RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780329|ref|YP_003064742.1| 30S ribosomal protein S6 [Candidatus Liberibacter asiaticus str. psy62] (135 letters) >gnl|CDD|179034 PRK00453, rpsF, 30S ribosomal protein S6; Reviewed. Length = 108 Score = 121 bits (305), Expect = 8e-29 Identities = 46/100 (46%), Positives = 69/100 (69%) Query: 1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60 M+ YE VF+LR D+S +Q+K + +++ +I ENGG + V + G R +AY I K RK +Y Sbjct: 1 MRKYEIVFILRPDLSEEQVKALVERFKGVITENGGTIHKVEDWGRRRLAYPINKLRKGHY 60 Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100 V +N +PPAAI E++R RI+E+VLR LT+ V+ E+ P Sbjct: 61 VLLNFEAPPAAIAELERLFRINEDVLRFLTVKVEEAEEEP 100 >gnl|CDD|129270 TIGR00166, S6, ribosomal protein S6. MRP17 protein is a component of the small ribosomal subunit in mitochondria, and is shown here to be an ortholog of S6. Length = 93 Score = 77.8 bits (192), Expect = 8e-16 Identities = 34/94 (36%), Positives = 56/94 (59%), Gaps = 1/94 (1%) Query: 2 KLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYYV 61 + YE +FL+R +S + K I +Y+ +I NG E+ + G R +AY I+K +A+YV Sbjct: 1 RHYEIIFLVRPTLSEEV-KGQIERYKKVITLNGAEIVRSEDWGKRRLAYPIKKQLRAHYV 59 Query: 62 FMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDS 95 MN + I E +R RI++NV+RSL + ++ Sbjct: 60 LMNFSGEAQVIKEFERTARINDNVIRSLIIKLEH 93 >gnl|CDD|172564 PRK14074, rpsF, 30S ribosomal protein S6; Provisional. Length = 257 Score = 38.4 bits (89), Expect = 6e-04 Identities = 18/51 (35%), Positives = 32/51 (62%) Query: 44 GMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVD 94 G+ AY I K + +Y M I+S + + E R+M+++EN++R L++ VD Sbjct: 188 GLLDFAYPINKMKSGHYCIMCISSTSSIMDEFVRRMKLNENIIRHLSVQVD 238 >gnl|CDD|180854 PRK07121, PRK07121, hypothetical protein; Validated. Length = 492 Score = 28.7 bits (65), Expect = 0.50 Identities = 17/89 (19%), Positives = 33/89 (37%), Gaps = 20/89 (22%) Query: 22 TIGQYQSLIQENGGEVRL-VNELGMRTIAYRIRKNRKAYYVFMNIASPPAAIHEMKRKMR 80 IGQ+ ++++ GG L V+E ++R A + E+ RK+ Sbjct: 318 RIGQF--ILEQPGGTAYLIVDEALFEEARAQLRPQIDG---RTPGAWKAETVEELARKLG 372 Query: 81 IDENVLRSLTLLVDSHEQSPTLTIQRHDR 109 I L++ T+ ++R Sbjct: 373 IPPGGLQA--------------TVDAYNR 387 >gnl|CDD|179310 PRK01622, PRK01622, OxaA-like protein precursor; Validated. Length = 256 Score = 25.5 bits (56), Expect = 4.2 Identities = 3/18 (16%), Positives = 7/18 (38%) Query: 59 YYVFMNIASPPAAIHEMK 76 V + + P + +K Sbjct: 191 MKVSQSNGTSPEQVQMLK 208 >gnl|CDD|183556 PRK12493, PRK12493, magnesium chelatase subunit H; Provisional. Length = 1310 Score = 25.3 bits (56), Expect = 5.2 Identities = 8/27 (29%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Query: 17 QQIKDTIGQYQSLIQENGGEVRLVNEL 43 +++ + IG YQ L ++G +++VN + Sbjct: 669 RELSELIGSYQQL-PDSGRGIQIVNTI 694 >gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated. Length = 390 Score = 25.1 bits (55), Expect = 6.6 Identities = 24/89 (26%), Positives = 37/89 (41%), Gaps = 14/89 (15%) Query: 15 SSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKA--------YYVFMNIA 66 +++ IK +G +L G + L N L M+ ++R N + Y F I Sbjct: 213 ATETIKIILGAGNTL----SGRLLLYNALDMKFRELKLRPNPERPVIEKLIDYEQFCGI- 267 Query: 67 SPPAAIHEMKRKMRIDENVLRSLTLLVDS 95 P A E +K I E + L L+DS Sbjct: 268 -PQAKAAEAAQKAEIPEMTVTELKALLDS 295 >gnl|CDD|185543 PTZ00294, PTZ00294, glycerol kinase-like protein; Provisional. Length = 504 Score = 24.9 bits (55), Expect = 7.2 Identities = 8/36 (22%), Positives = 16/36 (44%), Gaps = 1/36 (2%) Query: 47 TIAYRIRKNRKAYYVFM-NIASPPAAIHEMKRKMRI 81 T+ Y++ N Y +IA A + ++ M + Sbjct: 291 TVCYQLGPNGPTVYALEGSIAVAGAGVEWLRDNMGL 326 >gnl|CDD|178465 PLN02877, PLN02877, alpha-amylase/limit dextrinase. Length = 970 Score = 24.7 bits (54), Expect = 7.8 Identities = 11/22 (50%), Positives = 14/22 (63%) Query: 73 HEMKRKMRIDENVLRSLTLLVD 94 H MKR M ++ L+SLTL D Sbjct: 563 HLMKRTMVRAKDALQSLTLERD 584 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.135 0.375 Gapped Lambda K H 0.267 0.0755 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,175,099 Number of extensions: 126764 Number of successful extensions: 286 Number of sequences better than 10.0: 1 Number of HSP's gapped: 283 Number of HSP's successfully gapped: 20 Length of query: 135 Length of database: 5,994,473 Length adjustment: 83 Effective length of query: 52 Effective length of database: 4,201,009 Effective search space: 218452468 Effective search space used: 218452468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (23.8 bits)