Acidobacterium sp. MP5ACTX9]
          Length = 162

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 62/116 (53%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE +F++R D+    +   +  +Q  I +  GEV+ + ++G R +AY +RK    +YV
Sbjct: 3   RTYEIMFIVRPDVEEADLDKLVEGFQKNITDGNGEVKSIEKMGRRRLAYTVRKFNDGFYV 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFP 117
            MNIA+    I E++R++R+ E V++ +T+ +D  E+         D   +    P
Sbjct: 63  LMNIAAEGQLITEIERRLRVSEPVIKFITVRMDEEEKRLAKIKAHRDTHVKRSAIP 118


>gi|253581413|ref|ZP_04858639.1| SSU ribosomal protein S6P [Fusobacterium varium ATCC 27725]
 gi|251836777|gb|EES65311.1| SSU ribosomal protein S6P [Fusobacterium varium ATCC 27725]
          Length = 94

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 41/94 (43%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++++   I  +     + +   ++   G  V    + G R +AY I K +  +Y
Sbjct: 1  MKKYEIMYIINPTILEEGRDAVVEKVTGILTAAGATVAKSEKWGERKLAYPIDKKKTGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V          +  ++ K+ I E V+R + +  D
Sbjct: 61 VLATFDIDGTQLSAVEGKLNITEEVMRYIIVKQD 94


>gi|51894455|ref|YP_077146.1| 30S ribosomal protein S6 [Symbiobacterium thermophilum IAM 14863]
 gi|61216175|sp|Q67J48|RS6_SYMTH RecName: Full=30S ribosomal protein S6
 gi|51858144|dbj|BAD42302.1| 30S ribosomal protein S6 [Symbiobacterium thermophilum IAM 14863]
          Length = 95

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 44/92 (47%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + + R D+    ++    +   LI  NGG V   +    + +AY I+  R+ +Y
Sbjct: 1  MRKYEMMVIARPDLDEAGLQALSDKIAELITSNGGTVESQDAWKKQRLAYEIKHLREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
             N    P   +E+ R ++I + V+R L + 
Sbjct: 61 SVFNFTGEPRTANELNRVLKITDEVVRFLIVR 92


>gi|24212294|sp|Q8RIE3|RS6_FUSNN RecName: Full=30S ribosomal protein S6
          Length = 94

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 47/94 (50%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++   +  +  ++ + Q  +L+  NG  +    + G R +AY I K +  +Y
Sbjct: 1  MRKYEIMYIINPTVLEEGREELVNQVNALLTSNGATIAKTEKWGERKLAYPIDKKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V          + E++ K+ I E+V+R + +  D
Sbjct: 61 VLTTFEIDGTKLAEVESKLNIMESVMRYIVVKQD 94


>gi|17232294|ref|NP_488842.1| 30S ribosomal protein S6 [Nostoc sp. PCC 7120]
 gi|24212311|sp|Q8YMX2|RS6_ANASP RecName: Full=30S ribosomal protein S6
 gi|17133939|dbj|BAB76501.1| 30S ribosomal protein S6 [Nostoc sp. PCC 7120]
          Length = 108

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 35/101 (34%), Positives = 58/101 (57%)

Query: 4   YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
           YE +++LR D++ +Q++  I +YQ+L+QE G     V   G R +AY I+K R  +YV  
Sbjct: 5   YETLYILRPDLTDEQVELAIAKYQNLLQEQGATDLEVQNRGKRRLAYEIKKQRDGFYVQF 64

Query: 64  NIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTI 104
           N  +P  AI  ++R MR+ E V+R LT+  +  ++      
Sbjct: 65  NYNAPGKAIAILERAMRLSEEVIRYLTVKQEVTKEKEDKVA 105


>gi|225432037|ref|XP_002273724.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|296083213|emb|CBI22849.3| unnamed protein product [Vitis vinifera]
          Length = 301

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 55/102 (53%), Gaps = 1/102 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V+L+  +   +++++   + Q  I+E  G++  +N+ G+R +AY+I+K + A+Y
Sbjct: 127 MRHYEVVYLIH-EKHDEEVENVNSKVQDFIREKKGKLWRLNDWGLRRLAYKIQKAKNAHY 185

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
           + MN       I++ K  +  DE V+R L +  D        
Sbjct: 186 ILMNFELEAQWINDFKTMLDQDERVIRHLVIKRDEAITEDCP 227


>gi|304405907|ref|ZP_07387565.1| ribosomal protein S6 [Paenibacillus curdlanolyticus YK9]
 gi|304345150|gb|EFM10986.1| ribosomal protein S6 [Paenibacillus curdlanolyticus YK9]
          Length = 95

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 53/92 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++LR D+  + ++  + ++  +I   GGEV   + +G R +AY I K R   Y
Sbjct: 1  MRKYEVMYILRSDVEQEAVQAIVEKFNGIITNGGGEVSKTDIIGKRRLAYEINKQRDGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          V ++ ++P   I E+ R M+I + V R+L + 
Sbjct: 61 VLVHFSAPAEVIVELDRVMKIADEVFRTLIVK 92


>gi|154148390|ref|YP_001405847.1| 30S ribosomal protein S6 [Campylobacter hominis ATCC BAA-381]
 gi|166226816|sp|A7I006|RS6_CAMHC RecName: Full=30S ribosomal protein S6
 gi|153804399|gb|ABS51406.1| ribosomal protein S6 [Campylobacter hominis ATCC BAA-381]
          Length = 145

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 65/125 (52%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE +F+++  +   ++K  +   + +I +NGGE+  V E+G R +AY+I K  +  Y
Sbjct: 1   MKHYEVLFIVKPTLQDDEVKTKVDFVKEVITKNGGEIAAVVEMGTRKLAYKIDKYERGVY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             +   +P   I E+ R +RI+E+++R LT+  ++ ++        H      +    +R
Sbjct: 61  FVIYFTAPTKLIAELVRNLRINEDIIRFLTIKYENKKEISAWEKLSHGVKLSENMKKNER 120

Query: 121 NVDRK 125
              ++
Sbjct: 121 KAPKE 125


>gi|296271510|ref|YP_003654142.1| 30S ribosomal protein S6 [Thermobispora bispora DSM 43833]
 gi|296094297|gb|ADG90249.1| ribosomal protein S6 [Thermobispora bispora DSM 43833]
          Length = 96

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 55/96 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + ++ ++ Q+ S+++ +GG V  V+  G R +AY I K  +  Y
Sbjct: 1  MRRYEMMVILDPSLDERTVEPSLDQFLSIVRNDGGTVEKVDVWGRRKLAYDIAKRSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++   P  + E+ R++ ++ENVLR+  +  D H
Sbjct: 61 AVIDLTCKPETVRELDRQLNLNENVLRTKVIRPDLH 96


>gi|222617304|gb|EEE53436.1| hypothetical protein OsJ_36520 [Oryza sativa Japonica Group]
          Length = 257

 Score = 98.0 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 53/100 (53%), Gaps = 1/100 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V+L+ +D   + ++D + + Q  ++E  G +  +N  G+R +AY+I+K R A Y
Sbjct: 129 MRHYEVVYLIHEDRVEE-VEDVVSKVQDFVREKKGRIWRLNNWGLRRLAYKIKKARHANY 187

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
           + MN       I++ K  +  DE ++R L +  D      
Sbjct: 188 ILMNFEIQAKYINDFKTLLDKDERIIRHLVMKRDEAITED 227


>gi|78777857|ref|YP_394172.1| 30S ribosomal protein S6 [Sulfurimonas denitrificans DSM 1251]
 gi|91207800|sp|Q30PZ4|RS6_SULDN RecName: Full=30S ribosomal protein S6
 gi|78498397|gb|ABB44937.1| SSU ribosomal protein S6P [Sulfurimonas denitrificans DSM 1251]
          Length = 137

 Score = 97.6 bits (242), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 69/124 (55%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE++ +++  +++++I+  I   + +I  NGGE+   + +GMR +AY + KN + Y+
Sbjct: 1   MRNYENLVIVKPTLTAEEIQANISAIEEIITSNGGEIAARDAMGMRKLAYPLGKNERGYF 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             +  +  P+AI E++R+ RI+E +LR +T+  D++ +             +  +   + 
Sbjct: 61  HVIYYSVDPSAISEIERRFRINEELLRFVTIKYDTNREVTAWNQLVQKAQKKATQPAGEA 120

Query: 121 NVDR 124
            V+ 
Sbjct: 121 KVEE 124


>gi|212640666|ref|YP_002317186.1| 30S ribosomal protein S6 [Anoxybacillus flavithermus WK1]
 gi|212562146|gb|ACJ35201.1| Ribosomal protein S6 [Anoxybacillus flavithermus WK1]
          Length = 98

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/95 (31%), Positives = 57/95 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R ++  +  K  + ++ +++ ENG E+  V E G R +AY I K R  YY
Sbjct: 4  MRKYEIMYIIRPNMEEEARKAVVERFNNVLTENGAEITNVKEWGKRRLAYEIEKFRDGYY 63

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ + PAA+ E  R  RI E+++R + +  + 
Sbjct: 64 MILNVVAKPAAVQEFDRLARISEDIIRHIVVKEEE 98


>gi|21222313|ref|NP_628092.1| 30S ribosomal protein S6 [Streptomyces coelicolor A3(2)]
 gi|256786586|ref|ZP_05525017.1| 30S ribosomal protein S6 [Streptomyces lividans TK24]
 gi|289770478|ref|ZP_06529856.1| 30S ribosomal protein S6 [Streptomyces lividans TK24]
 gi|7388220|sp|Q9X8U2|RS6_STRCO RecName: Full=30S ribosomal protein S6
 gi|4808402|emb|CAB42734.1| putative 30S ribosomal protein S6 [Streptomyces coelicolor A3(2)]
 gi|289700677|gb|EFD68106.1| 30S ribosomal protein S6 [Streptomyces lividans TK24]
          Length = 96

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S++++ GG+V  V+  G R ++Y I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERSVSPLIENFLSVVRDGGGKVEKVDTWGRRRLSYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  + H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPEMH 96


>gi|302535599|ref|ZP_07287941.1| ribosomal protein S6 [Streptomyces sp. C]
 gi|302444494|gb|EFL16310.1| ribosomal protein S6 [Streptomyces sp. C]
          Length = 96

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVAPLIENFLSVVREGNGKVEKVDTWGRRRLAYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVLDLQAEPAVVKELDRQMNLNESVLRTKVLRPETH 96


>gi|152977673|ref|YP_001377190.1| 30S ribosomal protein S6 [Bacillus cereus subsp. cytotoxis NVH
          391-98]
 gi|189045454|sp|A7GVN7|RS6_BACCN RecName: Full=30S ribosomal protein S6
 gi|152026425|gb|ABS24195.1| ribosomal protein S6 [Bacillus cytotoxicus NVH 391-98]
          Length = 95

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 54/95 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++++R ++  +  K  + ++ +++  NG E+    E G R +AY I   R  +Y
Sbjct: 1  MKKYEIMYIIRPNMEEEAQKALVERFANVLTNNGAEIINTKEWGKRRLAYEINDLRDGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ S P A+ E  R  +I+E+++R + +  + 
Sbjct: 61 MILNVNSNPEAVKEFDRLAKINEDIIRHIVVKEEE 95


>gi|325204322|gb|ADY99775.1| ribosomal protein S6 [Neisseria meningitidis M01-240355]
          Length = 102

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 46/90 (51%)

Query: 22  TIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRI 81
            + +Y+++I E  G++  + + G R +AY I K  KA+YV MNI + P  + E++   R 
Sbjct: 1   MVERYKTMITEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIETTPEVVEELETAFRF 60

Query: 82  DENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           ++ VLR LT+         +  +      +
Sbjct: 61  NDAVLRHLTIKTKHAVTEASPMLGGEKAKN 90


>gi|302870699|ref|YP_003839336.1| 30S ribosomal protein S6 [Micromonospora aurantiaca ATCC 27029]
 gi|315506936|ref|YP_004085823.1| ribosomal protein s6 [Micromonospora sp. L5]
 gi|302573558|gb|ADL49760.1| ribosomal protein S6 [Micromonospora aurantiaca ATCC 27029]
 gi|315413555|gb|ADU11672.1| ribosomal protein S6 [Micromonospora sp. L5]
          Length = 96

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 53/94 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  Y ++I+  GG V   +  G R +AY I K  +  Y
Sbjct: 1  MRHYEVMVILDPSLEERTVAPSLDTYLNVIRTAGGSVEKTDVWGRRRLAYEINKKAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +++ + P A+ E+ R++R++E+VLR+  +  +
Sbjct: 61 AVIDLQATPEAVGELDRQLRLNESVLRTKVIRPE 94


>gi|83816197|ref|YP_445489.1| 30S ribosomal protein S6 [Salinibacter ruber DSM 13855]
 gi|83757591|gb|ABC45704.1| 30S ribosomal protein S6 [Salinibacter ruber DSM 13855]
          Length = 202

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 59/112 (52%), Gaps = 7/112 (6%)

Query: 4   YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
           YE  +++   +   Q+ D + +   LI+ N G+V  V+E G + +AY I + R  YYV M
Sbjct: 82  YELTYVISGVVKQNQVDDIVRKVNHLIESNDGDVLEVDEWGNQRLAYEIDRKRSGYYVNM 141

Query: 64  NIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
              +P   +  ++R++ I+++VLR LTL +D         ++RH    +  R
Sbjct: 142 YFQAPGELVPRLERELDINDDVLRYLTLRMD-------AKMKRHYEQRKKRR 186


>gi|302543991|ref|ZP_07296333.1| ribosomal protein S6 [Streptomyces hygroscopicus ATCC 53653]
 gi|302461609|gb|EFL24702.1| ribosomal protein S6 [Streptomyces himastatinicus ATCC 53653]
          Length = 96

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 56/96 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+I+E  G+V  V+  G R ++Y I K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVSPLIENFLSVIREGNGKVEKVDTWGRRRLSYEINKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R++ ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQLNLNESVLRTKVLRPETH 96


>gi|302559693|ref|ZP_07312035.1| 30S ribosomal protein S6 [Streptomyces griseoflavus Tu4000]
 gi|302477311|gb|EFL40404.1| 30S ribosomal protein S6 [Streptomyces griseoflavus Tu4000]
          Length = 96

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D   + +   I  + S++++ GG+V  V+  G R ++Y I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDTEERAVSPLIENFLSVVRDGGGKVEKVDTWGRRRLSYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPETH 96


>gi|320109097|ref|YP_004184687.1| 30S ribosomal protein S6 [Terriglobus saanensis SP1PR4]
 gi|319927618|gb|ADV84693.1| ribosomal protein S6 [Terriglobus saanensis SP1PR4]
          Length = 166

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 62/129 (48%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE ++++R DI    +   +  + +++   GGEV    ++G R +AY +RK +   ++
Sbjct: 3   RTYEVMYIVRPDIDEASLDALVEGFNAVVTNGGGEVTTAEKMGRRRLAYTVRKFQDGQFI 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            + I +    + E++R++R+ E V++ +T+  D   +      +  D   +      +  
Sbjct: 63  LLTITADGKVVLELERRLRVTEQVIKFITVRTDEENKRLAKVKKHRDAHKKVSDQRAEVA 122

Query: 122 VDRKQHVSE 130
              +  ++E
Sbjct: 123 PTPQASITE 131


>gi|222530065|ref|YP_002573947.1| 30S ribosomal protein S6 [Caldicellulosiruptor bescii DSM 6725]
 gi|222456912|gb|ACM61174.1| ribosomal protein S6 [Caldicellulosiruptor bescii DSM 6725]
          Length = 96

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 53/94 (56%), Gaps = 1/94 (1%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE VF++   +  +   + I ++++LI  N G++  V E G R +AY+I K+ + YYV
Sbjct: 4  RKYETVFIISPTLDDEARANLIEKFKNLISSN-GQLLNVEEWGKRRLAYKIDKHAEGYYV 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           M   S P    E++R  RI + V+R L + ++ 
Sbjct: 63 LMQFTSKPEFPRELERVYRITDGVIRFLIVKLEK 96


>gi|313894832|ref|ZP_07828392.1| ribosomal protein S6 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312976513|gb|EFR41968.1| ribosomal protein S6 [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 102

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 25/100 (25%), Positives = 54/100 (54%), Gaps = 1/100 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M++YE +F+++  +  +     I ++  LIQ NGG +   +  G + +AY I  + + YY
Sbjct: 1   MRMYEVIFIVKP-MEEEATNAVIEKFTKLIQANGGTIEKEDRWGKKRLAYEINDHSEGYY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
           V + + + PA + E  R M+I +++L+ + +  ++     
Sbjct: 60  VLLYVNAEPACVAECDRVMKITDDLLKHMIVRAENGVPET 99


>gi|116490136|ref|YP_809664.1| ribosomal protein S6 [Oenococcus oeni PSU-1]
 gi|118587502|ref|ZP_01544927.1| 30S ribosomal protein S6 [Oenococcus oeni ATCC BAA-1163]
 gi|290889530|ref|ZP_06552620.1| hypothetical protein AWRIB429_0010 [Oenococcus oeni AWRIB429]
 gi|122277673|sp|Q04HQ7|RS6_OENOB RecName: Full=30S ribosomal protein S6
 gi|116090861|gb|ABJ56015.1| SSU ribosomal protein S6P [Oenococcus oeni PSU-1]
 gi|118432152|gb|EAV38893.1| 30S ribosomal protein S6 [Oenococcus oeni ATCC BAA-1163]
 gi|290480728|gb|EFD89362.1| hypothetical protein AWRIB429_0010 [Oenococcus oeni AWRIB429]
          Length = 146

 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/136 (20%), Positives = 58/136 (42%), Gaps = 4/136 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE  +++R D+        + ++ S++ +NG ++    +   R  AY I   R+  Y
Sbjct: 1   MANYELTYIVRPDLDKDAKAALVTRFDSILSDNGAKIDKSEDWDTRRFAYEINNYRQGTY 60

Query: 61  VFMNIAS-PPAAIHEMKRKMRIDENVLRSLTLLVD--SHEQSPTLTIQRHDR-DDRNDRF 116
             +  +S    A++E  R  +I  ++LR + + VD      +         R  +R  + 
Sbjct: 61  HIVTFSSEDEKAVNEFDRLAKISGDILRHMIVAVDLEKLADAHAKQAAATQRAAERRAQR 120

Query: 117 PRDRNVDRKQHVSEEK 132
             +RN  + Q  +  +
Sbjct: 121 EAERNAAQAQSSASNQ 136


>gi|328883729|emb|CCA56968.1| SSU ribosomal protein S6p [Streptomyces venezuelae ATCC 10712]
          Length = 96

