HHsearch alignment for GI: 254780332 and conserved domain: KOG2680

>KOG2680 consensus.
Probab=96.20  E-value=0.0033  Score=43.90  Aligned_cols=60  Identities=32%  Similarity=0.410  Sum_probs=40.2

Q ss_pred             HHHCCCCEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHH
Q ss_conf             6416772677621310027699999999998510111233333212479758999585217999878999
Q gi|254780332|r  214 GGLQRSDLIIIAGRPGMGKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLEMSSEQLATRIIS  283 (504)
Q Consensus       214 gGl~~G~l~Viaarpg~GKTalalniA~~~A~~~~~~~~~~~~~~~~~g~~Vl~fSlEMs~~el~~R~is  283 (504)
T Consensus        61 egkiaGraiLiaG~pgtGKtAiAmg~sksLG~~tpF~~----------i~gSEI~SlEmsKTEAltQAfR  120 (454)
T KOG2680          61 EGKIAGRAILIAGQPGTGKTAIAMGMSKSLGDDTPFTS----------ISGSEIYSLEMSKTEALTQAFR  120 (454)
T ss_pred             CCCCCCEEEEEECCCCCCCEEEEEEHHHHHCCCCCEEE----------EECCEEEEECCCHHHHHHHHHH
T ss_conf             28632138997248988844100002454078875036----------5022222100017799999988