RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780329|ref|YP_003064742.1| 30S ribosomal protein S6 [Candidatus Liberibacter asiaticus str. psy62] (135 letters) >1cqm_A Ribosomal protein S6; alzheimer disease, oligomerization; 1.65A {Thermus thermophilus} (A:) Length = 101 Score = 109 bits (273), Expect = 2e-25 Identities = 24/100 (24%), Positives = 49/100 (49%) Query: 1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60 M+ YE +L ++ Q+ Q ++ G V V LG+R +AY I K+ + Y+ Sbjct: 1 MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYF 60 Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100 ++ + P ++++ R++RI +NV R + + + Sbjct: 61 LWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLAN 100 >3i1m_F 30S ribosomal protein S6; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1p6g_F 1p87_F* 1vs7_F* 2avy_F 2aw7_F 1vs5_F 2i2u_F 2i2p_F* 2qan_F* 2qb9_F* 2qbb_F* 2qbd_F 2qbf_F 2qbh_F* 2qbj_F* 2qou_F* 2qow_F* 2qoy_F* 2qp0_F* 2vho_F ... (F:) Length = 135 Score = 108 bits (271), Expect = 3e-25 Identities = 39/133 (29%), Positives = 70/133 (52%), Gaps = 2/133 (1%) Query: 1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60 M+ YE VF++ D S +Q+ I +Y + I G++ + + G R +AY I K KA+Y Sbjct: 1 MRHYEIVFMVHPDQS-EQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPINKLHKAHY 59 Query: 61 VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQ-RHDRDDRNDRFPRD 119 V MN+ +P I E++ R ++ V+RS+ + + ++ + +R +R D F + Sbjct: 60 VLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVKAKDERRERRDDFANE 119 Query: 120 RNVDRKQHVSEEK 132 D + SEE+ Sbjct: 120 TADDAEAGDSEEE 132 >2j5a_A 30S ribosomal protein S6; ribonucleoprotein, RNA-binding, rRNA-binding, protein folding; 2.3A {Aquifex aeolicus} (A:) Length = 110 Score = 105 bits (264), Expect = 2e-24 Identities = 29/101 (28%), Positives = 54/101 (53%), Gaps = 1/101 (0%) Query: 1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60 ++ YE VF ++ +S +++K Q + I++ GGE+ + GMR +AY I+K A Y Sbjct: 7 LRYYETVFAVKPTLSEEEMKKKFEQVKEFIKQKGGEILYEEDWGMRQLAYPIQKFNNARY 66 Query: 61 VFMNI-ASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100 + P +E+ +++IDE+V+R L + + E Sbjct: 67 FLVQFKTENPQLPNELDFQLKIDEDVIRWLNIQIKESEVKK 107 >3bbn_F Ribosomal protein S6; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} (F:) Length = 168 Score = 100 bits (251), Expect = 5e-23 Identities = 22/106 (20%), Positives = 48/106 (45%), Gaps = 9/106 (8%) Query: 1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKA-- 58 ++ YE + +LR D++ + +Y+ L+ G V G+ +AY I++ KA Sbjct: 62 LRQYETMAVLRPDMTEDERLTLTQKYEELLVAGGAMYVEVFNRGVIPLAYSIKRKNKAGE 121 Query: 59 -------YYVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97 Y+ + P +I ++ + D++V+RS + + + Sbjct: 122 TNNYLDGIYLLFTYFTKPESISPLEAALVTDDDVIRSSSFKIRKRK 167 >1vmb_A 30S ribosomal protein S6; TM0603, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.70A {Thermotoga maritima} (A:) Length = 140 Score = 98.8 bits (246), Expect = 2e-22 Identities = 20/101 (19%), Positives = 49/101 (48%), Gaps = 1/101 (0%) Query: 1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQEN-GGEVRLVNELGMRTIAYRIRKNRKAY 59 ++YE +F++ ++ ++ ++ + + + +I+E G++ V +GMR AY I+K + Sbjct: 18 ERIYESMFIIAPNVPEEERENLVERVKKIIEERVKGKIDKVERMGMRKFAYEIKKFNEGD 77 Query: 60 YVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSP 100 Y + + E++ R+ ++R T E+ Sbjct: 78 YTVIYFRCDGQNLQELENFYRVTPEIIRWQTFRRFDLEKKE 118 >2kjw_A TS9, 30S ribosomal protein S6; S6 permutant, solution structure, backbone dynamics, folding, ribonucleoprotein, RNA-binding, rRNA-binding; NMR {Thermus thermophilus} (A:) Length = 96 Score = 60.9 bits (148), Expect = 6e-11 Identities = 16/54 (29%), Positives = 24/54 (44%) Query: 1 MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRK 54 YE +L ++ Q+ Q ++ G V V ELG+R +AY I K Sbjct: 43 PGRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAK 96 >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} (A:408-488) Length = 81 Score = 25.0 bits (54), Expect = 3.3 Identities = 10/38 (26%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Query: 35 GEVRLVNELGMRTIAYRIRKNRKAYYVFMNIASPPAAI 72 G++ ++N G+ +A+R +++ YV+ N+ + P I Sbjct: 3 GKIEIING-GLNVVAFRRYNDKRDLYVYHNLVNRPVKI 39 >3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ} (A:) Length = 215 Score = 25.1 bits (54), Expect = 4.1 Identities = 3/11 (27%), Positives = 7/11 (63%) Query: 71 AIHEMKRKMRI 81 MK+++R+ Sbjct: 1 GPGSMKKELRV 11 >2fji_1 Exocyst complex component SEC6; exocytosis, tandem helical bundles, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} (1:210-399) Length = 190 Score = 24.5 bits (53), Expect = 5.3 Identities = 9/49 (18%), Positives = 18/49 (36%) Query: 5 EHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIR 53 + R+D+SS + K + Q ++ E + T+ R Sbjct: 136 VGILKCRKDVSSSERKKIVQQATEMLHEYRRNMEANGVDREPTLMRRFV 184 >2odr_C Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} (C:359-648) Length = 290 Score = 24.0 bits (52), Expect = 6.9 Identities = 8/47 (17%), Positives = 19/47 (40%), Gaps = 9/47 (19%) Query: 48 IAYRI----RKNRKAYYVFMNIASPPAAIHEMKRKMRIDENVLRSLT 90 I ++ N + V + I + I+ ++ID+ L+ + Sbjct: 136 ITSKLEEAFVSNTTEFKVKVPIVRSLSDIN-----LKIDDIALKQIM 177 >2odr_D Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} (D:363-647) Length = 285 Score = 24.0 bits (52), Expect = 6.9 Identities = 8/47 (17%), Positives = 19/47 (40%), Gaps = 9/47 (19%) Query: 48 IAYRI----RKNRKAYYVFMNIASPPAAIHEMKRKMRIDENVLRSLT 90 I ++ N + V + I + I+ ++ID+ L+ + Sbjct: 132 ITSKLEEAFVSNTTEFKVKVPIVRSLSDIN-----LKIDDIALKQIM 173 >2fef_A Hypothetical protein PA2201; SAD, structural genomics, PSI, protein structure initiative, MCSG; 1.90A {Pseudomonas aeruginosa PAO1} (A:) Length = 294 Score = 23.7 bits (51), Expect = 9.2 Identities = 7/34 (20%), Positives = 13/34 (38%) Query: 102 LTIQRHDRDDRNDRFPRDRNVDRKQHVSEEKPLS 135 + R DR R + D D ++ ++ S Sbjct: 20 RNLARTDRAPRRNIDLADWKADWRELIAALDRFS 53 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.320 0.135 0.375 Gapped Lambda K H 0.267 0.0517 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 957,710 Number of extensions: 39171 Number of successful extensions: 100 Number of sequences better than 10.0: 1 Number of HSP's gapped: 96 Number of HSP's successfully gapped: 13 Length of query: 135 Length of database: 4,956,049 Length adjustment: 79 Effective length of query: 56 Effective length of database: 2,285,454 Effective search space: 127985424 Effective search space used: 127985424 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.5 bits)