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVSPLIENFLSVVREGNGKVEKVDTWGRRRLAYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R++ ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQLNLNESVLRTKVLRPETH 96


>gi|146296357|ref|YP_001180128.1| ribosomal protein S6 [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|145409933|gb|ABP66937.1| SSU ribosomal protein S6P [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 124

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 53/94 (56%), Gaps = 1/94 (1%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VF++   +  +   + I ++++LI  N G++  V E G R +AY+I K+ + YYV
Sbjct: 32  RKYETVFIISPTLDDEARANLIEKFKNLISSN-GQLLTVEEWGKRRLAYKIDKHAEGYYV 90

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            M   S P    E++R  RI + V+R L + ++ 
Sbjct: 91  LMQFISKPEFPRELERVYRITDGVIRFLIVKLEK 124


>gi|291280359|ref|YP_003497194.1| 30S ribosomal protein S6 [Deferribacter desulfuricans SSM1]
 gi|290755061|dbj|BAI81438.1| 30S ribosomal protein S6 [Deferribacter desulfuricans SSM1]
          Length = 125

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 57/94 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M++YE +F+++ D+S +       Q++ LI ++ G++      G +T+AY+I+K  + YY
Sbjct: 1  MRVYETLFIVKPDLSQEDANKVFEQFKELIVKHNGKILHEEVWGKKTLAYKIQKFSEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N  +      E++R+ R++E+V+R + + +D
Sbjct: 61 FLINFEAEADFPKELERRFRLNESVIRFIVIKID 94


>gi|323141487|ref|ZP_08076376.1| ribosomal protein S6 [Phascolarctobacterium sp. YIT 12067]
 gi|322414067|gb|EFY04897.1| ribosomal protein S6 [Phascolarctobacterium sp. YIT 12067]
          Length = 94

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +++++  +  +  +  + +++ LI  NGG V   +  G R +AY I+   +  Y
Sbjct: 1  MNAYEVMYIVKP-VEDEACEAVVAKFEKLITANGGNVEKTDRWGKRRLAYEIQDLNEGIY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          V +   +  AA+ E+ R M+I + VLR + + 
Sbjct: 60 VLVTFQADAAAVKELDRVMKITDEVLRHMIIR 91


>gi|291520309|emb|CBK75530.1| SSU ribosomal protein S6P [Butyrivibrio fibrisolvens 16/4]
          Length = 96

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 48/96 (50%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE   ++   I       T+ + +  I   GG++  V++ G + +AY I+K  + +Y
Sbjct: 1  MNKYELALVVNAKIEDDARTATVEKAKEYITRFGGQITDVDDWGKKRLAYEIQKMNEGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
           F++  + P    +++  +RI +NVLR L +  D  
Sbjct: 61 YFIHFDAEPGVPAQIEENIRIMDNVLRFLCVRADEA 96


>gi|296141834|ref|YP_003649077.1| ribosomal protein S6 [Tsukamurella paurometabola DSM 20162]
 gi|296029968|gb|ADG80738.1| ribosomal protein S6 [Tsukamurella paurometabola DSM 20162]
          Length = 94

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 57/92 (61%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++++++GG V  ++  G R +AY I KN +  Y
Sbjct: 1  MRKYELMVILDPSLDERTVAPSLETFLNVVRKDGGTVSNIDIWGKRRLAYEITKNSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
            +++ + PA ++E+ R+++++E+VLR+  L 
Sbjct: 61 AVIDLTAEPATVNELDRQLKLNESVLRTKVLR 92


>gi|254391456|ref|ZP_05006658.1| 30S ribosomal protein S6 [Streptomyces clavuligerus ATCC 27064]
 gi|326442135|ref|ZP_08216869.1| 30S ribosomal protein S6 [Streptomyces clavuligerus ATCC 27064]
 gi|197705145|gb|EDY50957.1| 30S ribosomal protein S6 [Streptomyces clavuligerus ATCC 27064]
          Length = 96

 Score = 97.2 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVAPLIENFLSVVREGNGKVEKVDTWGRRRLAYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPETH 96


>gi|251800231|ref|YP_003014962.1| ribosomal protein S6 [Paenibacillus sp. JDR-2]
 gi|247547857|gb|ACT04876.1| ribosomal protein S6 [Paenibacillus sp. JDR-2]
          Length = 94

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 55/92 (59%), Gaps = 1/92 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R D+  + ++  + ++  +I  NGGEV   + +G R +AY I K R  YY
Sbjct: 1  MRKYEVMYIIRPDVEQENVQAIVDKFSGII-NNGGEVTKQDVIGKRRLAYEINKIRDGYY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          V ++  +    ++E+ R M+I + V+RSL + 
Sbjct: 60 VLVHFNATTEVVNELDRIMKITDEVIRSLIVR 91


>gi|228994193|ref|ZP_04154093.1| 30S ribosomal protein S6 [Bacillus pseudomycoides DSM 12442]
 gi|229000263|ref|ZP_04159832.1| 30S ribosomal protein S6 [Bacillus mycoides Rock3-17]
 gi|228759595|gb|EEM08572.1| 30S ribosomal protein S6 [Bacillus mycoides Rock3-17]
 gi|228765645|gb|EEM14299.1| 30S ribosomal protein S6 [Bacillus pseudomycoides DSM 12442]
          Length = 96

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 52/95 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++++R ++  +  K  + ++  ++  NG E+    E G R +AY I   R  +Y
Sbjct: 1  MKKYEIMYIIRPNMEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLRDGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ S   A+ E  R  +I+E++LR + +  + 
Sbjct: 61 MILNVNSDAEAVKEFDRLAKINEDILRHIVVKEEE 95


>gi|189183703|ref|YP_001937488.1| 30S ribosomal protein S6 [Orientia tsutsugamushi str. Ikeda]
 gi|226695109|sp|B3CRZ7|RS6_ORITI RecName: Full=30S ribosomal protein S6
 gi|189180474|dbj|BAG40254.1| 30S ribosomal protein S6 [Orientia tsutsugamushi str. Ikeda]
          Length = 118

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 63/113 (55%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+LYE V ++R ++SS +I     +  S+I    G++      GMR++AY+I +N++A+Y
Sbjct: 1   MRLYELVLIVRPELSSTEIDKLTDELTSIISNYEGKLVKHEYWGMRSLAYKINRNQRAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
           + + I++    + ++K K++ +  ++RS  + V    Q+ +  ++    +   
Sbjct: 61  IMLAISANNNILQKLKNKIKNNLEIIRSRFIKVKEISQTTSPILKNQSLEQTA 113


>gi|154503454|ref|ZP_02040514.1| hypothetical protein RUMGNA_01278 [Ruminococcus gnavus ATCC 29149]
 gi|153795554|gb|EDN77974.1| hypothetical protein RUMGNA_01278 [Ruminococcus gnavus ATCC 29149]
          Length = 136

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 49/94 (52%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE   ++   I        I + + +I   GG V  V+E G R  AY I+K ++ +Y
Sbjct: 42  MNKYELAVVVSAKIEDDARAAVIEKVKEMITRFGGNVTDVDEWGKRRFAYEIQKMKEGFY 101

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            F++  S  +   E+++++RI +NVLR L +  +
Sbjct: 102 YFVHFESDASVPGEIEQRIRIMDNVLRYLCVRQE 135


>gi|319950615|ref|ZP_08024522.1| 30S ribosomal protein S6 [Dietzia cinnamea P4]
 gi|319435723|gb|EFV90936.1| 30S ribosomal protein S6 [Dietzia cinnamea P4]
          Length = 95

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 52/95 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++I++ GG V  V+  G R  AY I K  +  Y
Sbjct: 1  MRQYEVMVILDPSLDERTVAPSLDTFLNVIRQEGGSVDKVDVWGKRRFAYEINKLNEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            + + S P A+ E+ R++ ++ENVLR+  L  D 
Sbjct: 61 AVVQLKSEPDAVKELDRQLGLNENVLRTKVLRADK 95


>gi|313674401|ref|YP_004052397.1| SSU ribosomal protein s6p [Marivirga tractuosa DSM 4126]
 gi|312941099|gb|ADR20289.1| SSU ribosomal protein S6P [Marivirga tractuosa DSM 4126]
          Length = 123

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 59/117 (50%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           K YE VF+L   +S  Q+KD + +++ ++++   E+  V + G++ +AY I+     +Y 
Sbjct: 4   KNYETVFILTPVLSDAQMKDAVDKFRKVLEDKKAEIINVEQWGLKKLAYPIQHKSTGFYN 63

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPR 118
            +   + P  +  ++ + R DE ++R LT+ +D H        ++   +   ++   
Sbjct: 64  LIEFKATPEVVAALELEYRRDEKIMRFLTVALDKHAIEYGERRRKGAFNKPKEQKEE 120


>gi|303232315|ref|ZP_07319010.1| ribosomal protein S6 [Atopobium vaginae PB189-T1-4]
 gi|302481572|gb|EFL44637.1| ribosomal protein S6 [Atopobium vaginae PB189-T1-4]
          Length = 97

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 45/97 (46%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++ +    + +       +    I E  G V  V + G R +AY I K  +  Y
Sbjct: 1  MKAYELLYFVSPSATDEVRAAVAKRIDDTITEQSGVVDSVEDWGKRKLAYEINKLTEGDY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97
            +N  + PA I E+ R +RI++ V+R + +     +
Sbjct: 61 TLINFHADPAHIAELDRVLRINDTVVRHMIVRRPDKD 97


>gi|312621640|ref|YP_004023253.1| 30S ribosomal protein S6 [Caldicellulosiruptor kronotskyensis
          2002]
 gi|312202107|gb|ADQ45434.1| ribosomal protein S6 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 96

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 1/94 (1%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE VF++   +  +     I ++++LI  N G++  V E G R +AY+I K+ + YYV
Sbjct: 4  RKYETVFIISPTLDDEARNSLIEKFKNLISSN-GQLLNVEEWGKRRLAYKIDKHAEGYYV 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           M   S P    E++R  RI + V+R L + ++ 
Sbjct: 63 LMQFISKPEFPRELERVYRITDGVIRFLIVKLEK 96


>gi|254384803|ref|ZP_05000140.1| 30S ribosomal protein S6 [Streptomyces sp. Mg1]
 gi|297193322|ref|ZP_06910720.1| 30S ribosomal protein S6 [Streptomyces pristinaespiralis ATCC
          25486]
 gi|194343685|gb|EDX24651.1| 30S ribosomal protein S6 [Streptomyces sp. Mg1]
 gi|197718360|gb|EDY62268.1| 30S ribosomal protein S6 [Streptomyces pristinaespiralis ATCC
          25486]
          Length = 96

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVSPLIENFLSVVREGNGKVEKVDTWGRRRLAYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPETH 96


>gi|227824503|ref|ZP_03989335.1| 30S ribosomal protein S6P [Acidaminococcus sp. D21]
 gi|226905002|gb|EEH90920.1| 30S ribosomal protein S6P [Acidaminococcus sp. D21]
          Length = 94

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 21/92 (22%), Positives = 48/92 (52%), Gaps = 1/92 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +++++  +  +     + ++  L+  NG  +   ++ G + +AY I+  +   Y
Sbjct: 1  MNNYEVMYIVKP-VEEEAYSAVVKKFDDLLTANGATIEKTDKWGKKHLAYPIQDIQDGLY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          V    ++ PAA+ E+ R M+I + +LR + + 
Sbjct: 60 VLTTFSAEPAAVKELDRVMKITDEILRHMIIR 91


>gi|225873663|ref|YP_002755122.1| ribosomal protein S6 [Acidobacterium capsulatum ATCC 51196]
 gi|254765214|sp|C1F904|RS6_ACIC5 RecName: Full=30S ribosomal protein S6
 gi|225792352|gb|ACO32442.1| ribosomal protein S6 [Acidobacterium capsulatum ATCC 51196]
          Length = 141

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 24/97 (24%), Positives = 57/97 (58%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE +F++R D++ +++   I   +  +   GG +R   ++G R +AY +RK  +  Y+
Sbjct: 3  RFYEVMFIVRPDLAEEEVDKIIASLEQTVTNGGGTIRSTEKMGRRKLAYLVRKFSEGNYI 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQ 98
           + + +    + E++R++R+ E V++ +T+ +D  E+
Sbjct: 63 LLTVDADGPLVAELERRLRVTEQVIKFITVRMDEEEK 99


>gi|238020008|ref|ZP_04600434.1| hypothetical protein VEIDISOL_01884 [Veillonella dispar ATCC
          17748]
 gi|269797400|ref|YP_003311300.1| ribosomal protein S6 [Veillonella parvula DSM 2008]
 gi|282849202|ref|ZP_06258587.1| ribosomal protein S6 [Veillonella parvula ATCC 17745]
 gi|294793014|ref|ZP_06758160.1| ribosomal protein S6 [Veillonella sp. 6_1_27]
 gi|294794946|ref|ZP_06760081.1| ribosomal protein S6 [Veillonella sp. 3_1_44]
 gi|313893842|ref|ZP_07827408.1| ribosomal protein S6 [Veillonella sp. oral taxon 158 str. F0412]
 gi|237863532|gb|EEP64822.1| hypothetical protein VEIDISOL_01884 [Veillonella dispar ATCC
          17748]
 gi|269094029|gb|ACZ24020.1| ribosomal protein S6 [Veillonella parvula DSM 2008]
 gi|282580906|gb|EFB86304.1| ribosomal protein S6 [Veillonella parvula ATCC 17745]
 gi|294454308|gb|EFG22682.1| ribosomal protein S6 [Veillonella sp. 3_1_44]
 gi|294455959|gb|EFG24323.1| ribosomal protein S6 [Veillonella sp. 6_1_27]
 gi|313441406|gb|EFR59832.1| ribosomal protein S6 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 94

 Score = 97.2 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 51/94 (54%), Gaps = 1/94 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +F+++     +     I + ++LI   GG V  V+  G R +AY ++K    +Y
Sbjct: 1  MNKYEVMFIVKPA-EEEATNAVIEKVEALIARVGGTVEKVDRWGKRRLAYAVKKFTDGFY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V +N  + PA I E+ R ++I++ VLR L +  +
Sbjct: 60 VLINFEAAPAEIKEIDRVLKINDEVLRHLIVKHE 93


>gi|229087961|ref|ZP_04220069.1| 30S ribosomal protein S6 [Bacillus cereus Rock3-44]
 gi|228695346|gb|EEL48223.1| 30S ribosomal protein S6 [Bacillus cereus Rock3-44]
          Length = 96

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 53/95 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++++R  +  +  K  + ++  ++  NG E+    E G R +AY I   R+ +Y
Sbjct: 1  MKKYEIMYIIRPGVEEEAQKALVERFAGVLTNNGAEIINTKEWGKRRLAYEINDLREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + +N+ S   AI+E  R  +I+E++LR + +  + 
Sbjct: 61 MILNVNSNAEAINEFDRLAKINEDILRHIVVKEEE 95


>gi|312792726|ref|YP_004025649.1| 30S ribosomal protein S6 [Caldicellulosiruptor kristjanssonii
          177R1B]
 gi|312877714|ref|ZP_07737668.1| ribosomal protein S6 [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795515|gb|EFR11890.1| ribosomal protein S6 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312179866|gb|ADQ40036.1| ribosomal protein S6 [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 96

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 52/94 (55%), Gaps = 1/94 (1%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE VF++   +  +     + ++++LI  N G++  V E G R +AY+I K+ + YYV
Sbjct: 4  RKYETVFIISPTLDDEARNALVEKFKNLISSN-GQLLTVEEWGKRRLAYKIDKHAEGYYV 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           M   S P    E++R  RI + V+R L + ++ 
Sbjct: 63 LMQFISKPEFPRELERVYRITDGVIRFLIVKLEK 96


>gi|297158764|gb|ADI08476.1| 30S ribosomal protein S6 [Streptomyces bingchenggensis BCW-1]
          Length = 96

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 56/96 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R ++Y I K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVSPLIENFLSVVREGNGKVEKVDTWGRRRLSYEINKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R++ ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQLNLNESVLRTKVLRPETH 96


>gi|311897279|dbj|BAJ29687.1| putative ribosomal protein S6 [Kitasatospora setae KM-6054]
          Length = 96

 Score = 96.8 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 24/96 (25%), Positives = 52/96 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +   I  + ++++  GG++  ++  G R +AY I K  +  Y
Sbjct: 1  MRHYEVMVILDPSVEERAVSPLIESFLNVVRTGGGKIEKIDTWGRRRLAYEINKQSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + P  + E+ R+  + E+VLR+  L  D+H
Sbjct: 61 SVIDLKATPEVVKELDRQFSLSESVLRTKVLRPDTH 96


>gi|237736138|ref|ZP_04566619.1| SSU ribosomal protein S6P [Fusobacterium mortiferum ATCC 9817]
 gi|229421691|gb|EEO36738.1| SSU ribosomal protein S6P [Fusobacterium mortiferum ATCC 9817]
          Length = 94

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 43/94 (45%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE +F++   I  +     I +   ++   G  ++   + G R +AY I K +  +Y
Sbjct: 1  MKKYEIMFIINPTILEEGRDAVIEKVTGVLTAAGANIQKSEKWGERKLAYPIDKKKTGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V          + +++ K+ I E VLR + +  D
Sbjct: 61 VLTTFEIDGTVLSDVELKLNIIEEVLRYIIVKQD 94


>gi|222054668|ref|YP_002537030.1| ribosomal protein S6 [Geobacter sp. FRC-32]
 gi|254765439|sp|B9M5U8|RS6_GEOSF RecName: Full=30S ribosomal protein S6
 gi|221563957|gb|ACM19929.1| ribosomal protein S6 [Geobacter sp. FRC-32]
          Length = 128

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 64/128 (50%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M++YE +F+++ D+  +++K    + Q +I    GE++ + + G R +AY I K  +  Y
Sbjct: 1   MRMYETIFIVQPDLGEEELKGISARVQEVIVSMKGELKRLEDWGARKLAYPIEKFNRGRY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
            ++      A I E++R++R+++ ++R  ++ ++    +      +   ++  +  P  +
Sbjct: 61  YYLRFDGDAALIAELERRLRLNDKIIRYQSVKLEKEAPAAAAIPAKVTEEEPVEAAPEAK 120

Query: 121 NVDRKQHV 128
                +  
Sbjct: 121 VETTTEEE 128


>gi|309811413|ref|ZP_07705200.1| ribosomal protein S6 [Dermacoccus sp. Ellin185]
 gi|308434720|gb|EFP58565.1| ribosomal protein S6 [Dermacoccus sp. Ellin185]
          Length = 99

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 57/94 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  ++  + ++ ++ ++ S++ ++GG V  V+  G R +AY I+K  +  Y
Sbjct: 5  MRHYEMMIILDGELDERTVQPSLEKFLSVVTKDGGTVDNVDVWGRRRMAYDIKKKSEGIY 64

