BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780329|ref|YP_003064742.1| 30S ribosomal protein S6
[Candidatus Liberibacter asiaticus str. psy62]
         (135 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780329|ref|YP_003064742.1| 30S ribosomal protein S6 [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 135

 Score =  277 bits (709), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 135/135 (100%), Positives = 135/135 (100%)

Query: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60
           MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY
Sbjct: 1   MKLYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVNELGMRTIAYRIRKNRKAYY 60

Query: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120
           VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR
Sbjct: 61  VFMNIASPPAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDR 120

Query: 121 NVDRKQHVSEEKPLS 135
           NVDRKQHVSEEKPLS
Sbjct: 121 NVDRKQHVSEEKPLS 135


>gi|254781018|ref|YP_003065431.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 337

 Score = 23.1 bits (48), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 7/28 (25%), Positives = 16/28 (57%)

Query: 19  IKDTIGQYQSLIQENGGEVRLVNELGMR 46
           + +T+G++   I+ NGG  ++     +R
Sbjct: 272 VPETVGKFIRCIENNGGSAKIAGAGSIR 299


>gi|254780291|ref|YP_003064704.1| hypothetical protein CLIBASIA_00880 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 475

 Score = 22.7 bits (47), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 1/39 (2%)

Query: 3   LYEHVFLLRQDISSQQIKDTIGQYQSLIQENGGEVRLVN 41
           +Y   F+   DIS QQI D   Q +S+ + NG   R  N
Sbjct: 246 IYGCAFIAINDIS-QQINDHYPQIKSIKEFNGDSQRYRN 283


>gi|254780799|ref|YP_003065212.1| DNA translocase FtsK [Candidatus Liberibacter asiaticus str. psy62]
          Length = 806

 Score = 21.6 bits (44), Expect = 5.7,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 15/31 (48%)

Query: 100 PTLTIQRHDRDDRNDRFPRDRNVDRKQHVSE 130
           PTL +  HD  D N       N D  Q++S+
Sbjct: 266 PTLDVSFHDAIDINSITEYQLNADIVQNISQ 296


>gi|254780289|ref|YP_003064702.1| RNA polymerase sigma factor RpoD [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 682

 Score = 21.2 bits (43), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 7/24 (29%), Positives = 16/24 (66%)

Query: 6  HVFLLRQDISSQQIKDTIGQYQSL 29
          + FL   ++SS+Q++DT+    ++
Sbjct: 50 NAFLPPDEVSSEQMEDTVAMLSNM 73


>gi|254780537|ref|YP_003064950.1| periplasmic solute binding protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 294

 Score = 21.2 bits (43), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 13/56 (23%), Positives = 24/56 (42%)

Query: 69  PAAIHEMKRKMRIDENVLRSLTLLVDSHEQSPTLTIQRHDRDDRNDRFPRDRNVDR 124
           P A   +   M   EN+ ++LT L  S+ +   L  + +    RN   P    +++
Sbjct: 124 PHAWMSLTNAMIYIENIRKALTALDPSNAKKYELNAREYSEKIRNSILPLKTRIEK 179


>gi|254780137|ref|YP_003064550.1| malic enzyme [Candidatus Liberibacter asiaticus str. psy62]
          Length = 779

 Score = 20.8 bits (42), Expect = 9.2,   Method: Composition-based stats.
 Identities = 8/20 (40%), Positives = 12/20 (60%)

Query: 15  SSQQIKDTIGQYQSLIQENG 34
           + Q +KD +  Y+SL  E G
Sbjct: 518 NKQSLKDYVDSYRSLSAEKG 537


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.320    0.135    0.375 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 80,859
Number of Sequences: 1233
Number of extensions: 2865
Number of successful extensions: 11
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 9
length of query: 135
length of database: 328,796
effective HSP length: 65
effective length of query: 70
effective length of database: 248,651
effective search space: 17405570
effective search space used: 17405570
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 34 (17.7 bits)