RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780330|ref|YP_003064743.1| 30S ribosomal protein S18 [Candidatus Liberibacter asiaticus str. psy62] (83 letters) >d2qalr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]} Length = 55 Score = 78.1 bits (193), Expect = 2e-16 Identities = 30/52 (57%), Positives = 39/52 (75%) Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82 IDYKDI L ++++ GKIVPSRI+ K QR+LA+AIKRARYL L+ Y + Sbjct: 2 IDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTD 53 >d2uubr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} Length = 70 Score = 74.3 bits (183), Expect = 3e-15 Identities = 27/65 (41%), Positives = 40/65 (61%) Query: 18 RKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGL 77 + + DY+++ +L RFLS+ GKI+P R + +S K+QR LAK IKRAR LGL Sbjct: 1 KAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGL 60 Query: 78 IAYVN 82 + + Sbjct: 61 LPFTE 65 >d1s5ja2 e.8.1.1 (A:450-864) Family B DNA polymerase {Sulfolobus solfataricus [TaxId: 2287]} Length = 415 Score = 25.7 bits (55), Expect = 1.2 Identities = 9/44 (20%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Query: 38 LLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYV 81 L +R ++P + ++ + IK Y G A V Sbjct: 9 LYYWEHRKRNWLIPLKEEILAKSSNIRTSALIKGKGYKG--AVV 50 >d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Score = 24.1 bits (51), Expect = 3.2 Identities = 7/27 (25%), Positives = 14/27 (51%), Gaps = 3/27 (11%) Query: 49 IVP-SRIS--SVSHKKQRELAKAIKRA 72 ++P RI+ ++ K +A +I A Sbjct: 381 LLPSGRINMCGLTTKNLDYVATSIHEA 407 >d1twfa_ e.29.1.2 (A:) RBP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 1449 Score = 23.3 bits (49), Expect = 5.8 Identities = 4/21 (19%), Positives = 12/21 (57%) Query: 31 IDYKDIRLLNRFLSQRGKIVP 51 ++Y+ + LL ++ +G + Sbjct: 1362 VNYRHMALLVDVMTTQGGLTS 1382 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.323 0.136 0.386 Gapped Lambda K H 0.267 0.0717 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 299,890 Number of extensions: 11464 Number of successful extensions: 28 Number of sequences better than 10.0: 1 Number of HSP's gapped: 28 Number of HSP's successfully gapped: 7 Length of query: 83 Length of database: 2,407,596 Length adjustment: 49 Effective length of query: 34 Effective length of database: 1,734,826 Effective search space: 58984084 Effective search space used: 58984084 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (21.9 bits)