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V ++  + PA   E+ R++ ++E++LR+  L  D
Sbjct: 65 VVVDFNATPATAAELDRQLGLNESILRTKILRKD 98


>gi|323698323|ref|ZP_08110235.1| ribosomal protein S6 [Desulfovibrio sp. ND132]
 gi|323458255|gb|EGB14120.1| ribosomal protein S6 [Desulfovibrio desulfuricans ND132]
          Length = 96

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 51/92 (55%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
            YE + LL  +++++     +     ++   GG++   ++ GMR +AY ++K  + YYV
Sbjct: 3  NNYETLVLLSPELAAEDRTTILDTLTGIVDREGGKMVETDDWGMRQLAYPVQKQTRGYYV 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLV 93
           +   +P A + E++R +RI + + + +T+ +
Sbjct: 63 RLVYDAPGALVAELERNIRITDGIFKFMTVKL 94


>gi|257058628|ref|YP_003136516.1| 30S ribosomal protein S6 [Cyanothece sp. PCC 8802]
 gi|256588794|gb|ACU99680.1| ribosomal protein S6 [Cyanothece sp. PCC 8802]
          Length = 124

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 49/97 (50%)

Query: 4   YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
           YE +++LR  +S +Q+   + +Y+  + +   +   V   G R +AY I++     YV M
Sbjct: 5   YEMIYILRPSLSEEQVNQEVNKYRDFLNDYNVKDLQVKIWGKRRLAYPIKRFIDGIYVQM 64

Query: 64  NIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
           N       +  ++R MR+ E V+R +TL V++     
Sbjct: 65  NYQGEGNQVAPLERAMRLSEEVIRYMTLKVETAVSET 101


>gi|311032236|ref|ZP_07710326.1| 30S ribosomal protein S6 [Bacillus sp. m3-13]
          Length = 96

 Score = 96.8 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 53/94 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE ++++R +I     K    ++ +++ +NG ++    E G R +AY I   R  YY
Sbjct: 1  MNKYEIMYIIRPNIEEDAKKALTERFNTILTDNGADLTESKEWGKRRLAYEINDFRDGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          + +N+A+ PAA+ E  R  +I E+++R + +  +
Sbjct: 61 MLVNVAAEPAAVQEFDRLAKISEDIIRHIVVKKE 94


>gi|148284319|ref|YP_001248409.1| 30S ribosomal protein S6 [Orientia tsutsugamushi str. Boryong]
 gi|166227358|sp|A5CCY7|RS6_ORITB RecName: Full=30S ribosomal protein S6
 gi|146739758|emb|CAM79616.1| 30S ribosomal protein S6 [Orientia tsutsugamushi str. Boryong]
          Length = 118

 Score = 96.8 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 63/113 (55%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+LYE V ++R ++SS +I     +  S+I    G++      GMR++AY+I +N++A+Y
Sbjct: 1   MRLYELVLIVRPELSSTEIDKLTDELTSIISNYEGKLVKHEYWGMRSLAYKINRNQRAHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
           + + I++    + ++K K++ +  ++RS  + V    Q+ +  ++    +   
Sbjct: 61  IMLAISANNNILQKLKNKIKNNLEIIRSRFIKVKEISQTTSPILKNQSFEQTA 113


>gi|157736502|ref|YP_001489185.1| 30S ribosomal protein S6 [Arcobacter butzleri RM4018]
 gi|157698356|gb|ABV66516.1| 30S ribosomal protein S6 [Arcobacter butzleri RM4018]
          Length = 118

 Score = 96.8 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 64/114 (56%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           K YE +F+L+  ++ ++    I   ++LI++NGGE+   + +G+R +AY I K ++ YY 
Sbjct: 5   KHYETMFILKPTLTEEETVAQIDGIKALIEKNGGEISSTDNVGIRELAYEIEKCKRGYYY 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDR 115
            +     P+ I E++R  R +EN++R + +  D+ ++  + T    +   +  +
Sbjct: 65  VIYFKGNPSGIAEIERNYRNNENLIRFIFIKYDTKKEIASWTKMSDEAAKKATK 118


>gi|212550374|ref|YP_002308691.1| 30S ribosomal protein S6 [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|226703416|sp|B6YQ08|RS6_AZOPC RecName: Full=30S ribosomal protein S6
 gi|212548612|dbj|BAG83280.1| 30S ribosomal protein S6 [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 112

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/112 (24%), Positives = 55/112 (49%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE VF+L   +S +Q+K+T+ +++ ++     E+      G+R ++Y I++    +Y
Sbjct: 1   MNNYEAVFILTPVLSDEQVKETVNKFKDILIAEEAEIINEENWGLRKLSYPIQRKTTGFY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
             +   S    I +++ + R DE VLR LT   +       L  +   ++ +
Sbjct: 61  FLLEFKSDSTIISKLETQFRRDEKVLRFLTFRQNKVFMEYALKRRNKLKETK 112


>gi|325130388|gb|EGC53153.1| ribosomal protein S6 [Neisseria meningitidis OX99.30304]
          Length = 102

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 46/90 (51%)

Query: 22  TIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRI 81
            + +Y+++I E  G++  + + G R +AY I K  KA+YV MNI + P  + E++   R 
Sbjct: 1   MVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIETTPEVVEELETAFRF 60

Query: 82  DENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           ++ VLR LT+         +  +      +
Sbjct: 61  NDAVLRHLTIKTKHAVTEASPMLGGEKAKN 90


>gi|302872493|ref|YP_003841129.1| ribosomal protein S6 [Caldicellulosiruptor obsidiansis OB47]
 gi|312126894|ref|YP_003991768.1| 30S ribosomal protein S6 [Caldicellulosiruptor hydrothermalis
          108]
 gi|302575352|gb|ADL43143.1| ribosomal protein S6 [Caldicellulosiruptor obsidiansis OB47]
 gi|311776913|gb|ADQ06399.1| ribosomal protein S6 [Caldicellulosiruptor hydrothermalis 108]
          Length = 96

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 52/94 (55%), Gaps = 1/94 (1%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE VF++   +  +     + ++++LI  N G++  V E G R +AY+I K+ + YYV
Sbjct: 4  RKYETVFIISPALDDEARAALVEKFKNLISSN-GQLLTVEEWGKRRLAYKIDKHAEGYYV 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           M   S P    E++R  RI + V+R L + ++ 
Sbjct: 63 LMQFISKPEFPRELERVYRITDGVIRFLIVKLEK 96


>gi|159904384|ref|YP_001551728.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9211]
 gi|226695114|sp|A9BDR2|RS6_PROM4 RecName: Full=30S ribosomal protein S6
 gi|159889560|gb|ABX09774.1| 30S ribosomal protein S6 [Prochlorococcus marinus str. MIT 9211]
          Length = 172

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/131 (24%), Positives = 62/131 (47%), Gaps = 6/131 (4%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE +++LR  I   ++   + +Y  +++  GGEV      G R +AY I K+++  YV
Sbjct: 5   PYYETMYILRPTIPEDEVDSHLKKYTEILESAGGEVLDSQMRGKRRLAYPIGKHKEGIYV 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            ++       I  +++ MR+ E+V+R LT+  D    +  +                D+ 
Sbjct: 65  QLSHQGDGQHIAVLEKAMRLTEDVIRYLTVKQDGPLPAKRVVKTSEK------NVKEDKE 118

Query: 122 VDRKQHVSEEK 132
           V+ K+  +E+K
Sbjct: 119 VENKETTTEDK 129


>gi|23100934|ref|NP_694401.1| 30S ribosomal protein S6 [Oceanobacillus iheyensis HTE831]
 gi|32171554|sp|Q8EKV4|RS6_OCEIH RecName: Full=30S ribosomal protein S6
 gi|22779169|dbj|BAC15435.1| 30S ribosomal protein S6 [Oceanobacillus iheyensis HTE831]
          Length = 95

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 53/94 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R DI  +     I ++ +++ +NG E+  V+E G R +AY I   R  YY
Sbjct: 1  MRKYEIMYIIRPDIEEEAQTALIERFNTILTDNGAEIDKVDEKGKRRLAYEINDYRDGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V +N      AI+E  R  + +++++R + +  +
Sbjct: 61 VIINFRGSEEAINEFDRLAKFNDDIIRHMAIKDE 94


>gi|89897782|ref|YP_521269.1| 30S ribosomal protein S6 [Desulfitobacterium hafniense Y51]
 gi|219670931|ref|YP_002461366.1| 30S ribosomal protein S6 [Desulfitobacterium hafniense DCB-2]
 gi|122480435|sp|Q24MB7|RS6_DESHY RecName: Full=30S ribosomal protein S6
 gi|254765432|sp|B8G0J4|RS6_DESHD RecName: Full=30S ribosomal protein S6
 gi|89337230|dbj|BAE86825.1| 30S ribosomal protein S6 [Desulfitobacterium hafniense Y51]
 gi|219541191|gb|ACL22930.1| ribosomal protein S6 [Desulfitobacterium hafniense DCB-2]
          Length = 95

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 51/95 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++++R D+  + +  T+ +   ++  NGG    +++ G R +AY +   R+ +Y
Sbjct: 1  MKAYEVLYVIRPDLDDEAVAATVDKLSEVVTNNGGADVAIDKWGKRRLAYEVNDYREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          + MN         E++R M+I + V+R LT   + 
Sbjct: 61 ILMNFNGEARTAQEVERIMKISDAVVRFLTTKKED 95


>gi|34763884|ref|ZP_00144788.1| SSU ribosomal protein S6P [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
 gi|237742687|ref|ZP_04573168.1| SSU ribosomal protein S6P [Fusobacterium sp. 4_1_13]
 gi|256846082|ref|ZP_05551540.1| ribosomal protein S6 [Fusobacterium sp. 3_1_36A2]
 gi|294784788|ref|ZP_06750076.1| ribosomal protein S6 [Fusobacterium sp. 3_1_27]
 gi|27886347|gb|EAA23618.1| SSU ribosomal protein S6P [Fusobacterium nucleatum subsp. vincentii
           ATCC 49256]
 gi|229430335|gb|EEO40547.1| SSU ribosomal protein S6P [Fusobacterium sp. 4_1_13]
 gi|256719641|gb|EEU33196.1| ribosomal protein S6 [Fusobacterium sp. 3_1_36A2]
 gi|294486502|gb|EFG33864.1| ribosomal protein S6 [Fusobacterium sp. 3_1_27]
          Length = 105

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 47/94 (50%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE ++++   +  +  ++ I Q  +L+  NG  +    + G R +AY I K +  +Y
Sbjct: 12  MRKYEIMYIINPTVLEEGREELINQVNALLTSNGATIAKTEKWGERKLAYPIDKKKSGFY 71

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           V          + E++ K+ I E+V+R + +  D
Sbjct: 72  VLTTFEIDGTKLAEVESKLNIMESVMRYIVVKQD 105


>gi|260662544|ref|ZP_05863439.1| 30S ribosomal protein S6 [Lactobacillus fermentum 28-3-CHN]
 gi|260553235|gb|EEX26178.1| 30S ribosomal protein S6 [Lactobacillus fermentum 28-3-CHN]
          Length = 97

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 46/93 (49%), Gaps = 1/93 (1%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE  +++R DI      + + ++  ++ +NG  V    + G R  AY+I K  +  Y 
Sbjct: 4  RKYEITYIIRPDIEESAKSELVARFDKILADNGATVVDSADWGTRRFAYQIGKYTEGTYH 63

Query: 62 FMNIASPPAA-IHEMKRKMRIDENVLRSLTLLV 93
           +N+ +   A ++E  R  +  +++LR + +  
Sbjct: 64 IVNVTADSDASLNEFDRLAKFSDDILRHMIVKR 96


>gi|284993411|ref|YP_003411966.1| 30S ribosomal protein S6 [Geodermatophilus obscurus DSM 43160]
 gi|284066657|gb|ADB77595.1| ribosomal protein S6 [Geodermatophilus obscurus DSM 43160]
          Length = 95

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 55/96 (57%), Gaps = 1/96 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + I  ++ ++ +++  +GG V      G R +AY I K  +  Y
Sbjct: 1  MRRYELMVILDPDLEERTIAPSLDRFLTVVTNSGGTV-KTEIWGRRRLAYEINKQVEGIY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            ++I + PAA+ E+ R++ ++E+VLR+  +  + H
Sbjct: 60 AIVDIQATPAAVAELDRQLNLNESVLRTKLMRPEVH 95


>gi|295697818|ref|YP_003591056.1| ribosomal protein S6 [Bacillus tusciae DSM 2912]
 gi|295413420|gb|ADG07912.1| ribosomal protein S6 [Bacillus tusciae DSM 2912]
          Length = 95

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/95 (34%), Positives = 53/95 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +++LR D+  +   D + +   ++   GGE++ VN  G R +AY I  +R+ YY
Sbjct: 1  MRNYETLYILRPDLEEEATADQVKRLAEVVTTAGGELQEVNTWGKRRMAYEIEGHREGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V M  AS      E++R +RI E VLR + +  D 
Sbjct: 61 VLMKFASDTEVPKELERVLRISEPVLRYIVVREDE 95


>gi|229822655|ref|YP_002884181.1| ribosomal protein S6 [Beutenbergia cavernae DSM 12333]
 gi|259495326|sp|C5C661|RS6_BEUC1 RecName: Full=30S ribosomal protein S6
 gi|229568568|gb|ACQ82419.1| ribosomal protein S6 [Beutenbergia cavernae DSM 12333]
          Length = 96

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 54/96 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  ++  + +  ++ ++ S+I+  GG V  V+  G R +AY I K  +  Y
Sbjct: 1  MRNYELMIILDPEVDERTVAPSLDKFLSVIKTGGGSVDNVDIWGKRRLAYEINKRAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +N+ + P    E+ R++ ++E VLR+  +  D+H
Sbjct: 61 AVVNLTATPDLAKELDRQLGLNEAVLRTKLIRPDAH 96


>gi|297585578|ref|YP_003701358.1| 30S ribosomal protein S6 [Bacillus selenitireducens MLS10]
 gi|297144035|gb|ADI00793.1| ribosomal protein S6 [Bacillus selenitireducens MLS10]
          Length = 95

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 55/95 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R D+  Q +K+T+ ++ +++  NG E+    E+G R +AY I      +Y
Sbjct: 1  MRKYEIMYIVRPDLEEQAVKETVERFNTILTNNGAELTETKEMGKRRLAYEIEDFTDGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V + + +   A+ E  R   I++N+LRS+ +  D 
Sbjct: 61 VLIQLNANKDALDEFNRLSSINDNILRSIIVREDD 95


>gi|325198474|gb|ADY93930.1| ribosomal protein S6 [Neisseria meningitidis G2136]
 gi|325200052|gb|ADY95507.1| ribosomal protein S6 [Neisseria meningitidis H44/76]
          Length = 102

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/90 (27%), Positives = 46/90 (51%)

Query: 22  TIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRI 81
            + +Y+++I E  G++  + + G R +AY I K  KA+YV MNI + P  + E++   R 
Sbjct: 1   MVERYKTMIAEANGKIHRLEDWGRRQLAYPINKIHKAHYVLMNIETTPEVVEELETAFRF 60

Query: 82  DENVLRSLTLLVDSHEQSPTLTIQRHDRDD 111
           ++ VLR LT+         +  +      +
Sbjct: 61  NDAVLRHLTIKTKHAVTEASPMLGGEKAKN 90


>gi|239942697|ref|ZP_04694634.1| 30S ribosomal protein S6 [Streptomyces roseosporus NRRL 15998]
 gi|239989156|ref|ZP_04709820.1| 30S ribosomal protein S6 [Streptomyces roseosporus NRRL 11379]
 gi|291446161|ref|ZP_06585551.1| 30S ribosomal protein S6 [Streptomyces roseosporus NRRL 15998]
 gi|291349108|gb|EFE76012.1| 30S ribosomal protein S6 [Streptomyces roseosporus NRRL 15998]
          Length = 96

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 56/96 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVSPLIENFLSVVREGNGKVEKVDTWGRRRLAYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  + H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPEVH 96


>gi|237743346|ref|ZP_04573827.1| SSU ribosomal protein S6P [Fusobacterium sp. 7_1]
 gi|256028464|ref|ZP_05442298.1| SSU ribosomal protein S6P [Fusobacterium sp. D11]
 gi|229433125|gb|EEO43337.1| SSU ribosomal protein S6P [Fusobacterium sp. 7_1]
          Length = 94

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 48/94 (51%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++   +  +  ++TI Q  +L+  NG  +    + G R +AY I K +  +Y
Sbjct: 1  MRKYEIMYIINPTVLEEGREETINQVNALLTSNGATITKTEKWGERKLAYPIDKKKSGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V          + E++ K+ I E+V+R + +  D
Sbjct: 61 VLTTFEIDGTKLAEVEAKVNIMESVMRYIVVRQD 94


>gi|297200912|ref|ZP_06918309.1| ribosomal protein S6 [Streptomyces sviceus ATCC 29083]
 gi|197716410|gb|EDY60444.1| ribosomal protein S6 [Streptomyces sviceus ATCC 29083]
          Length = 96

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R ++Y I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVAPLIENFLSVVREGNGKVEKVDTWGRRRLSYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R++ ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQLNLNESVLRTKVLRPETH 96


>gi|311112590|ref|YP_003983812.1| 30S ribosomal protein S6 [Rothia dentocariosa ATCC 17931]
 gi|310944084|gb|ADP40378.1| 30S ribosomal protein S6 [Rothia dentocariosa ATCC 17931]
          Length = 119

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 51/95 (53%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + +L  ++  + ++ ++ ++  ++   GG +  ++  G R +AY I+K  +  Y
Sbjct: 20  MRAYELMVILNPEVEDRAVEPSLSKFLEIVTNAGGTIDNLDIWGRRRLAYEIQKKSEGIY 79

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
             +N  + P    E+ R + ++E+V+R+  +  + 
Sbjct: 80  AVVNFTASPETAAELDRVLNLNESVMRTKIIRPED 114


>gi|229542335|ref|ZP_04431395.1| ribosomal protein S6 [Bacillus coagulans 36D1]
 gi|229326755|gb|EEN92430.1| ribosomal protein S6 [Bacillus coagulans 36D1]
          Length = 95

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 52/95 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R +I  +  K  + ++ +++   G E+    E G R +AY I+  R  YY
Sbjct: 1  MRKYEIMYIIRPNIEDEAKKALVERFDNVLNNQGAEIIESKEWGKRRLAYEIQDFRDGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N+ + P A+ E  R  +I+ +++R + +  + 
Sbjct: 61 HIINVNAEPVAVQEFDRLAKINGDIIRHIVVREEE 95


