BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780333|ref|YP_003064746.1| alanine racemase [Candidatus
Liberibacter asiaticus str. psy62]
         (370 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780333|ref|YP_003064746.1| alanine racemase [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040010|gb|ACT56806.1| alanine racemase [Candidatus Liberibacter asiaticus str. psy62]
          Length = 370

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/370 (100%), Positives = 370/370 (100%)

Query: 1   MHSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDF 60
           MHSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDF
Sbjct: 1   MHSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDF 60

Query: 61  FVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGV 120
           FVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGV
Sbjct: 61  FVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGV 120

Query: 121 SHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLE 180
           SHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLE
Sbjct: 121 SHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLE 180

Query: 181 RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEA 240
           RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEA
Sbjct: 181 RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEA 240

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
           RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG
Sbjct: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
           FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR
Sbjct: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360

Query: 361 IGTRYAKFYT 370
           IGTRYAKFYT
Sbjct: 361 IGTRYAKFYT 370


>gi|315122242|ref|YP_004062731.1| alanine racemase [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495644|gb|ADR52243.1| alanine racemase [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 348

 Score =  565 bits (1457), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 279/348 (80%), Positives = 307/348 (88%)

Query: 23  MNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLRLYTPQARIFV 82
           MN LSG ARTAAVVKDNAYGLG EKIA  LYN+GVQDFFV  V EGVKLR Y P+A+IFV
Sbjct: 1   MNVLSGCARTAAVVKDNAYGLGFEKIAQTLYNSGVQDFFVAHVGEGVKLRAYVPKAKIFV 60

Query: 83  LYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVDTGFNRLGLSLQEA 142
           LYGIHPG+EKI+FD NLIPVISS  QLTFY KLMS G SHPYALQVDTGFNRLGLSLQEA
Sbjct: 61  LYGIHPGEEKILFDANLIPVISSSQQLTFYLKLMSNGFSHPYALQVDTGFNRLGLSLQEA 120

Query: 143 LDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHYKGIEASLASSSGI 202
           L+F  N  NKK  +LSLI+SHLAC++DP S +NS QLE+F TL+  YKGIEASLASS+GI
Sbjct: 121 LNFAKNFSNKKSDKLSLIMSHLACSEDPVSLMNSSQLEQFLTLMKSYKGIEASLASSAGI 180

Query: 203 LLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKALAGELVSYGGQKKL 262
           LLG NYHFQLTRPGISLYGGT  INK +PMQTVVTAEARIILIR+A AGE++SYGGQKKL
Sbjct: 181 LLGENYHFQLTRPGISLYGGTPAINKLNPMQTVVTAEARIILIREAAAGEVISYGGQKKL 240

Query: 263 TRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDI 322
            R+SLIAVAAIGYADGYPLTLSG+D EH+ + F GGKGFIKGYMVPILGKITMD+TMFDI
Sbjct: 241 KRNSLIAVAAIGYADGYPLTLSGIDLEHNQAQFPGGKGFIKGYMVPILGKITMDITMFDI 300

Query: 323 TDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFYT 370
           TDS+ IE GDYI++FGP+IKLDDVALAS TTNYDLLVRIGTRYA+FYT
Sbjct: 301 TDSIGIEAGDYIEVFGPNIKLDDVALASRTTNYDLLVRIGTRYARFYT 348


>gi|325292459|ref|YP_004278323.1| Alanine racemase [Agrobacterium sp. H13-3]
 gi|325060312|gb|ADY64003.1| Alanine racemase [Agrobacterium sp. H13-3]
          Length = 391

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/365 (50%), Positives = 248/365 (67%), Gaps = 2/365 (0%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL +DL AL +NW  M   SG ARTAAVVK +AYGLG E     LY+AG +DFFV +V 
Sbjct: 22  LRLTVDLGALADNWRDMKKRSGKARTAAVVKADAYGLGIEDCGATLYHAGARDFFVATVS 81

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           EG  LR Y P+ARIFVL GI  GQE+ +FD +L+PV++S  QL+F+   ++    HP AL
Sbjct: 82  EGATLRSYAPEARIFVLSGIWQGQERQVFDNDLVPVLASEEQLSFWMATVAERGEHPCAL 141

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
            VDTGFNRLGL L +AL    +          L++SHLACAD PSS +N VQLE FR + 
Sbjct: 142 HVDTGFNRLGLPLDDALFLADDVTRPASFDPVLVLSHLACADTPSSPMNKVQLESFRKVS 201

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + ++GIE+SL++S+GI LGP+YHF LTRPGI+LYGG    + ++PM+ V  AEARII IR
Sbjct: 202 AAFEGIESSLSASAGIFLGPDYHFDLTRPGIALYGGEAINDVANPMRPVAKAEARIIQIR 261

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
           +A  G+ VSYGG   L R S +A+A++GYADGY  +LSG           G  G + G+ 
Sbjct: 262 EAGEGQTVSYGGTYLLKRASRLAIASVGYADGYQRSLSGSGIPLREMGHGGAYGIVNGHK 321

