RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780330|ref|YP_003064743.1| 30S ribosomal protein S18 [Candidatus Liberibacter asiaticus str. psy62] (83 letters) >3i1m_R 30S ribosomal protein S18; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_R* 1vs5_R 3i1o_R 3i1q_R 3i1s_R 3i1z_R 3i21_R 2qal_R* 1p6g_R 1p87_R 2aw7_R 2avy_R 2i2u_R 2i2p_R* 2qan_R* 2qb9_R* 2qbb_R* 2qbd_R 2qbf_R 2qbh_R* ... (R:) Length = 75 Score = 78.9 bits (195), Expect = 2e-16 Identities = 35/66 (53%), Positives = 46/66 (69%) Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76 RRK C + +G IDYKDI L ++++ GKIVPSRI+ K QR+LA+AIKRARYL Sbjct: 7 RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 66 Query: 77 LIAYVN 82 L+ Y + Sbjct: 67 LLPYTD 72 >2vqe_R 30S ribosomal protein S18; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} (R:) Length = 88 Score = 75.2 bits (185), Expect = 3e-15 Identities = 29/78 (37%), Positives = 43/78 (55%) Query: 5 APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64 A + R+ + DY+++ +L RFLS+ GKI+P R + +S K+QR Sbjct: 6 AKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSGKEQRI 65 Query: 65 LAKAIKRARYLGLIAYVN 82 LAK IKRAR LGL+ + Sbjct: 66 LAKTIKRARILGLLPFTE 83 >3bbn_R Ribosomal protein S18; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} (R:) Length = 103 Score = 70.9 bits (174), Expect = 6e-14 Identities = 23/66 (34%), Positives = 44/66 (66%) Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76 + + RIDY+++ L++RF+S++GKI+ R++ ++ K+QR + AIK+AR L Sbjct: 14 SFRRRLPPIQSGDRIDYRNMSLISRFISEQGKILSRRVNRLTLKQQRLITSAIKQARILS 73 Query: 77 LIAYVN 82 L+ ++N Sbjct: 74 LLPFLN 79 >1slm_A Stromelysin-1; hydrolase, metalloprotease, fibroblast, collagen degradation; 1.90A {Homo sapiens} (A:1-83) Length = 83 Score = 26.0 bits (57), Expect = 2.0 Identities = 12/52 (23%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR-ARYLGL 77 GA R + + L+ ++L + V K + K I+ ++LGL Sbjct: 5 GAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGL 56 >1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} (A:1-81) Length = 81 Score = 25.7 bits (56), Expect = 2.1 Identities = 6/52 (11%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKR-ARYLGL 77 +D+ L+ ++L + + + + + +K+ + GL Sbjct: 3 ATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGL 54 >3gh1_A Predicted nucleotide-binding protein; structural genomics, protein structure initiative; 1.90A {Vibrio cholerae o1 biovar el tor str} PDB: 2pmb_A (A:83-462) Length = 380 Score = 24.9 bits (54), Expect = 3.5 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 22 PLSGKGAPRIDYKDIRLLNRFLSQ-RGKIVPSR 53 P G P + K +LLN F++Q R K+ Sbjct: 330 PFEXHGDPVLXKKXDQLLNDFVAQNRXKLPGGS 362 >2waq_C DNA-directed RNA polymerase RPO1C subunit; multi-subunit, transcription; 3.35A {Sulfolobus shibatae} PDB: 2wb1_C 3hkz_C 2pmz_C (C:64-116,C:277-330) Length = 107 Score = 23.6 bits (51), Expect = 9.0 Identities = 4/22 (18%), Positives = 11/22 (50%) Query: 31 IDYKDIRLLNRFLSQRGKIVPS 52 +D + I L+ +++ G + Sbjct: 85 VDMRHILLVADVMTRTGVVRQI 106 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.323 0.136 0.386 Gapped Lambda K H 0.267 0.0710 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 613,738 Number of extensions: 22796 Number of successful extensions: 62 Number of sequences better than 10.0: 1 Number of HSP's gapped: 62 Number of HSP's successfully gapped: 9 Length of query: 83 Length of database: 4,956,049 Length adjustment: 47 Effective length of query: 36 Effective length of database: 3,367,214 Effective search space: 121219704 Effective search space used: 121219704 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.1 bits)