>gi|19704978|ref|NP_602473.1| SSU ribosomal protein S6P [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|296329233|ref|ZP_06871734.1| 30S ribosomal protein S6 [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
 gi|19712882|gb|AAL93772.1| SSU ribosomal protein S6P [Fusobacterium nucleatum subsp. nucleatum
           ATCC 25586]
 gi|296153589|gb|EFG94406.1| 30S ribosomal protein S6 [Fusobacterium nucleatum subsp. nucleatum
           ATCC 23726]
          Length = 105

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 47/94 (50%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE ++++   +  +  ++ + Q  +L+  NG  +    + G R +AY I K +  +Y
Sbjct: 12  MRKYEIMYIINPTVLEEGREELVNQVNALLTSNGATIAKTEKWGERKLAYPIDKKKSGFY 71

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           V          + E++ K+ I E+V+R + +  D
Sbjct: 72  VLTTFEIDGTKLAEVESKLNIMESVMRYIVVKQD 105


>gi|258655466|ref|YP_003204622.1| 30S ribosomal protein S6 [Nakamurella multipartita DSM 44233]
 gi|258558691|gb|ACV81633.1| ribosomal protein S6 [Nakamurella multipartita DSM 44233]
          Length = 102

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/93 (26%), Positives = 54/93 (58%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE + +L  ++  + +  +I  + ++I++ GG V  V+  G R +A+ I+KN +  Y 
Sbjct: 8   RHYELLLILDPNLDERTVAPSIDTFLNVIRQGGGSVENVDIWGKRRLAFEIKKNPEGIYA 67

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            + +  P A + E+ R++ ++E+VLR+  +  D
Sbjct: 68  VIKVTCPSAVVTELDRQLNLNESVLRTKIIRPD 100


>gi|311746135|ref|ZP_07719920.1| ribosomal protein S6 [Algoriphagus sp. PR1]
 gi|126576356|gb|EAZ80634.1| ribosomal protein S6 [Algoriphagus sp. PR1]
          Length = 123

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 63/120 (52%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE VF+L   +S  Q+KDT+ ++ +L++E G +V  V   G++ +AY I K    +YV
Sbjct: 4   RNYETVFILTPVLSDVQMKDTVDKFVNLLKEEGADVINVENWGLKKMAYTIDKKTTGFYV 63

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            +   + P  I + + + R DE V+R LT +++ H  +     ++ + + + +       
Sbjct: 64  LVEFKADPTVISKFELEFRRDEKVMRFLTTVLEKHGIAYAERRRKGEFNKKTEAKEEQAK 123


>gi|116782633|gb|ABK22584.1| unknown [Picea sitchensis]
          Length = 289

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/101 (26%), Positives = 56/101 (55%), Gaps = 1/101 (0%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE ++L+ +D ++ ++++ + + +  ++E  G++  +N+ GMR +AY+I K +KA Y+
Sbjct: 135 RHYEIMYLIHED-NADEVQEVVSKVKDFVEEKKGKIWRLNDWGMRRLAYKIEKAKKANYI 193

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
            MNI      I+++K     DE V+R L +           
Sbjct: 194 LMNIEMGAEHINDLKTLFDKDERVIRHLVMKQKKAITEDCP 234


>gi|291007702|ref|ZP_06565675.1| 30S ribosomal protein S6 [Saccharopolyspora erythraea NRRL 2338]
          Length = 121

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 54/93 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++I+ +GG V  V+  G R +AY I K  +  Y
Sbjct: 4  MRHYELMVILDPSLDERTVAPSLENFLNVIRNDGGSVEKVDVWGRRRLAYEIDKQAEGIY 63

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLV 93
          V +++ S PA++ E+ R++ ++E VLR+  L  
Sbjct: 64 VVLDLNSEPASVKELDRQLNLNETVLRTKVLRR 96


>gi|331700357|ref|YP_004336596.1| 30S ribosomal protein S6 [Pseudonocardia dioxanivorans CB1190]
 gi|326955046|gb|AEA28743.1| 30S ribosomal protein S6 [Pseudonocardia dioxanivorans CB1190]
          Length = 109

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 55/94 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + ++ ++  + ++++ +GG V  V   G R +AY I KN +A Y
Sbjct: 4  MRHYEVMVILDPSLDERTVQPSLETFLNVVRTDGGSVEKVEVWGKRRLAYEIAKNAEAIY 63

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            + + + PA + E+ R++ ++E+VLR+  L  +
Sbjct: 64 AILEVTAEPATVAELDRQLGLNESVLRTKVLRRE 97


>gi|290959030|ref|YP_003490212.1| 30S ribosomal protein S6 [Streptomyces scabiei 87.22]
 gi|260648556|emb|CBG71667.1| putative 30S ribosomal protein S6 [Streptomyces scabiei 87.22]
          Length = 96

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R ++Y I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVAPLIENFLSVVREGNGKVEKVDTWGRRRLSYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPETH 96


>gi|158335092|ref|YP_001516264.1| 30S ribosomal protein S6 [Acaryochloris marina MBIC11017]
 gi|158305333|gb|ABW26950.1| 30S ribosomal protein S6 [Acaryochloris marina MBIC11017]
          Length = 108

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE +++LR D+  +Q+   I +YQ L++E G E       G R +AY I+  R+  Y
Sbjct: 1   MTAYETMYILRPDLGEEQLDQAINKYQDLLKEQGVEDIDTQHRGKRRLAYEIQNFREGVY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDR 112
           + MN      AI +++R+MRI E V+R LTL      + P       + D  
Sbjct: 61  IQMNYNGQGHAIAKLEREMRISEQVIRYLTLK----HEGPAANADEDESDSE 108


>gi|308273057|emb|CBX29661.1| 30S ribosomal protein S6 [uncultured Desulfobacterium sp.]
          Length = 149

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 62/134 (46%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE   ++  DI  +     + +   +I +  G +  +NE G + +AY I K  + +Y
Sbjct: 1   MRRYETTVIIDPDIPPENRAPLLEKINEIISQKDGFLVKLNEWGTQKLAYEISKKTRGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V ++       + EM+R  RID+ VL+ +T+L++ +     +  +  + +       +  
Sbjct: 61  VHLDFCGTGLLVSEMERFFRIDDRVLKFMTILLEKNVDIEKIKAKIAELEAEAASSAQMN 120

Query: 121 NVDRKQHVSEEKPL 134
             ++   +SEE   
Sbjct: 121 KSEKTDPISEENET 134


>gi|295106371|emb|CBL03914.1| SSU ribosomal protein S6P [Gordonibacter pamelaeae 7-10-1-b]
          Length = 97

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 46/97 (47%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE +F +   I  +     + + ++ I E  G V  V+  G R +AY I       Y
Sbjct: 1  MKAYELLFFVAPSIDEESRAAVMKRIETTIAEGEGTVDNVDNWGKRKLAYEIDGLTDGDY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97
            ++  + PA + E+ R +RI++ V+R + +     +
Sbjct: 61 TLIDFHADPANVAELDRVLRINDAVVRHMIVKRTDRD 97


>gi|242085884|ref|XP_002443367.1| hypothetical protein SORBIDRAFT_08g018320 [Sorghum bicolor]
 gi|241944060|gb|EES17205.1| hypothetical protein SORBIDRAFT_08g018320 [Sorghum bicolor]
          Length = 308

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 1/102 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V+L+ +D   + +++ + + Q  I+E  G +  VN  G+R +AY+I+K   A Y
Sbjct: 123 MRHYEVVYLIHEDRVEE-VENVVSKVQDFIREKKGRIWRVNNWGLRRLAYKIKKATHANY 181

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
           + MN       I++ K  +  DE V+R L +  D        
Sbjct: 182 ILMNFEIESRYINDFKTLLDKDERVIRHLVMKRDEAITEDCP 223


>gi|168013078|ref|XP_001759228.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162689541|gb|EDQ75912.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 271

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/101 (30%), Positives = 57/101 (56%), Gaps = 1/101 (0%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE +FL+  + + +++ D I + ++ + E  G++  VN+ G+R +AY+I+KN +A YV
Sbjct: 114 RHYEIMFLV-PESNLEKVPDVIKKVEAFVAEQKGKIWRVNDWGVRRLAYKIKKNERANYV 172

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
            MNI     AI+E+      DE V+R + +         T+
Sbjct: 173 LMNIEMKAEAINELNSLFEKDERVIRHMCISQKQAFTEDTV 213


>gi|134103771|ref|YP_001109432.1| 30S ribosomal protein S6 [Saccharopolyspora erythraea NRRL 2338]
 gi|166227379|sp|A4FR32|RS6_SACEN RecName: Full=30S ribosomal protein S6
 gi|133916394|emb|CAM06507.1| 30S ribosomal protein S6 [Saccharopolyspora erythraea NRRL 2338]
          Length = 118

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/93 (29%), Positives = 54/93 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++I+ +GG V  V+  G R +AY I K  +  Y
Sbjct: 1  MRHYELMVILDPSLDERTVAPSLENFLNVIRNDGGSVEKVDVWGRRRLAYEIDKQAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLV 93
          V +++ S PA++ E+ R++ ++E VLR+  L  
Sbjct: 61 VVLDLNSEPASVKELDRQLNLNETVLRTKVLRR 93


>gi|15675658|ref|NP_269832.1| 30S ribosomal protein S6 [Streptococcus pyogenes M1 GAS]
 gi|19746764|ref|NP_607900.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS8232]
 gi|21911118|ref|NP_665386.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS315]
 gi|28895197|ref|NP_801547.1| 30S ribosomal protein S6 [Streptococcus pyogenes SSI-1]
 gi|50914913|ref|YP_060885.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS10394]
 gi|71904204|ref|YP_281007.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS6180]
 gi|71911368|ref|YP_282918.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS5005]
 gi|94989190|ref|YP_597291.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS9429]
 gi|94991131|ref|YP_599231.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS10270]
 gi|94993077|ref|YP_601176.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS2096]
 gi|139473171|ref|YP_001127886.1| 30S ribosomal protein S6 [Streptococcus pyogenes str. Manfredo]
 gi|209559925|ref|YP_002286397.1| 30S ribosomal protein S6 [Streptococcus pyogenes NZ131]
 gi|251783275|ref|YP_002997580.1| 30S ribosomal protein S6 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
 gi|306826728|ref|ZP_07460030.1| 30S ribosomal protein S6 [Streptococcus pyogenes ATCC 10782]
 gi|54039535|sp|P66600|RS6_STRP3 RecName: Full=30S ribosomal protein S6
 gi|54039536|sp|P66601|RS6_STRP8 RecName: Full=30S ribosomal protein S6
 gi|54041978|sp|P66599|RS6_STRP1 RecName: Full=30S ribosomal protein S6
 gi|61216147|sp|Q5XA61|RS6_STRP6 RecName: Full=30S ribosomal protein S6
 gi|91207794|sp|Q48RK8|RS6_STRPM RecName: Full=30S ribosomal protein S6
 gi|166227389|sp|Q1JA29|RS6_STRPB RecName: Full=30S ribosomal protein S6
 gi|166227390|sp|Q1JK76|RS6_STRPC RecName: Full=30S ribosomal protein S6
 gi|166227391|sp|Q1JF72|RS6_STRPD RecName: Full=30S ribosomal protein S6
 gi|166227392|sp|A2RCR4|RS6_STRPG RecName: Full=30S ribosomal protein S6
 gi|226695292|sp|B5XI40|RS6_STRPZ RecName: Full=30S ribosomal protein S6
 gi|13622870|gb|AAK34553.1| 30S ribosomal protein S6 [Streptococcus pyogenes M1 GAS]
 gi|19748995|gb|AAL98399.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS8232]
 gi|21905328|gb|AAM80189.1| 30S ribosomal protein S6 [Streptococcus pyogenes MGAS315]
 gi|28810443|dbj|BAC63380.1| 30S ribosomal protein S6 [Streptococcus pyogenes SSI-1]
 gi|50903987|gb|AAT87702.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS10394]
 gi|71803299|gb|AAX72652.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS6180]
 gi|71854150|gb|AAZ52173.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS5005]
 gi|94542698|gb|ABF32747.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS9429]
 gi|94544639|gb|ABF34687.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS10270]
 gi|94546585|gb|ABF36632.1| SSU ribosomal protein S6P [Streptococcus pyogenes MGAS2096]
 gi|134271417|emb|CAM29637.1| 30S ribosomal protein S6 [Streptococcus pyogenes str. Manfredo]
 gi|209541126|gb|ACI61702.1| SSU ribosomal protein S6p [Streptococcus pyogenes NZ131]
 gi|242391907|dbj|BAH82366.1| 30S ribosomal protein S6 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
 gi|304431017|gb|EFM34024.1| 30S ribosomal protein S6 [Streptococcus pyogenes ATCC 10782]
 gi|322412658|gb|EFY03566.1| 30S ribosomal protein S6 [Streptococcus dysgalactiae subsp.
          dysgalactiae ATCC 27957]
 gi|323127999|gb|ADX25296.1| 30S ribosomal protein S6 [Streptococcus dysgalactiae subsp.
          equisimilis ATCC 12394]
          Length = 96

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE ++++R +I  +     + ++ S++ +NG  V    +   R +AY I   R+  Y
Sbjct: 1  MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEINDFREGLY 60

Query: 61 VFMNIAS-PPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N+ +   AA++E  R  +I+ ++LR + + +D
Sbjct: 61 HIVNLEATDAAALNEFDRLSKINGDILRHMIVKLD 95


>gi|295837783|ref|ZP_06824716.1| ribosomal protein S6 [Streptomyces sp. SPB74]
 gi|302520487|ref|ZP_07272829.1| ribosomal protein S6 [Streptomyces sp. SPB78]
 gi|318058996|ref|ZP_07977719.1| 30S ribosomal protein S6 [Streptomyces sp. SA3_actG]
 gi|318075522|ref|ZP_07982854.1| 30S ribosomal protein S6 [Streptomyces sp. SA3_actF]
 gi|333025746|ref|ZP_08453810.1| putative 30S ribosomal protein S6 [Streptomyces sp. Tu6071]
 gi|197698941|gb|EDY45874.1| ribosomal protein S6 [Streptomyces sp. SPB74]
 gi|302429382|gb|EFL01198.1| ribosomal protein S6 [Streptomyces sp. SPB78]
 gi|332745598|gb|EGJ76039.1| putative 30S ribosomal protein S6 [Streptomyces sp. Tu6071]
          Length = 96

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 56/96 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R ++Y I K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERSVAPLIESFLSVVREADGKVEKVDTWGRRRLSYEINKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA I E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVIKELDRQMNLNESVLRTKVLRPETH 96


>gi|296274357|ref|YP_003656988.1| 30S ribosomal protein S6 [Arcobacter nitrofigilis DSM 7299]
 gi|296098531|gb|ADG94481.1| ribosomal protein S6 [Arcobacter nitrofigilis DSM 7299]
          Length = 120

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/107 (27%), Positives = 63/107 (58%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           K YE +F+++  ++ ++    I   ++ I++NGGE+   +++G R +AY I K+++ +Y 
Sbjct: 5   KHYETMFIVKPTMTEEETVAQIELVKANIEKNGGEIVSFDDMGTRQLAYEIEKHKRGHYY 64

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHD 108
            M   +P  +I E++R  RI+EN++R + +  +S ++    T    +
Sbjct: 65  VMYFRAPTTSILELERNYRINENIIRFIFIKYESKKEVTAWTKLSDE 111


>gi|237739059|ref|ZP_04569540.1| SSU ribosomal protein S6P [Fusobacterium sp. 2_1_31]
 gi|291460851|ref|ZP_06025541.2| ribosomal protein S6 [Fusobacterium periodonticum ATCC 33693]
 gi|294783935|ref|ZP_06749257.1| ribosomal protein S6 [Fusobacterium sp. 1_1_41FAA]
 gi|229423659|gb|EEO38706.1| SSU ribosomal protein S6P [Fusobacterium sp. 2_1_31]
 gi|291380409|gb|EFE87927.1| ribosomal protein S6 [Fusobacterium periodonticum ATCC 33693]
 gi|294479747|gb|EFG27526.1| ribosomal protein S6 [Fusobacterium sp. 1_1_41FAA]
          Length = 105

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 46/94 (48%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE ++++   +  +   + I Q  SL+  NG  +    + G R +AY I K +  +Y
Sbjct: 12  MKKYEIMYIINPTVLEEGRDELINQINSLLTANGATIAKTEKWGERKLAYPIDKKKSGFY 71

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           V          + E++ K+ I E V+R + + +D
Sbjct: 72  VLTTFEMDGTKLAEVEAKINIMEAVMRHIVVRLD 105


>gi|54027546|ref|YP_121788.1| 30S ribosomal protein S6 [Nocardia farcinica IFM 10152]
 gi|61215419|sp|Q5YN17|RS6_NOCFA RecName: Full=30S ribosomal protein S6
 gi|54019054|dbj|BAD60424.1| putative ribosomal protein S6 [Nocardia farcinica IFM 10152]
          Length = 95

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 54/95 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++     +++  GG++  V+  G R +AY IRK  +  Y
Sbjct: 1  MRHYEVMVILDPSLDERTVGPSLENMLGVVKTEGGKIDKVDIWGRRRLAYEIRKQAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +++ + PA ++E+ R++ ++E+VLR+  L  D 
Sbjct: 61 AVIDLTASPATVNELDRQLGLNESVLRTKVLRHDK 95


>gi|254413827|ref|ZP_05027596.1| ribosomal protein S6 [Microcoleus chthonoplastes PCC 7420]
 gi|196179424|gb|EDX74419.1| ribosomal protein S6 [Microcoleus chthonoplastes PCC 7420]
          Length = 109

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 56/89 (62%)

Query: 4  YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
          YE +++LR D+S +Q+   + +Y+ L+QE GGE   +   G R +AY I ++R+  Y+ M
Sbjct: 5  YEMMYILRPDMSEEQVNQAVTKYKDLLQEQGGEEIEIQHRGKRRLAYPIERHREGVYIQM 64

Query: 64 NIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          N  +PP  + +++R MR  + V+R LTL 
Sbjct: 65 NYKAPPIHVAQLQRAMRYGDEVIRYLTLK 93


>gi|182437467|ref|YP_001825186.1| 30S ribosomal protein S6 [Streptomyces griseus subsp. griseus
          NBRC 13350]
 gi|326778122|ref|ZP_08237387.1| 30S ribosomal protein S6 [Streptomyces cf. griseus XylebKG-1]
 gi|226695288|sp|B1VPC4|RS6_STRGG RecName: Full=30S ribosomal protein S6
 gi|178465983|dbj|BAG20503.1| putative 30S ribosomal protein S6 [Streptomyces griseus subsp.
          griseus NBRC 13350]
 gi|326658455|gb|EGE43301.1| 30S ribosomal protein S6 [Streptomyces cf. griseus XylebKG-1]
          Length = 96

