RPSBLAST alignment of GI: 254780329 and protein with PDBid: 3bbn

>3bbn_F Ribosomal protein S6; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 168
 Score = 98.5 bits (245), Expect = 4e-22
 Identities = 22/106 (20%), Positives = 48/106 (45%), Gaps = 9/106 (8%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKA-- 58
           ++ YE + +LR D++  +      +Y+ L+   G     V   G+  +AY I++  KA  
Sbjct: 62  LRQYETMAVLRPDMTEDERLTLTQKYEELLVAGGAMYVEVFNRGVIPLAYSIKRKNKAGE 121

Query: 59  -------YYVFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHE 97
                   Y+     + P +I  ++  +  D++V+RS +  +   +
Sbjct: 122 TNNYLDGIYLLFTYFTKPESISPLEAALVTDDDVIRSSSFKIRKRK 167