Query: 307 VPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
            P+ G++TMD+T+FDITD  + ++  GDYI++FGP + LD+VA A+GT  Y++L  +G R
Sbjct: 322 APVAGRVTMDLTIFDITDIPANAVRTGDYIELFGPKVPLDEVARAAGTIGYEMLTGLGLR 381

Query: 365 YAKFY 369
           Y + Y
Sbjct: 382 YERQY 386


>gi|241203930|ref|YP_002975026.1| alanine racemase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857820|gb|ACS55487.1| alanine racemase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 389

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/365 (50%), Positives = 247/365 (67%), Gaps = 2/365 (0%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL +DLTAL  NW  M   SG AR +AVVK +AYG+G E    ALY AG +DFFV +V+
Sbjct: 21  LRLTVDLTALTENWRDMARRSGAARASAVVKADAYGMGIEDAGEALYMAGARDFFVATVD 80

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           EGV LRLY P+ARIFVL GI PG E+  FD +L+PVISS  QL F+  +++    +P AL
Sbjct: 81  EGVTLRLYAPEARIFVLSGIWPGTERRFFDNDLVPVISSDEQLAFWMAVLADYGDYPCAL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
            VDTGFNRLGL + +A+    +          L++SHLACADDP+  +N  QLE F  + 
Sbjct: 141 HVDTGFNRLGLHIDDAIALADDVSRPASFAPVLVMSHLACADDPTHAMNRQQLESFHRVS 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + Y+GI++SLA+S+GI LG +YHF LTRPGI+LYGG      ++PM+ V TAEARII +R
Sbjct: 201 AAYEGIDSSLAASAGIFLGEDYHFDLTRPGIALYGGEAVSGMANPMRPVATAEARIIQVR 260

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AGE VSYG   +L R+S +A+A+ GYADGY  + S         V  GG+GFI G+ 
Sbjct: 261 SVAAGETVSYGRALQLRRESRLAIASAGYADGYMRSQSSGGVPLRQVVPQGGQGFIAGHK 320

Query: 307 VPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           VP+ G+ITMD+T+FDITD    ++  GDY+++FG ++ +DDVA ASGT  Y++L  +G R
Sbjct: 321 VPVAGRITMDLTIFDITDLPDNAVRAGDYVELFGKNMPVDDVARASGTIGYEILTSMGLR 380

Query: 365 YAKFY 369
           + + Y
Sbjct: 381 HERRY 385


>gi|222148127|ref|YP_002549084.1| alanine racemase [Agrobacterium vitis S4]
 gi|221735115|gb|ACM36078.1| alanine racemase [Agrobacterium vitis S4]
          Length = 387

 Score =  367 bits (943), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 189/373 (50%), Positives = 248/373 (66%), Gaps = 6/373 (1%)

Query: 3   SNEFL----RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQ 58
           S+EFL    R+ IDL AL +NW  M   SG AR  AVVK + YG+G E     LYNAG +
Sbjct: 11  SDEFLTAPLRVTIDLQALADNWRDMAKRSGKARAGAVVKADGYGIGIEDSGQTLYNAGAR 70

Query: 59  DFFVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC 118
           DFFV    EG  LR Y P ARIFVL GI  G E + F+ +L+PVI+S  QL F+ + ++ 
Sbjct: 71  DFFVALPSEGATLRTYAPDARIFVLSGIWEGMEPLFFEHDLVPVIASEEQLAFWMRTVAD 130

Query: 119 GVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQ 178
              HP AL VDTGFNRLGLS+ +AL    +          LI+SHLACADDPSS +N  Q
Sbjct: 131 QGDHPCALHVDTGFNRLGLSMDDALFLATDVSRPASFSPVLILSHLACADDPSSPMNQKQ 190

Query: 179 LERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTA 238
           L+ F  + + ++GIE+SL++S+G LLGP+YHF LTRPGI+LYGG       +PM+ VV A
Sbjct: 191 LQAFHQVSAAFEGIESSLSASAGTLLGPDYHFDLTRPGIALYGGEAVTGLPNPMRPVVKA 250

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           EARI+ IR+A  GE VSYG   +LTR+S +AVA++GYADGY   LSG  +    +   G 
Sbjct: 251 EARILQIRQARNGETVSYGATCQLTRESRLAVASVGYADGYLRNLSGHGTALRDTGSPGA 310

Query: 299 KGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYD 356
            G I GY VP++G+ITMDMT+FD++D    +I  GDYI++FGP++ +DDVA A+GT  Y+
Sbjct: 311 YGSIAGYQVPVVGRITMDMTIFDVSDVPEKAIAAGDYIELFGPNMPIDDVARAAGTIGYE 370

Query: 357 LLVRIGTRYAKFY 369
           +L  +G RY + Y
Sbjct: 371 MLTGLGLRYERHY 383


>gi|222085428|ref|YP_002543958.1| alanine racemase [Agrobacterium radiobacter K84]
 gi|221722876|gb|ACM26032.1| alanine racemase [Agrobacterium radiobacter K84]
          Length = 387