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 56/96 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVSPLIENFLSVVREGDGKVEKVDTWGRRRLAYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  + H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPEVH 96


>gi|29830832|ref|NP_825466.1| 30S ribosomal protein S6 [Streptomyces avermitilis MA-4680]
 gi|61216299|sp|Q82FG4|RS6_STRAW RecName: Full=30S ribosomal protein S6
 gi|29607945|dbj|BAC72001.1| putative ribosomal protein S6 [Streptomyces avermitilis MA-4680]
 gi|320009724|gb|ADW04574.1| ribosomal protein S6 [Streptomyces flavogriseus ATCC 33331]
          Length = 96

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R ++Y I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVSPLIENFLSVVREGNGKVEKVDTWGRRRLSYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPETH 96


>gi|262372196|ref|ZP_06065475.1| ribosomal protein S6 [Acinetobacter junii SH205]
 gi|262312221|gb|EEY93306.1| ribosomal protein S6 [Acinetobacter junii SH205]
          Length = 127

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 62/129 (48%), Gaps = 2/129 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y S I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E++   R ++ ++R++ +  +      +L  +  + + R  +  R+ 
Sbjct: 60  ILMNVECGQTTLDELEELFRYNDAIIRNIIIRREHAITEESLLAKSAE-EKRARKAQREE 118

Query: 121 NVDRKQHVS 129
                Q   
Sbjct: 119 AQQAIQEAE 127


>gi|239624858|ref|ZP_04667889.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47_FAA]
 gi|239521244|gb|EEQ61110.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47FAA]
          Length = 95

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/94 (30%), Positives = 47/94 (50%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE   +L   +   Q    + + +  I   GG V  V+E G + +AY I+K  +A+Y
Sbjct: 1  MNKYELTVVLNVKLEDDQRAAALEKVKGYITRFGGTVTNVDEWGKKRLAYEIQKMHEAFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           F+   S     +E++  +RI E V+R L + VD
Sbjct: 61 YFIQFESDSVCPNEVEAHIRIMEPVIRYLCVRVD 94


>gi|218245582|ref|YP_002370953.1| 30S ribosomal protein S6 [Cyanothece sp. PCC 8801]
 gi|226703449|sp|B7JXP0|RS6_CYAP8 RecName: Full=30S ribosomal protein S6
 gi|218166060|gb|ACK64797.1| ribosomal protein S6 [Cyanothece sp. PCC 8801]
          Length = 124

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/97 (27%), Positives = 49/97 (50%)

Query: 4   YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
           YE +++LR  +S +Q+   + +Y+  + E   +   V   G R +AY I++     YV M
Sbjct: 5   YEMIYILRPSLSEEQVNQEVNKYRDFLNEYNVKDLQVKIWGKRRLAYPIKRFIDGIYVQM 64

Query: 64  NIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
           N       +  ++R MR+ E V+R +TL V++     
Sbjct: 65  NYQGEGNQVAPLERAMRLSEEVIRYMTLKVETAVSET 101


>gi|50085515|ref|YP_047025.1| 30S ribosomal protein S6 [Acinetobacter sp. ADP1]
 gi|61215532|sp|Q6F9R0|RS6_ACIAD RecName: Full=30S ribosomal protein S6
 gi|49531491|emb|CAG69203.1| 30S ribosomal protein S6 [Acinetobacter sp. ADP1]
          Length = 128

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 62/129 (48%), Gaps = 2/129 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y S I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSDQVVGMVERYISQIKEADGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E++   R ++ ++R++ +  +      +L  +  + + R  +  R+ 
Sbjct: 60  ILMNVECGQTTLDELEELFRYNDAIIRNIIIRREHAITEESLLAKSAE-EKRARKAQREE 118

Query: 121 NVDRKQHVS 129
               +    
Sbjct: 119 AQQIQDSAE 127


>gi|138897056|ref|YP_001127509.1| 30S ribosomal protein S6 [Geobacillus thermodenitrificans NG80-2]
 gi|134268569|gb|ABO68764.1| Ribosomal protein S6 (BS9) [Geobacillus thermodenitrificans
          NG80-2]
          Length = 98

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 55/94 (58%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE ++++R ++  +  +  + ++ ++++E G E+  V + G R +AY I K R  YY+
Sbjct: 5  RKYEIMYIIRPNMDDEARQAVVERFNNVLKEKGAEITNVTDWGKRRLAYEIEKYRDGYYM 64

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           +N+ + P A+ E  R  RI E+++R + +  + 
Sbjct: 65 ILNVMAEPQAVQEFDRLARISEDIIRHIVVKEEK 98


>gi|328906634|gb|EGG26409.1| 30S ribosomal protein S6 [Propionibacterium sp. P08]
          Length = 96

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 51/96 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + ++   +  +Q+   + +Y  +I +  G V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRKYEVMIIVDPTVEERQVDSLMEKYLKVITDEKGTVGNVDVWGKRRLAYDIQKKSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
          V +N    PA I EM R + IDE ++R+  +  + H
Sbjct: 61 VVVNATCEPATIQEMDRLLAIDEKIMRTKVMRPEIH 96


>gi|226952677|ref|ZP_03823141.1| 30S ribosomal protein S6 [Acinetobacter sp. ATCC 27244]
 gi|294649991|ref|ZP_06727379.1| 30S ribosomal protein S6 [Acinetobacter haemolyticus ATCC 19194]
 gi|226836583|gb|EEH68966.1| 30S ribosomal protein S6 [Acinetobacter sp. ATCC 27244]
 gi|292824084|gb|EFF82899.1| 30S ribosomal protein S6 [Acinetobacter haemolyticus ATCC 19194]
          Length = 127

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 62/129 (48%), Gaps = 2/129 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V L+  D  S Q+   + +Y S I+E  G++  + + G R +AY I K  KA+Y
Sbjct: 1   MRHYEIVLLVHPD-QSDQVVGMVERYISQIKEAEGQIHRLEDWGRRQLAYPINKIHKAHY 59

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           + MN+      + E++   R ++ ++R++ +  +      +L  +  + + R  +  R+ 
Sbjct: 60  ILMNVECGQTTLDELEELFRYNDAIIRNIIIRREHAITEESLLAKSAE-EKRARKAQREE 118

Query: 121 NVDRKQHVS 129
                Q   
Sbjct: 119 AQQAVQEAE 127


>gi|332654783|ref|ZP_08420525.1| ribosomal protein S6 [Ruminococcaceae bacterium D16]
 gi|332516126|gb|EGJ45734.1| ribosomal protein S6 [Ruminococcaceae bacterium D16]
          Length = 98

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 1/93 (1%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
            YE +++L   +S + I   + +++++++ N G V  ++E G R +AY I    + YYV
Sbjct: 6  ANYEAMYILDPALSEEAIAALVAKFKAVVEAN-GTVSEIDEWGKRRLAYPINDLMEGYYV 64

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           M   +  A   E+ R  RI + V+RSL +  D
Sbjct: 65 LMTFNAAAAIPAELDRIFRITDGVMRSLIVCKD 97


>gi|310644857|ref|YP_003949616.1| 30S ribosomal protein s6 [Paenibacillus polymyxa SC2]
 gi|309249808|gb|ADO59375.1| 30S ribosomal protein S6 [Paenibacillus polymyxa SC2]
          Length = 94

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R DI  + ++ T+ ++Q +I   GGE+   +    R +AY I+K R   +
Sbjct: 1  MRKYEVMYIIRPDIEQEAVQATVDKFQGIISNGGGEITNHDVT-KRRLAYEIKKFRDGSF 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLT 90
          V +N  + PA + E++R M+I + V+R L 
Sbjct: 60 VLVNFTAEPAVVTELERIMKISDEVIRYLI 89


>gi|329944678|ref|ZP_08292788.1| ribosomal protein S6 [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328530092|gb|EGF56978.1| ribosomal protein S6 [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 95

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 51/94 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  +   +    T+ +   ++  NGG V  V+  G R +AY I+K  + +Y
Sbjct: 1  MRHYEIMIILDPETDERTANATLEKLLQVVPSNGGTVDKVDIWGKRRLAYDIKKKSEGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V +++ + P    E+ R++ ++E VLR+  L  +
Sbjct: 61 VVVDMTTTPETAQELDRQLGLNETVLRTKLLRPE 94


>gi|50843665|ref|YP_056892.1| 30S ribosomal protein S6 [Propionibacterium acnes KPA171202]
 gi|282854510|ref|ZP_06263846.1| ribosomal protein S6 [Propionibacterium acnes J139]
 gi|289425921|ref|ZP_06427673.1| ribosomal protein S6 [Propionibacterium acnes SK187]
 gi|289428181|ref|ZP_06429880.1| ribosomal protein S6 [Propionibacterium acnes J165]
 gi|295131753|ref|YP_003582416.1| ribosomal protein S6 [Propionibacterium acnes SK137]
 gi|61216184|sp|Q6A5M9|RS6_PROAC RecName: Full=30S ribosomal protein S6
 gi|50841267|gb|AAT83934.1| 30S ribosomal protein S6 [Propionibacterium acnes KPA171202]
 gi|282582371|gb|EFB87752.1| ribosomal protein S6 [Propionibacterium acnes J139]
 gi|289153697|gb|EFD02406.1| ribosomal protein S6 [Propionibacterium acnes SK187]
 gi|289158661|gb|EFD06865.1| ribosomal protein S6 [Propionibacterium acnes J165]
 gi|291375975|gb|ADD99829.1| ribosomal protein S6 [Propionibacterium acnes SK137]
 gi|313765163|gb|EFS36527.1| ribosomal protein S6 [Propionibacterium acnes HL013PA1]
 gi|313771569|gb|EFS37535.1| ribosomal protein S6 [Propionibacterium acnes HL074PA1]
 gi|313794141|gb|EFS42161.1| ribosomal protein S6 [Propionibacterium acnes HL110PA1]
 gi|313803264|gb|EFS44460.1| ribosomal protein S6 [Propionibacterium acnes HL110PA2]
 gi|313808597|gb|EFS47057.1| ribosomal protein S6 [Propionibacterium acnes HL087PA2]
 gi|313811967|gb|EFS49681.1| ribosomal protein S6 [Propionibacterium acnes HL083PA1]
 gi|313813949|gb|EFS51663.1| ribosomal protein S6 [Propionibacterium acnes HL025PA1]
 gi|313817113|gb|EFS54827.1| ribosomal protein S6 [Propionibacterium acnes HL059PA1]
 gi|313819058|gb|EFS56772.1| ribosomal protein S6 [Propionibacterium acnes HL046PA2]
 gi|313821663|gb|EFS59377.1| ribosomal protein S6 [Propionibacterium acnes HL036PA1]
 gi|313823799|gb|EFS61513.1| ribosomal protein S6 [Propionibacterium acnes HL036PA2]
 gi|313826903|gb|EFS64617.1| ribosomal protein S6 [Propionibacterium acnes HL063PA1]
 gi|313829274|gb|EFS66988.1| ribosomal protein S6 [Propionibacterium acnes HL063PA2]
 gi|313832400|gb|EFS70114.1| ribosomal protein S6 [Propionibacterium acnes HL007PA1]
 gi|313834167|gb|EFS71881.1| ribosomal protein S6 [Propionibacterium acnes HL056PA1]
 gi|313839205|gb|EFS76919.1| ribosomal protein S6 [Propionibacterium acnes HL086PA1]
 gi|314916832|gb|EFS80663.1| ribosomal protein S6 [Propionibacterium acnes HL005PA4]
 gi|314919009|gb|EFS82840.1| ribosomal protein S6 [Propionibacterium acnes HL050PA1]
 gi|314921160|gb|EFS84991.1| ribosomal protein S6 [Propionibacterium acnes HL050PA3]
 gi|314921992|gb|EFS85823.1| ribosomal protein S6 [Propionibacterium acnes HL001PA1]
 gi|314926139|gb|EFS89970.1| ribosomal protein S6 [Propionibacterium acnes HL036PA3]
 gi|314932493|gb|EFS96324.1| ribosomal protein S6 [Propionibacterium acnes HL067PA1]
 gi|314956278|gb|EFT00650.1| ribosomal protein S6 [Propionibacterium acnes HL027PA1]
 gi|314958672|gb|EFT02774.1| ribosomal protein S6 [Propionibacterium acnes HL002PA1]
 gi|314960978|gb|EFT05079.1| ribosomal protein S6 [Propionibacterium acnes HL002PA2]
 gi|314964038|gb|EFT08138.1| ribosomal protein S6 [Propionibacterium acnes HL082PA1]
 gi|314965949|gb|EFT10048.1| ribosomal protein S6 [Propionibacterium acnes HL082PA2]
 gi|314968802|gb|EFT12900.1| ribosomal protein S6 [Propionibacterium acnes HL037PA1]
 gi|314975066|gb|EFT19161.1| ribosomal protein S6 [Propionibacterium acnes HL053PA1]
 gi|314977477|gb|EFT21572.1| ribosomal protein S6 [Propionibacterium acnes HL045PA1]
 gi|314979065|gb|EFT23159.1| ribosomal protein S6 [Propionibacterium acnes HL072PA2]
 gi|314980728|gb|EFT24822.1| ribosomal protein S6 [Propionibacterium acnes HL110PA3]
 gi|314985855|gb|EFT29947.1| ribosomal protein S6 [Propionibacterium acnes HL005PA1]
 gi|314989264|gb|EFT33355.1| ribosomal protein S6 [Propionibacterium acnes HL005PA3]
 gi|315078284|gb|EFT50323.1| ribosomal protein S6 [Propionibacterium acnes HL053PA2]
 gi|315081410|gb|EFT53386.1| ribosomal protein S6 [Propionibacterium acnes HL078PA1]
 gi|315084950|gb|EFT56926.1| ribosomal protein S6 [Propionibacterium acnes HL027PA2]
 gi|315087480|gb|EFT59456.1| ribosomal protein S6 [Propionibacterium acnes HL002PA3]
 gi|315089612|gb|EFT61588.1| ribosomal protein S6 [Propionibacterium acnes HL072PA1]
 gi|315090953|gb|EFT62929.1| ribosomal protein S6 [Propionibacterium acnes HL110PA4]
 gi|315095176|gb|EFT67152.1| ribosomal protein S6 [Propionibacterium acnes HL060PA1]
 gi|315096893|gb|EFT68869.1| ribosomal protein S6 [Propionibacterium acnes HL038PA1]
 gi|315100047|gb|EFT72023.1| ribosomal protein S6 [Propionibacterium acnes HL059PA2]
 gi|315102793|gb|EFT74769.1| ribosomal protein S6 [Propionibacterium acnes HL046PA1]
 gi|315105295|gb|EFT77271.1| ribosomal protein S6 [Propionibacterium acnes HL050PA2]
 gi|315107347|gb|EFT79323.1| ribosomal protein S6 [Propionibacterium acnes HL030PA1]
 gi|315110505|gb|EFT82481.1| ribosomal protein S6 [Propionibacterium acnes HL030PA2]
 gi|327328805|gb|EGE70565.1| ribosomal protein S6 [Propionibacterium acnes HL103PA1]
 gi|327332996|gb|EGE74728.1| ribosomal protein S6 [Propionibacterium acnes HL096PA2]
 gi|327333988|gb|EGE75703.1| ribosomal protein S6 [Propionibacterium acnes HL096PA3]
 gi|327334407|gb|EGE76118.1| ribosomal protein S6 [Propionibacterium acnes HL097PA1]
 gi|327448704|gb|EGE95358.1| ribosomal protein S6 [Propionibacterium acnes HL043PA1]
 gi|327449104|gb|EGE95758.1| ribosomal protein S6 [Propionibacterium acnes HL043PA2]
 gi|327450361|gb|EGE97015.1| ribosomal protein S6 [Propionibacterium acnes HL013PA2]
 gi|327455520|gb|EGF02175.1| ribosomal protein S6 [Propionibacterium acnes HL087PA3]
 gi|327456175|gb|EGF02830.1| ribosomal protein S6 [Propionibacterium acnes HL083PA2]
 gi|327457574|gb|EGF04229.1| ribosomal protein S6 [Propionibacterium acnes HL092PA1]
 gi|328756816|gb|EGF70432.1| ribosomal protein S6 [Propionibacterium acnes HL087PA1]
 gi|328757704|gb|EGF71320.1| ribosomal protein S6 [Propionibacterium acnes HL020PA1]
 gi|328759099|gb|EGF72715.1| ribosomal protein S6 [Propionibacterium acnes HL025PA2]
 gi|328762208|gb|EGF75704.1| ribosomal protein S6 [Propionibacterium acnes HL099PA1]
 gi|332676617|gb|AEE73433.1| 30S ribosomal protein S6 [Propionibacterium acnes 266]
          Length = 96

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 51/96 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + ++   +  +Q+   + +Y  +I +  G V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRKYEVMIIIDPTVEERQVDSLMEKYLKVITDEKGTVDNVDVWGKRRLAYDIQKKSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
          V +N    PA I E+ R + IDE ++R+  +  + H
Sbjct: 61 VVVNATCEPATIQELDRLLAIDEKIMRTKVMRPEIH 96


>gi|116750609|ref|YP_847296.1| 30S ribosomal protein S6 [Syntrophobacter fumaroxidans MPOB]
 gi|166227396|sp|A0LN59|RS6_SYNFM RecName: Full=30S ribosomal protein S6
 gi|116699673|gb|ABK18861.1| SSU ribosomal protein S6P [Syntrophobacter fumaroxidans MPOB]
          Length = 147

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 3/125 (2%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE  F++  D+  +       + +S++  NGG+V      G + +AY ++K  +  Y
Sbjct: 1   MRKYETFFIIDPDLPDEVTAAVDEKIKSVVGANGGDVVSYVPWGKKKLAYPVKKRSRGLY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V M  A     + E++R MR+DE VL+ +T+ +D          +          FP D 
Sbjct: 61  VLMEYAGDSRLVAELERNMRLDERVLKFITVKLDDRYD---PEKEAARMAANLPSFPEDE 117

Query: 121 NVDRK 125
           + + K
Sbjct: 118 DTEEK 122


>gi|288554589|ref|YP_003426524.1| 30S ribosomal protein S6 [Bacillus pseudofirmus OF4]
 gi|288545749|gb|ADC49632.1| 30S ribosomal protein S6 [Bacillus pseudofirmus OF4]
          Length = 95

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/95 (29%), Positives = 54/95 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++  ++     K+ I ++  ++  NG EV  V E+G R +AY I   R+ +Y
Sbjct: 1  MRKYEIMYIIAPNLEESANKEIIERFNGVLTSNGAEVEKVEEMGKRRLAYEINDYREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V +++ +   AI E  R ++I++NV+R L    + 
Sbjct: 61 VLLSVQANSEAIAEFNRLIKINDNVIRVLITKDEE 95


