BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780330|ref|YP_003064743.1| 30S ribosomal protein S18 [Candidatus Liberibacter asiaticus str. psy62] (83 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780330|ref|YP_003064743.1| 30S ribosomal protein S18 [Candidatus Liberibacter asiaticus str. psy62] Length = 83 Score = 166 bits (420), Expect = 8e-44, Method: Compositional matrix adjust. Identities = 83/83 (100%), Positives = 83/83 (100%) Query: 1 MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60 MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK Sbjct: 1 MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHK 60 Query: 61 KQRELAKAIKRARYLGLIAYVNL 83 KQRELAKAIKRARYLGLIAYVNL Sbjct: 61 KQRELAKAIKRARYLGLIAYVNL 83 >gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 24.6 bits (52), Expect = 0.35, Method: Compositional matrix adjust. Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Query: 33 YKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82 Y++ RLL F I P I+ ++HK + +A+ Y+ + Y N Sbjct: 94 YQEHRLLMDFSVIENIIFPQIIAGINHKTAYQ--RAMDLLSYMDMSQYAN 141 >gi|254780608|ref|YP_003065021.1| ribosomal large subunit pseudouridine synthase C [Candidatus Liberibacter asiaticus str. psy62] Length = 346 Score = 23.9 bits (50), Expect = 0.55, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Query: 27 GAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSH--KKQRELAKAIKRARY 74 G R+D K ++ NR S + +P I++++H K+Q+ L ++ ++ Sbjct: 44 GQVRVDKKRVKFNNRIQSGQVVRIPPVINALNHIIKEQKILDSSVNLTKH 93 >gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str. psy62] Length = 1828 Score = 21.9 bits (45), Expect = 1.8, Method: Composition-based stats. Identities = 11/37 (29%), Positives = 17/37 (45%) Query: 38 LLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARY 74 +L+ LSQR + IS HK+ + I + Y Sbjct: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIY 1306 >gi|254780142|ref|YP_003064555.1| DNA-directed RNA polymerase subunit beta' [Candidatus Liberibacter asiaticus str. psy62] Length = 1398 Score = 20.4 bits (41), Expect = 6.2, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 31 IDYKDIRLLNRFLSQRGK 48 +D ++ LNR L+Q+GK Sbjct: 1275 VDRIEVEELNRSLAQQGK 1292 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.136 0.386 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,535 Number of Sequences: 1233 Number of extensions: 1761 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 83 length of database: 328,796 effective HSP length: 52 effective length of query: 31 effective length of database: 264,680 effective search space: 8205080 effective search space used: 8205080 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)