>TIGR01011 rpsB_bact ribosomal protein S2; InterPro: IPR005706 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits. Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , . This family describes the bacterial, mitochondrial and chloroplast forms of ribosomal protein S2.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015935 small ribosomal subunit.

Probab=96.79 E-value=0.045 Score=35.25 Aligned_cols=151 Identities=23% Similarity=0.300 Sum_probs=94.7 Q ss_pred HHHCCC-CEEEEECC-CHH-----HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEECC-CCHHHHHHHHHHHH Q ss_conf 641677-26776213-100-----27699999999998510111233333212479758999585-21799987899998 Q gi|254780332|r 214 GGLQRS-DLIIIAGR-PGM-----GKTSLATNIAYNVADAYKAELQTDGSYKTINGGIVGFYSLE-MSSEQLATRIISEQ 285 (504) Q Consensus 214 gGl~~G-~l~Viaar-pg~-----GKTalalniA~~~A~~~~~~~~~~~~~~~~~g~~Vl~fSlE-Ms~~el~~R~is~~ 285 (504) T Consensus 19 RRWNPkMk~fIf~eRKngihIIDL~kT~~~~~~Ay~~v~~-----------~~~~gg~iLFVGTKNkQA~~~i~-~~A~r 86 (227) T TIGR01011 19 RRWNPKMKPFIFGERKNGIHIIDLQKTLQLLEEAYNFVRE-----------VVANGGKILFVGTKNKQAKEIIK-EEAER 86 (227) T ss_pred CCCCCCCCCCCCCCCCCCCEEECHHHHHHHHHHHHHHHHH-----------HHHCCCEEEEEECHHHHHHHHHH-HHHHH T ss_conf 2368889885532012785122578999999999999999-----------99819958885165889999999-99987 Q ss_pred HHHCCCCC--CCCCCCHHHHHHHHHHHHHHHHCC-----EEEECCCCCCHHHHHHHHHHHCCCC-C-------CCEEEE- Q ss_conf 74101100--012137688998999999986278-----0782589988999999886402244-4-------746776- Q gi|254780332|r 286 TEVPSSKI--RRGELTRPDYEKIVACSQVMQKLP-----LYIDQTGGISMSQLATRARRLKRQR-G-------LDLLIV- 349 (504) Q Consensus 286 s~I~~~~i--~~g~l~~~e~~~i~~a~~~l~~~~-----l~I~d~~~~ti~~I~~~~r~~~~~~-g-------i~~vvI- 349 (504) T Consensus 87 ~g~~YVn~RWLGGMLTN--f~TirkSi~kL~~lE~~~~~g~~~~LtKKE~~~L~Re~~KL~k~LgGIk~M~~lPd~l~vi 164 (227) T TIGR01011 87 CGMFYVNQRWLGGMLTN--FKTIRKSIKKLKKLEKMEEDGTFDVLTKKEILMLSREKEKLEKNLGGIKDMKKLPDLLFVI 164 (227) T ss_pred CCCCEECCCCCCCCCHH--HHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEE T ss_conf 48962113334640024--7999999999999998776133124770007767899999865530025453169708997 Q ss_pred CCHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCC Q ss_conf 713532566443211378899999999999988279199977138220 Q gi|254780332|r 350 DYIQLMTTSKKIEENRVLEITGITMALKALAKELNIPIIALSQLSRQV 397 (504) Q Consensus 350 DYLqli~~~~~~~~~r~~~i~~is~~lK~lA~e~~ipvi~lsQLnR~~ 397 (504) T Consensus 165 D------~-~~E----~IAv~E--------A~kLgIPvvA~vDTNCdP 193 (227) T TIGR01011 165 D------P-RKE----KIAVAE--------ARKLGIPVVAIVDTNCDP 193 (227) T ss_pred C------C-CCC----HHHHHH--------HHHCCCCEEEEECCCCCC T ss_conf 4------8-210----689999--------733799789870478888

HHsearch alignment for GI: 254780332 and conserved domain: TIGR01011