>gi|332710818|ref|ZP_08430755.1| SSU ribosomal protein S6P [Lyngbya majuscula 3L]
 gi|332350371|gb|EGJ29974.1| SSU ribosomal protein S6P [Lyngbya majuscula 3L]
          Length = 102

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 54/88 (61%)

Query: 7  VFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIA 66
          +++LR D+  +Q+   IG+Y+ L+QE GGE   +   G R +AY I + R+  Y+ MN  
Sbjct: 1  MYILRPDLGEEQVDQAIGKYRDLLQELGGEQIEIQHRGKRRLAYPIDRYREGIYIQMNYN 60

Query: 67 SPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           P   + +++R MR+ ++V+R LT+  +
Sbjct: 61 GPGTHVAKIERAMRLSQDVIRYLTIRQE 88


>gi|224368966|ref|YP_002603130.1| 30S ribosomal protein S6 [Desulfobacterium autotrophicum HRM2]
 gi|259495330|sp|C0QBV4|RS6_DESAH RecName: Full=30S ribosomal protein S6
 gi|223691683|gb|ACN14966.1| RpsF [Desulfobacterium autotrophicum HRM2]
          Length = 155

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/154 (18%), Positives = 66/154 (42%), Gaps = 22/154 (14%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M++YE +F+   D+  +       +++ ++++ GG +   ++ G + +AY I K  + +Y
Sbjct: 1   MRMYETIFITDPDLQDEVRNTLFDRFKGILEQEGGILANFDDWGNKKLAYEIAKKPRGHY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ--------------- 105
           V M        + E++R  R+D+ +L+ +T+L++       L +Q               
Sbjct: 61  VCMTYGGTGTLVTELERNFRLDDKILKYMTILLEKDIDPEALKLQIDAEAAAKSEADAAK 120

Query: 106 -------RHDRDDRNDRFPRDRNVDRKQHVSEEK 132
                        + +    D  VD +   +EE+
Sbjct: 121 AEADAARVEAEAKKAETDETDETVDAETPENEEE 154


>gi|326492696|dbj|BAJ90204.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 303

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/135 (24%), Positives = 59/135 (43%), Gaps = 7/135 (5%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V+L+ +D   + ++D + + Q  I+E  G +  VN  G+R +AY+I+K   A Y
Sbjct: 118 MRHYEVVYLIHEDRVEE-VEDVVSKVQDFIREKKGRIWRVNNWGLRRLAYKIKKATHANY 176

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL------TIQRHDRDDRND 114
           + MN      +I++ K  +  DE ++R L +  D               ++    DD   
Sbjct: 177 ILMNFEIQAQSINDFKTLLDKDERIIRHLVMKRDEAITEDCPPPPEFHAMRSQQLDDEYI 236

Query: 115 RFPRDRNVDRKQHVS 129
                +  D      
Sbjct: 237 DEEYGKADDADDEAE 251


>gi|311115043|ref|YP_003986264.1| 30S ribosomal protein S6 [Gardnerella vaginalis ATCC 14019]
 gi|310946537|gb|ADP39241.1| 30S ribosomal protein S6 [Gardnerella vaginalis ATCC 14019]
          Length = 131

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 47/92 (51%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
            YE +F+   ++  + +K    QY  L+ + GG V   +  G R +AY I    +  YV 
Sbjct: 38  KYELMFIADPELDERGLKKLTEQYLELVTKEGGSVDGTDYWGRRKLAYEIDGKTEGNYVV 97

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           +N  + PA   E+ R + ++E+V+R+  L  D
Sbjct: 98  VNYTAEPALSDELDRVLNLNESVVRTKILRKD 129


>gi|257057876|ref|YP_003135708.1| 30S ribosomal protein S6P [Saccharomonospora viridis DSM 43017]
 gi|256587748|gb|ACU98881.1| SSU ribosomal protein S6P [Saccharomonospora viridis DSM 43017]
          Length = 111

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 49/92 (53%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE + +L   +  + +  T+  +  +I+ +GG V  V+  G R +AY I K+ +  Y 
Sbjct: 3  RHYEIMVILDPSLDERTVAPTLENFLQVIRSSGGTVEKVDVWGRRRLAYDIGKHSEGIYA 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLV 93
           + + + P A+ E+ R++ + E V+R+  +  
Sbjct: 63 VLELYAEPEAVSELDRQLSLQETVMRTKVIRR 94


>gi|254499289|ref|ZP_05111963.1| 30S ribosomal protein S6 [Legionella drancourtii LLAP12]
 gi|254351486|gb|EET10347.1| 30S ribosomal protein S6 [Legionella drancourtii LLAP12]
          Length = 106

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 54/103 (52%), Gaps = 1/103 (0%)

Query: 7   VFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIA 66
           +FL+  D  S+Q+   + +Y+ +I ++ G +    +LG R +AY I    KA+Y  MNI 
Sbjct: 1   MFLVHPD-QSEQVPAMVERYEGIISKHSGLIHRKEDLGRRQLAYPINDVHKAHYYLMNIE 59

Query: 67  SPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDR 109
               A+ E+K   + ++ +LR+L  +      + ++ +++   
Sbjct: 60  CSLEALEEIKNAFKFNDAILRNLITVQKQAITTESVLMKKEKE 102


>gi|222823952|ref|YP_002575526.1| 30S ribosomal protein S6 [Campylobacter lari RM2100]
 gi|254765227|sp|B9KCI6|RS6_CAMLR RecName: Full=30S ribosomal protein S6
 gi|222539174|gb|ACM64275.1| 30S ribosomal protein S6 [Campylobacter lari RM2100]
          Length = 124

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 59/123 (47%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE +F+L+  ++ +++   +   + ++ +NG E+  V  +G R +AY+I+K  +  Y
Sbjct: 1   MRHYEVLFILKPTLTEEEVSAKLEFVKEVLTKNGAEIESVVPMGTRKLAYKIKKYERGTY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
             +   +P   I E++R +RI E V+R L +  ++ ++                      
Sbjct: 61  FVIYFKAPTNLIAELERVLRITEEVIRFLIVKYENKKEIAAWEKLSKGIKQNKKEIKASE 120

Query: 121 NVD 123
           + +
Sbjct: 121 STE 123


>gi|308071627|ref|YP_003873232.1| 30S ribosomal protein S6 [Paenibacillus polymyxa E681]
 gi|305860906|gb|ADM72694.1| 30S ribosomal protein S6 [Paenibacillus polymyxa E681]
          Length = 94

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 54/90 (60%), Gaps = 1/90 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R DI  + ++ T+ ++Q +I   GGE+   +    R +AY I+K R   +
Sbjct: 1  MRKYEAMYIIRPDIEQEAVQATVDKFQGIISNGGGEITSHDVT-KRRLAYEIKKFRDGSF 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLT 90
          V +N  + PA + E++R M+I + V+R L 
Sbjct: 60 VLVNFTAEPAVVTELERIMKISDEVIRYLI 89


>gi|172059040|ref|YP_001815500.1| 30S ribosomal protein S6 [Exiguobacterium sibiricum 255-15]
 gi|226703468|sp|B1YG99|RS6_EXIS2 RecName: Full=30S ribosomal protein S6
 gi|171991561|gb|ACB62483.1| ribosomal protein S6 [Exiguobacterium sibiricum 255-15]
          Length = 95

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 55/95 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R ++  +  K  + ++  ++ +NGG V    E+G R  AY I   R+ +Y
Sbjct: 1  MRKYEVLYIIRPEVDEEARKALVERFNKVLTDNGGTVEKTTEMGKRRFAYEINDMREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V +N+ + PAA  E+ R M+I ++++R +    + 
Sbjct: 61 VLLNVTAEPAATKELDRLMKISDDIVRLMITKDEK 95


>gi|290968077|ref|ZP_06559626.1| ribosomal protein S6 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781983|gb|EFD94562.1| ribosomal protein S6 [Megasphaera genomosp. type_1 str. 28L]
          Length = 94

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/95 (30%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +F+ R  +  + +K  I    +L+++NG +V  +   G R +AY ++K    YY
Sbjct: 1  MNKYEVMFIARP-LEDEAVKPIIEFVDALLKKNGAKVEKIEPWGKRHLAYPVKKQNDGYY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V +N  + P  I E+ R M+I + +L+ L + +D 
Sbjct: 60 VLVNFEAEPDIIKEIDRVMKIRDEILKQLIVKIDE 94


>gi|269129132|ref|YP_003302502.1| 30S ribosomal protein S6 [Thermomonospora curvata DSM 43183]
 gi|268314090|gb|ACZ00465.1| ribosomal protein S6 [Thermomonospora curvata DSM 43183]
          Length = 96

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 55/96 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   I  + +  ++ Q+ S+++  GG V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRRYEVMVILDPSIEERAVAPSLDQFLSVVKNGGGTVEKVDIWGRRRLAYDIQKKSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R++ + E+VLR+  +  + H
Sbjct: 61 AVVDLTAEPAVVKELDRQLNLSESVLRTKVIRPEVH 96


>gi|224099095|ref|XP_002311372.1| predicted protein [Populus trichocarpa]
 gi|222851192|gb|EEE88739.1| predicted protein [Populus trichocarpa]
          Length = 319

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 34/141 (24%), Positives = 60/141 (42%), Gaps = 11/141 (7%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE V+L+  +   +++     + Q  ++E  G +   N+ GMR +AY+I+K + A+Y+
Sbjct: 133 RHYEVVYLIH-EKHDEEVGSLNEKVQDFVREKKGRIWRFNDWGMRRLAYKIQKAKNAHYI 191

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL----------TIQRHDRDD 111
            MN       I++ K  +  DE V+R L +  D                   +  +D +D
Sbjct: 192 LMNFELEARWINDFKNMLDKDERVIRHLVIKRDEAITEDCPPPPEFHTLQGGMDNNDEED 251

Query: 112 RNDRFPRDRNVDRKQHVSEEK 132
             D    D   D    V  E 
Sbjct: 252 GLDYDDNDEAYDEDLEVEAEA 272


>gi|282863345|ref|ZP_06272404.1| ribosomal protein S6 [Streptomyces sp. ACTE]
 gi|282561680|gb|EFB67223.1| ribosomal protein S6 [Streptomyces sp. ACTE]
          Length = 96

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 56/96 (58%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R ++Y I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVSPLIENFLSVVREGNGKVEKVDTWGRRRLSYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  + H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPEVH 96


>gi|330978938|gb|EGH77997.1| 30S ribosomal protein S6 [Pseudomonas syringae pv. aptata str.
          DSM 50252]
          Length = 86

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1  MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61 VFMNIASPPAAIHEMKRKM 79
          V +N+     ++ E + ++
Sbjct: 60 VMLNVECTGKSLAEREEQL 78


>gi|149182310|ref|ZP_01860789.1| ribosomal protein S6 (BS9) [Bacillus sp. SG-1]
 gi|148850002|gb|EDL64173.1| ribosomal protein S6 (BS9) [Bacillus sp. SG-1]
          Length = 95

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 50/95 (52%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R ++  +  K  + ++ +++  NG E+    E G R +AY I   R  YY
Sbjct: 1  MRKYEVMYIIRPNVDDETKKAVVDRFDNVLTSNGAEIVESKEWGKRRLAYEINDFRDGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            + I S   A+ E  R  +I ++++R + +  + 
Sbjct: 61 QLVKIQSNNEAVSEFDRLAKISDDIIRHIVIKEEE 95


>gi|161611280|ref|YP_140168.2| 30S ribosomal protein S6 [Streptococcus thermophilus LMG 18311]
 gi|161936363|ref|YP_142087.2| 30S ribosomal protein S6 [Streptococcus thermophilus CNRZ1066]
 gi|91207795|sp|Q5LY48|RS6_STRT1 RecName: Full=30S ribosomal protein S6
 gi|91207796|sp|Q5M2Q3|RS6_STRT2 RecName: Full=30S ribosomal protein S6
          Length = 96

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE ++++R +I  +     + ++ S++ +NG  V    +   R +AY I+  R+  Y
Sbjct: 1  MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLY 60

Query: 61 VFMNIAS-PPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N+ +    A++E  R  +I+ ++LR + + +D
Sbjct: 61 HVVNVEANDATALNEFDRLSKINGDILRHMIVKLD 95


>gi|312135779|ref|YP_004003117.1| 30S ribosomal protein S6 [Caldicellulosiruptor owensensis OL]
 gi|311775830|gb|ADQ05317.1| ribosomal protein S6 [Caldicellulosiruptor owensensis OL]
          Length = 96

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 54/94 (57%), Gaps = 1/94 (1%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE VF++   +  +   + I ++++LI  N G++  V E G + +AY+I K+ + YYV
Sbjct: 4  RKYETVFIISPTLDDEARANLIEKFKNLISSN-GQLLTVEEWGKKRLAYKIDKHAEGYYV 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           M   S P    E++R  RI + V+R LT+ ++ 
Sbjct: 63 LMQFISKPEFPRELERVYRITDGVIRFLTVKLEK 96


>gi|289422468|ref|ZP_06424311.1| ribosomal protein S6 [Peptostreptococcus anaerobius 653-L]
 gi|289157040|gb|EFD05662.1| ribosomal protein S6 [Peptostreptococcus anaerobius 653-L]
          Length = 96

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 51/95 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE +++++  +  +  +  +   +++I E  GEV  V+  G R +AY I+K R   Y
Sbjct: 1  MKAYELLYIVKPTLDDEAREAVLESIKNIITEANGEVGEVDVWGSRKLAYPIQKFRDGVY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N  +      E+ R+++I E+V+R + +  D 
Sbjct: 61 TLVNFKATVDFPKELDRRLKISEDVIRHIIVAQDE 95


>gi|116628446|ref|YP_821065.1| 30S ribosomal protein S6 [Streptococcus thermophilus LMD-9]
 gi|122266959|sp|Q03IV3|RS6_STRTD RecName: Full=30S ribosomal protein S6
 gi|116101723|gb|ABJ66869.1| SSU ribosomal protein S6P [Streptococcus thermophilus LMD-9]
 gi|312279066|gb|ADQ63723.1| 30S ribosomal protein S6 [Streptococcus thermophilus ND03]
          Length = 96

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE ++++R +I  +     + ++ S++ +NG  V    +   R +AY I+  R+  Y
Sbjct: 1  MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGIY 60

Query: 61 VFMNIAS-PPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N+ +    A++E  R  +I+ ++LR + + +D
Sbjct: 61 HVVNVEANDATALNEFDRLSKINGDILRHMIVKLD 95


>gi|39995771|ref|NP_951722.1| 30S ribosomal protein S6 [Geobacter sulfurreducens PCA]
 gi|61215651|sp|Q74FE4|RS6_GEOSL RecName: Full=30S ribosomal protein S6
 gi|39982535|gb|AAR33995.1| ribosomal protein S6 [Geobacter sulfurreducens PCA]
 gi|298504781|gb|ADI83504.1| ribosomal protein S6 [Geobacter sulfurreducens KN400]
          Length = 117

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 51/92 (55%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          ++YE + +++ ++   ++K    +   +I    G +  + + G+R +AY ++K+ +  Y 
Sbjct: 3  RMYETIVIVQPELGDDELKGLTAKVTDIIGSFKGVLHRLEDWGVRKLAYPVKKSVRGRYY 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLV 93
          ++        I E++R++R+D+ VLR  ++ +
Sbjct: 63 YVRFDGDAPLIAELERRLRLDDKVLRYQSVKL 94


>gi|261414897|ref|YP_003248580.1| ribosomal protein S6 [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|261371353|gb|ACX74098.1| ribosomal protein S6 [Fibrobacter succinogenes subsp. succinogenes
           S85]
 gi|302327117|gb|ADL26318.1| ribosomal protein S6 [Fibrobacter succinogenes subsp. succinogenes
           S85]
          Length = 123

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 53/123 (43%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + ++   IS   IK  +    + I    GE+   ++ G R +AY I K +  YY
Sbjct: 1   MRQYETMVIIDAMISDDAIKAEVETIAANITNGNGEILRRDDWGKRKLAYTINKRQHGYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           V     +  + +  M+  ++++ENVLR +TL      +      Q    ++       + 
Sbjct: 61  VIFYYKAEASVVANMEAALKLNENVLRWMTLADYPMSEIVYDQTQAQSTEEIIPVDAEEG 120

Query: 121 NVD 123
             +
Sbjct: 121 EAE 123


>gi|84497233|ref|ZP_00996055.1| 30S ribosomal protein S6 [Janibacter sp. HTCC2649]
 gi|84382121|gb|EAP98003.1| 30S ribosomal protein S6 [Janibacter sp. HTCC2649]
          Length = 95

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 55/92 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  ++  + ++ ++ ++ ++I ++GG V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRQYELMVILDPELDDRTVQPSLDKFLTVITKDGGTVDNVDIWGRRRLAYEIKKKAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
            ++  S PA   E+ R++ ++E+++R+  L 
Sbjct: 61 AIVDFTSEPATAKELDRQLGLNESIMRTKLLR 92


>gi|315222301|ref|ZP_07864207.1| ribosomal protein S6 [Streptococcus anginosus F0211]
 gi|315188634|gb|EFU22343.1| ribosomal protein S6 [Streptococcus anginosus F0211]
          Length = 141

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE ++++R +I  +     + ++ S++ +NG  V    +   R +AY I+  R+  Y
Sbjct: 46  MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLY 105

Query: 61  VFMNIAS-PPAAIHEMKRKMRIDENVLRSLTLLVD 94
             +N+ +    A++E  R  +I+ ++LR + + +D
Sbjct: 106 HIVNVEAEDAVALNEFDRLSKINADILRHMIVKLD 140


>gi|213422406|ref|ZP_03355472.1| 30S ribosomal protein S6 [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
          Length = 98

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/92 (26%), Positives = 44/92 (47%)

Query: 22  TIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRI 81
            I +Y + I    G++  + + G R +AY I K  KA+YV MN+ +P   I E++   R 
Sbjct: 1   MIERYSAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRF 60

Query: 82  DENVLRSLTLLVDSHEQSPTLTIQRHDRDDRN 113
           ++ V+RS+ +         +  ++  D     
Sbjct: 61  NDAVIRSMVMRTKHAVTEASPMVKAKDERRER 92


>gi|313836464|gb|EFS74178.1| ribosomal protein S6 [Propionibacterium acnes HL037PA2]
 gi|314928919|gb|EFS92750.1| ribosomal protein S6 [Propionibacterium acnes HL044PA1]
 gi|314971090|gb|EFT15188.1| ribosomal protein S6 [Propionibacterium acnes HL037PA3]
          Length = 96

