HHsearch alignment for GI: 254780332 and conserved domain: COG0305

>COG0305 DnaB Replicative DNA helicase [DNA replication, recombination, and repair].
Probab=100.00  E-value=0  Score=879.63  Aligned_cols=434  Identities=44%  Similarity=0.717  Sum_probs=417.4

Q ss_pred             CCCCCCHHHHHHHHHHHHCCHHHHHHHHHHCCHHHCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCHHHCCHHH
Q ss_conf             67899789999999998329789999994429666379888999999999998399868643888973179832359489
Q gi|254780332|r   21 RESPNNIEAEQALLGAILVNNEAFYRVSDFLKPLHFFEAIHQKIFEIMGKLVHMGKTANPVTVKTFLSDQDMLGELTVPQ  100 (504)
Q Consensus        21 ~~~P~n~eaE~aVLG~lL~~p~~~~~v~~~L~pedFy~~~hr~IF~ai~~L~~~g~~iD~itl~~~L~~~~~l~~igg~~  100 (504)
T Consensus         1 ~~~p~~~eAE~~vLG~il~~~~~~~~i~~~l~~~dFy~~~H~~IF~a~~~l~~~~~~id~vtv~~~l~~~~~~~~igg~~   80 (435)
T COG0305           1 RLPPQDIEAEQAVLGGILLDPDAIERVSERLRPEDFYRPAHRLIYQAILDLYGQGEPIDLVTVSEELSDRGLLTRIGGAN   80 (435)
T ss_pred             CCCCCCHHHHHHHHHHHHCCHHHHHHHHHHCCHHHCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCHHHHCCCHH
T ss_conf             98997779999986654048888999997268532076789999999999986689876728999986414476607589


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCHHH
Q ss_conf             99999962211222367787878999999999876556775123444531566687655444432011344665430134
Q gi|254780332|r  101 YLARLASEAVSIINTEDYGRIIYGLALRRTLITIGEEMVNAAYEASLDKSPSIQIEEAERKLFHLAENGRYDGGFHTFSD  180 (504)
Q Consensus       101 yL~~L~~~~~s~~n~~~ya~~Ike~~~~R~li~~~~~i~~~a~~~~~~~~~~~~l~~~e~~l~~i~~~~~~~~~~~~~~~  180 (504)
T Consensus        81 yl~~L~~~~ps~~Ni~~y~~iv~e~s~~R~Li~~~~~i~~~~~~~~~~~~-~~~l~~ae~~i~~i~~~-~~~~~~~~~~~  158 (435)
T COG0305          81 YLATLIDRTPSAANIDYYAKIVKEKALLRELIEAGNEIVNLGYESEKDLD-EEVLDAAEKKIFDVAER-KNSEDFVHIGD  158 (435)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCH-HHHHHHHHHHHHHHHHH-HCCCCHHHHHH
T ss_conf             99999862887645999999999999999999999999996534544438-99999999999999975-21332244889


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             33677899999874112366443210137765564167726776213100276999999999985101112333332124
Q gi|254780332|r  181 AMTVAIDMAGQAFNRDGRLAGVSTGIQTLDKQMGGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTI  260 (504)
Q Consensus       181 ~~~~~~~~~~~~~~~~~~~~Gi~TG~~~LD~~~gGl~~G~l~Viaarpg~GKTalalniA~~~A~~~~~~~~~~~~~~~~  260 (504)
T Consensus       159 ~l~~~~~~i~~~~~~~~-~~Gi~tgf~~LD~~t~G~~~~dLiilAaRP~mGKTafalnia~n~a~~--------------  223 (435)
T COG0305         159 LLKETMDEIEARFENGG-LIGVPTGFTDLDEITSGFRPGDLIIVAARPGMGKTALALNIALNAAAD--------------  223 (435)
T ss_pred             HHHHHHHHHHHHHCCCC-CCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHH--------------
T ss_conf             99999999998735578-851446834567773377467779971689997589999999999985--------------


Q ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHCCEEEECCCCCCHHHHHHHHHHHCC
Q ss_conf             79758999585217999878999987410110001213768899899999998627807825899889999998864022
Q gi|254780332|r  261 NGGIVGFYSLEMSSEQLATRIISEQTEVPSSKIRRGELTRPDYEKIVACSQVMQKLPLYIDQTGGISMSQLATRARRLKR  340 (504)
Q Consensus       261 ~g~~Vl~fSlEMs~~el~~R~is~~s~I~~~~i~~g~l~~~e~~~i~~a~~~l~~~~l~I~d~~~~ti~~I~~~~r~~~~  340 (504)
T Consensus       224 ~~~~v~iFSLEM~~eql~~R~Ls~~s~v~~~kirtg~l~~~d~~~l~~a~~~l~~~~i~IdD~~~~si~eir~~aRrlk~  303 (435)
T COG0305         224 GRKPVAIFSLEMSEEQLVMRLLSSESGIESSKLRTGRLSDDEWERLIKAASELSEAPIFIDDTPGLTITEIRSKARRLKL  303 (435)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHCCCCCCCHHCCCCCCCCHHHHHHHHHHHHHHHHCCEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             58975999826799999997534011545100212542689999999999987617854337888878889999998887


Q ss_pred             CCCCCEEEECCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHC
Q ss_conf             44474677671353256644321137889999999999998827919997713822016899998401014324223313
Q gi|254780332|r  341 QRGLDLLIVDYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSRQVENRDNKRPQLSDLRESGSIEQDA  420 (504)
Q Consensus       341 ~~gi~~vvIDYLqli~~~~~~~~~r~~~i~~is~~lK~lA~e~~ipvi~lsQLnR~~e~r~~krP~lsDLr~Sg~IEqdA  420 (504)
T Consensus       304 ~~~l~liviDYLQLm~~~~~~-~~R~qevseISr~LK~LAkEL~vPvIAlSQLsR~~E~R~dkrP~lSDLRESGsIEQDA  382 (435)
T COG0305         304 KHNLGLIVIDYLQLMTGGKKS-ENRKQEVSEISRSLKGLAKELGVPVIALSQLNRSVEQRTDKRPMLSDLRESGALEQDA  382 (435)
T ss_pred             HCCCCEEEEEEEEECCCCCCC-CHHHHHHHHHHHHHHHHHHHHCCCEEEHHHHCCCHHHCCCCCCCCCCCCCCCCHHHHC
T ss_conf             459738998865411367764-1268899999999999998748808864452441121145687555675578436657


Q ss_pred             CEEEEEECHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCEEEEEEEECCCCCEEECC
Q ss_conf             87889725566164423333222111000000112338838999974089972599999746854020077
Q gi|254780332|r  421 DVVLFVIRDEYYIRNKEPTNKDDILAYTKWQEDLKRVKGIADIIIAKQRHGPTGTVTLAFQAEFTRFSALS  491 (504)
Q Consensus       421 D~v~~l~R~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~elivaKnR~G~~g~~~~~f~~~~~~f~~~~  491 (504)
T Consensus       383 DiVmflyRde~y~~~~~~-------------------~g~aeiIi~K~RnGp~GtV~l~f~~~~~~F~~~~  434 (435)
T COG0305         383 DIVIFLHRDEAYLKDTPD-------------------RGEAEVIVAKNRNGPTGTVKLAFDPQFTKFKNLA  434 (435)
T ss_pred             CEEEEEECHHHCCCCCCC-------------------CCEEEEEEEECCCCCCCEEEEEEECCCCCCCCCC
T ss_conf             789998142322677788-------------------8628999874368987459999834654301067