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/96 (30%), Positives = 51/96 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + ++   +  +Q+   + +Y  +I +  G V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRKYEVMIIVDPTVEERQVDSLMEKYLKVITDEKGTVDNVDVWGKRRLAYDIQKKSEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
          V +N    PA I EM R + IDE ++R+  +  + H
Sbjct: 61 VVVNATCEPATIQEMDRLLAIDEKIMRTKVMRPEIH 96


>gi|282891670|ref|ZP_06300157.1| hypothetical protein pah_c188o045 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498460|gb|EFB40792.1| hypothetical protein pah_c188o045 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 114

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 30/97 (30%), Positives = 57/97 (58%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVF 62
           LYE ++++   +S +  K  + + Q+ I E+GGE+  V++ G R +AY+I  +R+ YY  
Sbjct: 8   LYEGMYVISATLSDEARKKALEKIQNGITEHGGEILKVHDQGRRRLAYQIDGHREGYYYL 67

Query: 63  MNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQS 99
           +  +  PAAI E+     ++E+++R +TL  D   + 
Sbjct: 68  LYFSVDPAAISELWHDYHLNEDLIRFITLRTDKVMEK 104


>gi|322516031|ref|ZP_08068968.1| 30S ribosomal protein S6 [Streptococcus vestibularis ATCC 49124]
 gi|322125446|gb|EFX96792.1| 30S ribosomal protein S6 [Streptococcus vestibularis ATCC 49124]
          Length = 125

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE ++++R +I  +     + ++ S++ +NG  V    +   R +AY I+  R+  Y
Sbjct: 30  MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLY 89

Query: 61  VFMNIAS-PPAAIHEMKRKMRIDENVLRSLTLLVD 94
             +N+ +   AA++E  R  +I+ ++LR + + +D
Sbjct: 90  HVVNVEANDDAALNEFDRLSKINGDILRHMIVKLD 124


>gi|77919595|ref|YP_357410.1| 30S ribosomal protein S6 [Pelobacter carbinolicus DSM 2380]
 gi|91207926|sp|Q3A317|RS6_PELCD RecName: Full=30S ribosomal protein S6
 gi|77545678|gb|ABA89240.1| SSU ribosomal protein S6P [Pelobacter carbinolicus DSM 2380]
          Length = 115

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 54/95 (56%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE++ ++  D  + +    + +++ ++ +    +  V+E G+R +AY ++K  +  Y
Sbjct: 1  MRTYENIMIVHPDKVADEYNAVVEKFKGVLTDLNANLLKVDEWGVRKLAYPVKKQGRGSY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
          V     + P  I E +R++R+DE V++  T+L++ 
Sbjct: 61 VLTVFEADPTIIDEYERRLRLDEAVIKFQTVLLEK 95


>gi|218282112|ref|ZP_03488411.1| hypothetical protein EUBIFOR_00986 [Eubacterium biforme DSM 3989]
 gi|218216905|gb|EEC90443.1| hypothetical protein EUBIFOR_00986 [Eubacterium biforme DSM 3989]
          Length = 115

 Score = 94.9 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 50/94 (53%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE ++++   +     K    +  + I ENGG +  V++ G++  AY I   +K +Y
Sbjct: 19  MKKYEIMYIVNASLDDAAFKTVSDRLHATITENGGSIDKVDDWGVKEFAYEIDHMKKGHY 78

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           V +N+ +  A + E +R  RI  NV+R + +  +
Sbjct: 79  VVINVTANNAGVFEFQRLSRISNNVIRIMVVKTE 112


>gi|312141934|ref|YP_004009270.1| 30S ribosomal protein s6 rpsf [Rhodococcus equi 103S]
 gi|325672812|ref|ZP_08152506.1| 30S ribosomal protein S6 [Rhodococcus equi ATCC 33707]
 gi|311891273|emb|CBH50594.1| 30S ribosomal protein S6 RpsF [Rhodococcus equi 103S]
 gi|325556065|gb|EGD25733.1| 30S ribosomal protein S6 [Rhodococcus equi ATCC 33707]
          Length = 95

 Score = 94.9 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/92 (27%), Positives = 55/92 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++  + ++++++GG V  V+  G R +A+ I KN +  Y
Sbjct: 1  MRHYELMVILDPSLDERTVAPSLDTFLNVVRKDGGNVDKVDVWGKRRLAFEIAKNAEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLL 92
            ++I + PA + E+ R++ ++E+VLR+  L 
Sbjct: 61 AVVDITAEPATVKELDRQLGLNESVLRTKVLR 92


>gi|260495034|ref|ZP_05815163.1| ribosomal protein S6 [Fusobacterium sp. 3_1_33]
 gi|260197477|gb|EEW94995.1| ribosomal protein S6 [Fusobacterium sp. 3_1_33]
          Length = 105

 Score = 94.9 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 48/94 (51%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE ++++   +  +  ++TI Q  +L+  NG  +    + G R +AY I K +  +Y
Sbjct: 12  MRKYEIMYIINPTVLEEGREETISQVNALLTSNGATITKTEKWGERKLAYPIDKKKSGFY 71

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           V          + E++ K+ I E+V+R + +  D
Sbjct: 72  VLTTFEIDGTKLAEVEAKVNIMESVMRYIVVRQD 105


>gi|28376981|ref|NP_783873.1| 30S ribosomal protein S6 [Lactobacillus plantarum WCFS1]
 gi|254555176|ref|YP_003061593.1| 30S ribosomal protein S6 [Lactobacillus plantarum JDM1]
 gi|300769112|ref|ZP_07079001.1| 30S ribosomal protein S6 [Lactobacillus plantarum subsp.
          plantarum ATCC 14917]
 gi|308179198|ref|YP_003923326.1| 30S ribosomal protein S6 [Lactobacillus plantarum subsp.
          plantarum ST-III]
 gi|32171524|sp|Q890K2|RS6_LACPL RecName: Full=30S ribosomal protein S6
 gi|28269812|emb|CAD62709.1| ribosomal protein S6 [Lactobacillus plantarum WCFS1]
 gi|254044103|gb|ACT60896.1| 30S ribosomal protein S6 [Lactobacillus plantarum JDM1]
 gi|300493352|gb|EFK28531.1| 30S ribosomal protein S6 [Lactobacillus plantarum subsp.
          plantarum ATCC 14917]
 gi|308044689|gb|ADN97232.1| 30S ribosomal protein S6 [Lactobacillus plantarum subsp.
          plantarum ST-III]
          Length = 99

 Score = 94.9 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 47/95 (49%), Gaps = 1/95 (1%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          K YE  +++R DI        + ++  ++ +NG +V    +   R  AY I    +  Y 
Sbjct: 5  KKYEITYIVRPDIDDAAKTALVDRFDKILTDNGAQVIDSKDWSKRRFAYEIGGFNEGTYH 64

Query: 62 FMNIAS-PPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           +N+ +   AA++E  R  +I++++LR + +  + 
Sbjct: 65 IVNLTATDDAALNEFDRLSKINDDILRHMIVKRED 99


>gi|229917470|ref|YP_002886116.1| 30S ribosomal protein S6 [Exiguobacterium sp. AT1b]
 gi|259495334|sp|C4L008|RS6_EXISA RecName: Full=30S ribosomal protein S6
 gi|229468899|gb|ACQ70671.1| ribosomal protein S6 [Exiguobacterium sp. AT1b]
          Length = 95

 Score = 94.9 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 33/94 (35%), Positives = 57/94 (60%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R  +  +  K  I ++ ++I ENGG V    ++G R  AY I K R+ +Y
Sbjct: 1  MRKYELLYIIRPSVDEEAKKALIERFNNVITENGGTVEKTTDMGKRRFAYEINKMREGHY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V +NI + P AI E +R M+I ++V+R +T   +
Sbjct: 61 VLLNIVAEPKAILETERLMKISDDVVRQMTTKDE 94


>gi|298492977|ref|YP_003723154.1| 30S ribosomal protein S6 ['Nostoc azollae' 0708]
 gi|298234895|gb|ADI66031.1| ribosomal protein S6 ['Nostoc azollae' 0708]
          Length = 108

 Score = 94.9 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/89 (31%), Positives = 51/89 (57%)

Query: 4  YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
          YE +++LR D+  +Q++  + +YQ+L+ E G +   +   G R +AY I ++R   Y+  
Sbjct: 5  YETMYILRPDLGDEQVEQAVAKYQNLLTEQGAQNIEIQNRGKRRLAYEINRHRDGIYIQF 64

Query: 64 NIASPPAAIHEMKRKMRIDENVLRSLTLL 92
          N  +   AI  ++R MR+ E V+R +T  
Sbjct: 65 NYTALATAITPVERAMRLSEEVIRYMTTK 93


>gi|271970522|ref|YP_003344718.1| 30S ribosomal protein S6 [Streptosporangium roseum DSM 43021]
 gi|270513697|gb|ACZ91975.1| 30S ribosomal protein S6 [Streptosporangium roseum DSM 43021]
          Length = 96

 Score = 94.9 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 55/96 (57%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L   +  + +  ++ Q+ ++++ +GG V  V+  G R ++Y I K  +  Y
Sbjct: 1  MRRYEMMVILDPSLDERTVAPSLDQFLTVVRNDGGSVEKVDVWGRRRLSYDIDKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E +LR+  L  D H
Sbjct: 61 AVIDLTAEPATVKELDRQMNLNEGILRTKVLRPDVH 96


>gi|289766385|ref|ZP_06525763.1| SSU ribosomal protein S6P [Fusobacterium sp. D11]
 gi|289717940|gb|EFD81952.1| SSU ribosomal protein S6P [Fusobacterium sp. D11]
          Length = 105

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 48/94 (51%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE ++++   +  +  ++TI Q  +L+  NG  +    + G R +AY I K +  +Y
Sbjct: 12  MRKYEIMYIINPTVLEEGREETINQVNALLTSNGATITKTEKWGERKLAYPIDKKKSGFY 71

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           V          + E++ K+ I E+V+R + +  D
Sbjct: 72  VLTTFEIDGTKLAEVEAKVNIMESVMRYIVVRQD 105


>gi|148543250|ref|YP_001270620.1| 30S ribosomal protein S6 [Lactobacillus reuteri DSM 20016]
 gi|184152662|ref|YP_001841003.1| 30S ribosomal protein S6 [Lactobacillus reuteri JCM 1112]
 gi|194467409|ref|ZP_03073396.1| ribosomal protein S6 [Lactobacillus reuteri 100-23]
 gi|227364313|ref|ZP_03848406.1| ribosomal protein S6 [Lactobacillus reuteri MM2-3]
 gi|227543725|ref|ZP_03973774.1| ribosomal protein S6 [Lactobacillus reuteri CF48-3A]
 gi|300908790|ref|ZP_07126253.1| 30S ribosomal protein S6 [Lactobacillus reuteri SD2112]
 gi|325683512|ref|ZP_08163028.1| 30S ribosomal protein S6 [Lactobacillus reuteri MM4-1A]
 gi|189045474|sp|A5VHF9|RS6_LACRD RecName: Full=30S ribosomal protein S6
 gi|226703481|sp|B2G4Z1|RS6_LACRJ RecName: Full=30S ribosomal protein S6
 gi|148530284|gb|ABQ82283.1| SSU ribosomal protein S6P [Lactobacillus reuteri DSM 20016]
 gi|183224006|dbj|BAG24523.1| 30S ribosomal protein S6 [Lactobacillus reuteri JCM 1112]
 gi|194454445|gb|EDX43342.1| ribosomal protein S6 [Lactobacillus reuteri 100-23]
 gi|227070626|gb|EEI08956.1| ribosomal protein S6 [Lactobacillus reuteri MM2-3]
 gi|227186293|gb|EEI66364.1| ribosomal protein S6 [Lactobacillus reuteri CF48-3A]
 gi|300894197|gb|EFK87555.1| 30S ribosomal protein S6 [Lactobacillus reuteri SD2112]
 gi|324977862|gb|EGC14813.1| 30S ribosomal protein S6 [Lactobacillus reuteri MM4-1A]
          Length = 98

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE  +++R DI      + + ++  ++ +NG  +    +   R  AY I K  +  Y 
Sbjct: 4  RKYEITYIIRPDIEESAKSELVDRFDKILADNGATIADSKDWSTRRFAYPIAKYTEGTYH 63

Query: 62 FMNIASPPA-AIHEMKRKMRIDENVLRSLTLLVD 94
           +N+ +    A++E  R  +  +++LR + + +D
Sbjct: 64 VVNLTTDSDQALNEFDRLAKFSDDILRHMIVKLD 97


>gi|227500386|ref|ZP_03930448.1| ribosomal protein S6 [Anaerococcus tetradius ATCC 35098]
 gi|227217449|gb|EEI82768.1| ribosomal protein S6 [Anaerococcus tetradius ATCC 35098]
          Length = 94

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/95 (26%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE V + + D++       + +++ +I +N GEV  V++ G R +AY I   ++ YY
Sbjct: 1  MNKYEAVLIFKADMADSDRIALLDRFKEIIGQN-GEVTSVDDWGRRKLAYEINDLKEGYY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            ++  S P  I E +R++R+ + ++R + +  + 
Sbjct: 60 YIVDFNSNPDHIREFERRLRLSDFIIRYMVIRKED 94


>gi|255324072|ref|ZP_05365197.1| ribosomal protein S6 [Corynebacterium tuberculostearicum SK141]
 gi|255298929|gb|EET78221.1| ribosomal protein S6 [Corynebacterium tuberculostearicum SK141]
          Length = 96

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 21/94 (22%), Positives = 52/94 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  +   + +  ++ ++  ++++ GG+V  ++  G R +AY I K  +  Y
Sbjct: 1  MRHYEVMIILDPNQDERTVTPSLDKFLEIVRQEGGKVENLDVWGKRRLAYPINKKEEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N+     ++ E+ R++ +++ +LR+  L  D
Sbjct: 61 AVVNLECEHTSVAELDRRLNLNDTILRTKVLRTD 94


>gi|313906074|ref|ZP_07839426.1| ribosomal protein S6 [Eubacterium cellulosolvens 6]
 gi|313469119|gb|EFR64469.1| ribosomal protein S6 [Eubacterium cellulosolvens 6]
          Length = 96

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 46/94 (48%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE   +L   +  +     + + +  I    G +  V++ G + +AY I   R+ +Y
Sbjct: 1  MHNYELALVLSAKLDDESRAAKLEKAKGYITRYNGTIGNVDDWGKKKLAYEIEHEREGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
           F+   + P A  E++R +RI ++VLR L +  D
Sbjct: 61 YFIPFEADPTAPAEIERHVRIMDDVLRYLIIRTD 94


>gi|227486386|ref|ZP_03916702.1| ribosomal protein S6 [Anaerococcus lactolyticus ATCC 51172]
 gi|227235567|gb|EEI85582.1| ribosomal protein S6 [Anaerococcus lactolyticus ATCC 51172]
          Length = 94

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/95 (28%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE V + + +++       + +++  I+EN GEV  V++ G R +AY I   ++ YY
Sbjct: 1  MNNYEAVLIFKTELADADRNALLDRFKGHIEEN-GEVVSVDDWGKRRLAYEIADLKEGYY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            ++  S P  I E +R++R+ + VLR + +  + 
Sbjct: 60 YIVDFKSDPDHIKEFERRLRLSDFVLRYMVIRKED 94


>gi|262197681|ref|YP_003268890.1| ribosomal protein S6 [Haliangium ochraceum DSM 14365]
 gi|262081028|gb|ACY16997.1| ribosomal protein S6 [Haliangium ochraceum DSM 14365]
          Length = 210

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 65/127 (51%), Gaps = 5/127 (3%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE +++LR   ++  + +   + + +++  GG+V  V+  G R +AY I+K RK  Y+
Sbjct: 23  REYETIYILRPGTTNDGVAEVNTRVRGIVENMGGKVLQVDNWGKRRLAYEIQKERKGIYL 82

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
                +    I E++R +R+ + V+R +T+ +D  + +P       + +  ++ + R  +
Sbjct: 83  HWQFLATRGVIDEVERNLRMLDAVVRYMTIKLD-ADIAPG----ERETEVTDETYERAAS 137

Query: 122 VDRKQHV 128
            +  +  
Sbjct: 138 TEADEED 144


>gi|307329991|ref|ZP_07609143.1| ribosomal protein S6 [Streptomyces violaceusniger Tu 4113]
 gi|306884367|gb|EFN15401.1| ribosomal protein S6 [Streptomyces violaceusniger Tu 4113]
          Length = 96

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 27/96 (28%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R ++Y I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERAVSPLIENFLSVVREGEGKVEKVDTWGRRRLSYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R++ ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQLNLNESVLRTKVLRPETH 96


>gi|239980814|ref|ZP_04703338.1| 30S ribosomal protein S6 [Streptomyces albus J1074]
 gi|291452673|ref|ZP_06592063.1| 30S ribosomal protein S6 [Streptomyces albus J1074]
 gi|291355622|gb|EFE82524.1| 30S ribosomal protein S6 [Streptomyces albus J1074]
          Length = 96

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/96 (29%), Positives = 57/96 (59%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  D+  + +   I  + S+++E  G+V  V+  G R ++Y I+K  +  Y
Sbjct: 1  MRHYEVMVILDPDLEERSVAPLIENFLSVVREADGKVEKVDTWGRRRLSYEIKKKPEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSH 96
            +++ + PA + E+ R+M ++E+VLR+  L  ++H
Sbjct: 61 SVIDLQAEPAVVKELDRQMNLNESVLRTKVLRPETH 96


>gi|260587269|ref|ZP_05853182.1| ribosomal protein S6 [Blautia hansenii DSM 20583]
 gi|260542464|gb|EEX23033.1| ribosomal protein S6 [Blautia hansenii DSM 20583]
          Length = 156

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 46/94 (48%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M  YE   ++   I  +     + + +  I    G V  V E G + +AY I+K R+ YY
Sbjct: 62  MNKYELALVVNAKIDDEARAAVVEKAKDYIARYNGTVTEVEEWGKKRLAYEIQKMREGYY 121

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            F+   S  A   E++ ++RI +NVLR L +  +
Sbjct: 122 YFIQFESDAACPAEVEGRIRIMDNVLRYLVVKKE 155


>gi|320531752|ref|ZP_08032681.1| ribosomal protein S6 [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320136015|gb|EFW28034.1| ribosomal protein S6 [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 95

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 51/94 (54%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L  +   +    T+ +   ++  NGG V  V+  G R +AY I+K  + +Y
Sbjct: 1  MRHYEIMIILDPETDERTANATLEKLLQVVPSNGGTVDKVDIWGKRRLAYDIKKKSEGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V +++ + P    E+ R++ ++E VLR+  L  +
Sbjct: 61 VVVDMTTTPEIAQELDRQLGLNETVLRTKLLRPE 94


>gi|255321380|ref|ZP_05362540.1| ribosomal protein S6 [Campylobacter showae RM3277]
 gi|255301533|gb|EET80790.1| ribosomal protein S6 [Campylobacter showae RM3277]
          Length = 128

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 66/128 (51%), Gaps = 1/128 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MK YE +F+L+  ++ +++   +   + ++ +NG  +  V  +G R +AY ++K  +  Y
Sbjct: 1   MKHYELLFILKPTLTEEEVSAKVDFVKEILTKNGANIASVQSMGTRKLAYTVKKYERGTY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL-TIQRHDRDDRNDRFPRD 119
             +   +P  AI E++R +RI E++++ LT+  ++ ++      + +  + ++ +   + 
Sbjct: 61  FVVYFEAPTQAIAEVERIIRITEDIIKFLTVKFENKKEIAAWEKMSKGIKLNKKEPKVKA 120

Query: 120 RNVDRKQH 127
                 Q 
Sbjct: 121 EEAPTAQE 128


>gi|307543250|gb|ADN44265.1| ribosomal protein S6 [Pseudomonas syringae]
          Length = 78

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 1/79 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE +FL+  D  S+Q+   + +Y  LI+E+GG++  + + G R +AY I    KA+Y
Sbjct: 1  MRHYEIIFLVHPD-QSEQVGGMVERYTKLIEEDGGKIHRLEDWGRRQLAYAINNVHKAHY 59

Query: 61 VFMNIASPPAAIHEMKRKM 79
          V +N+     A+ E++   
Sbjct: 60 VMLNVECTGKALAELEDNY 78


>gi|254422309|ref|ZP_05036027.1| ribosomal protein S6 [Synechococcus sp. PCC 7335]
 gi|196189798|gb|EDX84762.1| ribosomal protein S6 [Synechococcus sp. PCC 7335]
          Length = 112

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 55/94 (58%)

Query: 7   VFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFMNIA 66
           +++LR D+  + + D I +YQ+L+ E G E       G R +AY I ++R+  Y+ MN  
Sbjct: 1   MYILRPDLGDEAVDDAISRYQTLLSEGGAEDIETQHRGKRRLAYEINRHREGIYIQMNYE 60

Query: 67  SPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100
           +P + I  M+R MR+ E+V+R LT++ +   +  
Sbjct: 61  APGSVIAPMERAMRLSEDVIRYLTIVFEEPAEGS 94


>gi|218961879|ref|YP_001741654.1| 30S ribosomal protein S6 [Candidatus Cloacamonas acidaminovorans]
 gi|167730536|emb|CAO81448.1| 30S ribosomal protein S6 [Candidatus Cloacamonas acidaminovorans]
          Length = 95

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 45/88 (51%)

Query: 4  YEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYVFM 63
          YE + +L   +S+ +         +L+ ENGGE+  ++  G R +AY I+K R+ YY   
Sbjct: 5  YELMVILVPTLSADEANAINDSLMALVTENGGEIIKIDPWGKRMLAYPIKKFREGYYFVD 64

Query: 64 NIASPPAAIHEMKRKMRIDENVLRSLTL 91
                  I ++K    I+EN++R L +
Sbjct: 65 YFRVDSLVIKKLKALFNINENIIRYLFV 92


>gi|149194316|ref|ZP_01871413.1| 30S ribosomal protein S6 [Caminibacter mediatlanticus TB-2]
 gi|149135491|gb|EDM23970.1| 30S ribosomal protein S6 [Caminibacter mediatlanticus TB-2]
          Length = 111

 Score = 94.5 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 57/101 (56%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE + +++  ++ ++ +  I   + +I +  GEV  V+ +G+R +AY I K  + +Y 
Sbjct: 4   RHYETMVIVKPTLTDEEKEAIIDNIKKVISDFKGEVVAVDNIGVRELAYPIEKFERGHYY 63

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
            +   +P  A+ E++R++R +E VLR +T+  ++ +     
Sbjct: 64  IIYYKAPAEAVIELERQLRYNEEVLRFMTVKYETKKDIKRW 104


>gi|317152941|ref|YP_004120989.1| 30S ribosomal protein S6 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943192|gb|ADU62243.1| ribosomal protein S6 [Desulfovibrio aespoeensis Aspo-2]
          Length = 103

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 22/92 (23%), Positives = 51/92 (55%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
             YE + LL  +++ +  K  +    S+++  GG +   ++ G+R +AY ++K  + YYV
Sbjct: 10  NNYETLVLLSPELAEENRKGILDLLTSIVEREGGNMVETDDWGLRQLAYPVQKQTRGYYV 69

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLV 93
            +   +P   + E++R +RI + + + +T+ +
Sbjct: 70  RLVYDAPGNLVAELERNIRITDGIFKFMTVKL 101


>gi|169824838|ref|YP_001692449.1| 30S ribosomal protein S6 [Finegoldia magna ATCC 29328]
 gi|297587221|ref|ZP_06945866.1| 30S ribosomal protein S6 [Finegoldia magna ATCC 53516]
 gi|302379566|ref|ZP_07268051.1| ribosomal protein S6 [Finegoldia magna ACS-171-V-Col3]
 gi|303234497|ref|ZP_07321134.1| ribosomal protein S6 [Finegoldia magna BVS033A4]
 gi|226703469|sp|B0S2G9|RS6_FINM2 RecName: Full=30S ribosomal protein S6
 gi|167831643|dbj|BAG08559.1| 30S ribosomal protein S6 [Finegoldia magna ATCC 29328]
 gi|297575202|gb|EFH93921.1| 30S ribosomal protein S6 [Finegoldia magna ATCC 53516]
 gi|302312473|gb|EFK94469.1| ribosomal protein S6 [Finegoldia magna ACS-171-V-Col3]
 gi|302494331|gb|EFL54100.1| ribosomal protein S6 [Finegoldia magna BVS033A4]
          Length = 95

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE V + + ++S +       + Q +I EN G++  V++ G R +AY I   ++ YY
Sbjct: 1  MNKYELVLIFKPELSEEDRNTVFSRIQQVIDEN-GKLEEVHDWGKRKLAYEINYIKEGYY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            +N    P  + E++R+ R+ + ++R + + VD 
Sbjct: 60 YIVNFDLDPQFVKEIERRCRLFDQIIRYMVVRVDE 94


>gi|325291434|ref|YP_004267615.1| SSU ribosomal protein S6P [Syntrophobotulus glycolicus DSM 8271]
 gi|324966835|gb|ADY57614.1| SSU ribosomal protein S6P [Syntrophobotulus glycolicus DSM 8271]
          Length = 94

 Score = 94.5 bits (234), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 52/94 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++++R D+  +Q K  + ++  ++  NGG    V E G R +AY ++K  + YY
Sbjct: 1  MKAYEVLYIIRPDLDEEQTKAQVTRFADIVNANGGSELKVEEWGKRRLAYEVKKFNEGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V MN       + E++R M+I +  +R LT   +
Sbjct: 61 VLMNFNGEANTVQELERVMKISDTAIRFLTTTKE 94


>gi|126651977|ref|ZP_01724169.1| 30S ribosomal protein S6 [Bacillus sp. B14905]
 gi|126591246|gb|EAZ85355.1| 30S ribosomal protein S6 [Bacillus sp. B14905]
          Length = 95

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 50/94 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE ++++R +I  +  K  + ++   +  NG EV    E G R +AY I+  R+ YY
Sbjct: 1  MRKYELMYIVRPNIEDEAKKALVERFNEALTSNGAEVIESKEWGKRRLAYEIQDFREGYY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
            + + +   AI+E  R   I E+++R + +  +
Sbjct: 61 QIVKVNATSDAINEYTRLANISEDIIRHIAVRQE 94


>gi|312864936|ref|ZP_07725166.1| ribosomal protein S6 [Streptococcus downei F0415]
 gi|311099556|gb|EFQ57770.1| ribosomal protein S6 [Streptococcus downei F0415]
          Length = 96

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE ++++R +I  +     + ++ +++ +NG  V    +   R +AY I+  R+  Y
Sbjct: 1  MAKYEILYIIRPNIEEEAKNALVERFDAILTDNGATVVESKDWEKRRLAYEIQDFREGLY 60

Query: 61 VFMNIAS-PPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N+ S    A++E  R  +I+ ++LR + + +D
Sbjct: 61 HIVNVESQDAHALNEFDRLSKINNDILRHMIVKLD 95


>gi|78042831|ref|YP_358907.1| 30S ribosomal protein S6 [Carboxydothermus hydrogenoformans
          Z-2901]
 gi|91207906|sp|Q3AG27|RS6_CARHZ RecName: Full=30S ribosomal protein S6
 gi|77994946|gb|ABB13845.1| ribosomal protein S6 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 96

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 28/94 (29%), Positives = 56/94 (59%)

Query: 2  KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
          + YE +++L  ++ +++ +  I +++ +I++ GGEV  ++  G R  AY I+K R+ YYV
Sbjct: 3  RQYEVMYILHPELDAEKTESIIERFKGMIEQEGGEVTKIDRWGKRRFAYEIKKLREGYYV 62

Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
           MN  +      E+ R +RI ++V+R + +  D 
Sbjct: 63 VMNFKAKAETAQELDRLLRISDDVVRHIVIREDK 96


>gi|257065462|ref|YP_003145134.1| ribosomal protein S6 [Slackia heliotrinireducens DSM 20476]
 gi|256793115|gb|ACV23785.1| ribosomal protein S6 [Slackia heliotrinireducens DSM 20476]
          Length = 97

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 46/97 (47%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE +F +   +  +     + + ++ I  N G+V  V   G R +AY I    +  Y
Sbjct: 1  MKAYEMLFFVAPTLDDETRLAAMKRVETTIAANNGQVDNVENWGRRKLAYEIAGLTEGDY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97
            ++    PA++ E+ R +RI + ++R   +  D  E
Sbjct: 61 TLIDFHMDPASVAELDRVLRITDAIVRHKIVRRDDRE 97


>gi|194701658|gb|ACF84913.1| unknown [Zea mays]
 gi|223975025|gb|ACN31700.1| unknown [Zea mays]
          Length = 310

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 52/102 (50%), Gaps = 1/102 (0%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE V+L+ +D   + +++ + + Q  I+E  G +  +N  G+R +AY+I+K   A Y
Sbjct: 123 MRHYEVVYLIHEDRVEE-VENVVSKVQDFIREKKGRIWRLNNWGLRRLAYKIKKATHANY 181

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
           + MN       I++ K  +  DE ++R L +  D        
Sbjct: 182 ILMNFEIESRYINDFKTLLDKDERIIRHLVMKRDEAITEDCP 223


>gi|237786618|ref|YP_002907323.1| 30S ribosomal protein S6 [Corynebacterium kroppenstedtii DSM
          44385]
 gi|259495328|sp|C4LGG1|RS6_CORK4 RecName: Full=30S ribosomal protein S6
 gi|237759530|gb|ACR18780.1| 30S ribosomal protein S6 [Corynebacterium kroppenstedtii DSM
          44385]
          Length = 95

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 24/94 (25%), Positives = 50/94 (53%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M+ YE + +L      + +  ++ +Y  ++++  G V  V+  G R +AY I+K  +  Y
Sbjct: 1  MRHYEIMIILDPAQDERTVAPSLDKYLDVVRKEKGNVDKVDIWGKRRLAYPIQKKEEGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V ++     A + E+ R + ++++VLR+  L  D
Sbjct: 61 VVVDFTCESATVLEVDRLLNLNDSVLRTKVLRTD 94


>gi|193214372|ref|YP_001995571.1| 30S ribosomal protein S6 [Chloroherpeton thalassium ATCC 35110]
 gi|254765229|sp|B3QVR7|RS6_CHLT3 RecName: Full=30S ribosomal protein S6
 gi|193087849|gb|ACF13124.1| ribosomal protein S6 [Chloroherpeton thalassium ATCC 35110]
          Length = 133

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 35/131 (26%), Positives = 66/131 (50%), Gaps = 3/131 (2%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           KLYE   ++   +    I  T+ +   LI   G EV+ V ++G + +AY I K    YYV
Sbjct: 3   KLYETTIVVDGGLDESVIAATVEKVTGLITSLGCEVKTVLDVGRKNLAYPIGKATIGYYV 62

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRN 121
            +   S   A+ E++R+ R++E+++R LT+++D          +R  +     +   D +
Sbjct: 63  HIEFESDGTALKELERQYRLNESIIRFLTIILDKRLLE---MRERVLKYGAPPQTSEDNS 119

Query: 122 VDRKQHVSEEK 132
            + ++ V E+K
Sbjct: 120 SEGEEFVEEKK 130


>gi|283458979|ref|YP_003363628.1| 30S ribosomal protein S6 [Rothia mucilaginosa DY-18]
 gi|283135043|dbj|BAI65808.1| ribosomal protein S6 [Rothia mucilaginosa DY-18]
          Length = 120

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 51/95 (53%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           M+ YE + +L  ++  + ++ ++ ++  ++   GG V  V+  G R +AY I+K  +  Y
Sbjct: 20  MRAYELMVILSPEVEDRAVEPSLSKFLEIVTNEGGSVDNVDIWGRRRLAYEIQKKSEGIY 79

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
             +N  S P    E+ R + ++E+V+R+  +  + 
Sbjct: 80  AVVNFTSTPETAAELDRVLNLNESVMRTKIIRPED 114


>gi|332971413|gb|EGK10371.1| 30S ribosomal protein S6 [Desmospora sp. 8437]
          Length = 97

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 23/95 (24%), Positives = 53/95 (55%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE +++LR ++  ++      +++ +I +NGGE   +   G R +AY I  +R+  Y
Sbjct: 1  MHKYELMYILRPELDEEKSNANREKFRGIIADNGGESVEMEHFGKRRLAYLIDDHREGIY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
                     ++E++R++++D++V+R + + +D 
Sbjct: 61 TVATFNGTVDTVNELERQLKLDDDVIRHMVINIDD 95


>gi|225869197|ref|YP_002745145.1| 30S ribosomal protein S6 [Streptococcus equi subsp.
          zooepidemicus]
 gi|225869849|ref|YP_002745796.1| 30S ribosomal protein S6 [Streptococcus equi subsp. equi 4047]
 gi|254765454|sp|C0MB79|RS6_STRE4 RecName: Full=30S ribosomal protein S6
 gi|259495344|sp|C0MEM1|RS6_STRS7 RecName: Full=30S ribosomal protein S6
 gi|225699253|emb|CAW92564.1| 30S ribosomal protein S6 [Streptococcus equi subsp. equi 4047]
 gi|225702473|emb|CAX00379.1| 30S ribosomal protein S6 [Streptococcus equi subsp.
          zooepidemicus]
          Length = 96

 Score = 94.1 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 22/95 (23%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE ++++R +I  +     + ++ S++ +NG  +    +   R +AY I   R+  Y
Sbjct: 1  MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATIVESKDWEKRRLAYEINDFREGLY 60

Query: 61 VFMNIAS-PPAAIHEMKRKMRIDENVLRSLTLLVD 94
            +N+ +    A++E  R  +I+ ++LR + + +D
Sbjct: 61 HIVNLEATDAVALNEFDRLSKINGDILRHMIVKLD 95


>gi|224373385|ref|YP_002607757.1| ribosomal protein S6 [Nautilia profundicola AmH]
 gi|223588759|gb|ACM92495.1| ribosomal protein S6 [Nautilia profundicola AmH]
          Length = 111

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 64/101 (63%)

Query: 2   KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61
           + YE +F+L+  ++ ++    +   Q++I+ENGGEV  ++++G+R +AY I K  +  Y 
Sbjct: 4   RHYETMFILKPTLTDEERAKNVENIQNVIKENGGEVAALDKIGVRELAYPIAKFERGDYY 63

Query: 62  FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTL 102
            +   +P +A+ E++R+MR +E++LR +T+  ++ ++    
Sbjct: 64  IVYYKAPASAVLELERQMRYNEDLLRFMTVKYENKKEIKRW 104


>gi|228476958|ref|ZP_04061596.1| ribosomal protein S6 [Streptococcus salivarius SK126]
 gi|322373708|ref|ZP_08048244.1| ribosomal protein S6 [Streptococcus sp. C150]
 gi|228250977|gb|EEK10148.1| ribosomal protein S6 [Streptococcus salivarius SK126]
 gi|321278750|gb|EFX55819.1| ribosomal protein S6 [Streptococcus sp. C150]
          Length = 96

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE ++++R +I  +     + ++ S++ +NG  V    +   R +AY I+  R+  Y
Sbjct: 1  MAKYEILYIIRPNIEEEAKNALVARFDSILTDNGATVVESKDWEKRRLAYEIQDFREGLY 60

Query: 61 VFMNIASPPA-AIHEMKRKMRIDENVLRSLTLLVD 94
            +N+ S    A++E  R  +I+ ++LR + + +D
Sbjct: 61 HVVNVESDNDFALNEFDRLSKINGDILRHMIVKLD 95


>gi|325479873|gb|EGC82958.1| ribosomal protein S6 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 94

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          M  YE V + + D++    ++ + +++ +I +  GEV  V++ G R +AY I   +  YY
Sbjct: 1  MNKYEAVLIFKADMNDSDRENLLDRFKEIIGQ-DGEVTNVDDWGKRKLAYEINDLKDGYY 59

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95
            ++  S P  I E +R++R+ ++++R + +  + 
Sbjct: 60 YIVDFDSNPDHIKEFERRLRLSDSIIRYMVIRKED 94


>gi|257452937|ref|ZP_05618236.1| SSU ribosomal protein S6P [Fusobacterium sp. 3_1_5R]
 gi|257466683|ref|ZP_05630994.1| SSU ribosomal protein S6P [Fusobacterium gonidiaformans ATCC
          25563]
 gi|315917836|ref|ZP_07914076.1| SSU ribosomal protein S6P [Fusobacterium gonidiaformans ATCC
          25563]
 gi|317059478|ref|ZP_07923963.1| SSU ribosomal protein S6P [Fusobacterium sp. 3_1_5R]
 gi|313685154|gb|EFS21989.1| SSU ribosomal protein S6P [Fusobacterium sp. 3_1_5R]
 gi|313691711|gb|EFS28546.1| SSU ribosomal protein S6P [Fusobacterium gonidiaformans ATCC
          25563]
          Length = 94

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 43/94 (45%)

Query: 1  MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
          MK YE ++++   +  +     I +   L+  NG  +    + G R +AY I K +  +Y
Sbjct: 1  MKKYEIMYIISPTVLEEGRDAIIEKVSELLTSNGANILKTEKWGERKLAYLIDKKKTGFY 60

Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94
          V          + E++ K+ I E V+R + +  D
Sbjct: 61 VLTTFEIDGTKLAEVESKLNITEEVMRYIVVKQD 94


>gi|218778774|ref|YP_002430092.1| 30S ribosomal p