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 187/368 (50%), Positives = 246/368 (66%), Gaps = 8/368 (2%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL +DL AL  NW  M   SG ART+AVVK +AYGLG E +  ALY AG +DFFV + +
Sbjct: 16  LRLTVDLDALVENWRDMAHRSGRARTSAVVKADAYGLGIEDVGEALYLAGARDFFVATAD 75

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           EG  LRLY P ARIFVL GI PG E++ F+ +L+PVI+S  QLTF+  ++S    +P AL
Sbjct: 76  EGATLRLYAPDARIFVLSGIWPGMERVFFENDLVPVIASEEQLTFWMSVLSDYGDYPCAL 135

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           QVDTGFNRLGL +++AL    +          L++SHLAC DDP++ +N  QLE FR + 
Sbjct: 136 QVDTGFNRLGLPMEDALALADDVSRPASFAPVLVMSHLACGDDPANPMNRQQLEAFRKVS 195

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + ++GIEASLA+S+GI LGP YHF LTRPGI+ YGG      ++PM+ V TAEARII  R
Sbjct: 196 AAFEGIEASLANSAGIFLGPEYHFDLTRPGIATYGGEAVPGIANPMRPVATAEARIIQTR 255

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP---SVFLGGKGFIK 303
              AGE V YG   +LTRDS +A+ + GYADGY   + G  S   P   +   GG GFI 
Sbjct: 256 FVKAGETVGYGRAMQLTRDSRLAIVSAGYADGY---MRGQSSGGVPLRQTDLPGGHGFIA 312

Query: 304 GYMVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           G+ VP+ G+ITMD+T+FDITD     +  GDY+++FG +I +DD A A+GT  Y++L  +
Sbjct: 313 GHRVPVAGRITMDLTIFDITDLPDNLVRAGDYVELFGSNILVDDAARAAGTIGYEMLTSL 372

Query: 362 GTRYAKFY 369
           G R+ + Y
Sbjct: 373 GLRHERRY 380


>gi|15888423|ref|NP_354104.1| alanine racemase [Agrobacterium tumefaciens str. C58]
 gi|20137302|sp|P58736|ALR1_AGRT5 RecName: Full=Alanine racemase, biosynthetic
 gi|15156111|gb|AAK86889.1| alanine racemase [Agrobacterium tumefaciens str. C58]
          Length = 391

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 247/365 (67%), Gaps = 2/365 (0%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL +DL AL +NW  M   SG ARTAAVVK +AYGLG E     LY+AG +DFFV +V 
Sbjct: 22  LRLTVDLGALADNWRDMKKRSGRARTAAVVKADAYGLGIEDCGATLYHAGARDFFVATVA 81

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           EG  LR Y P+ARIFVL GI  GQE+ +FD +L+PV++S  QL+F+   ++    HP AL
Sbjct: 82  EGATLRSYAPEARIFVLSGIWQGQERQVFDNDLVPVLASEEQLSFWMATVAERGDHPCAL 141

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
            VDTGFNRLGL L +AL    +          L++SHLACAD PSS +N  QLE FR + 
Sbjct: 142 HVDTGFNRLGLPLDDALFLADDVTRPASFDPVLVLSHLACADTPSSPMNRAQLESFRRVS 201

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + ++GIE+SL++S+GI LGP+YHF LTRPGI+LYGG    + ++PM+ V  AEARII IR
Sbjct: 202 AAFEGIESSLSASAGIFLGPDYHFDLTRPGIALYGGEAVNDVANPMRPVAKAEARIIQIR 261

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
           +A  G+ VSYG    L R S +A+A++GYADGY  +LSG           G  G + G+ 
Sbjct: 262 EAGEGQTVSYGSSFLLKRASRLAIASVGYADGYQRSLSGSGIPLREMGHGGAYGVVNGHK 321

Query: 307 VPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           VP+ G++TMD+T+FD+TD  + +I  GDYI++FGP++ +D+ A A+GT  Y++L  +G R
Sbjct: 322 VPVAGRVTMDLTIFDVTDVPANAIRAGDYIELFGPNVPVDETARAAGTIGYEMLTGLGLR 381

Query: 365 YAKFY 369
           Y + Y
Sbjct: 382 YERQY 386


>gi|116251316|ref|YP_767154.1| alanine racemase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255964|emb|CAK07045.1| putative alanine racemase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 389

 Score =  366 bits (939), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 183/365 (50%), Positives = 247/365 (67%), Gaps = 2/365 (0%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL +DLTAL  NW  M   SG AR +AVVK +AYG+G E    ALY AG +DFFV +V+
Sbjct: 21  LRLTVDLTALTENWRDMARRSGAARASAVVKADAYGMGIEDAGEALYMAGARDFFVATVD 80

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           EGV LRLY P+AR+FVL GI PG E+  F+ +L+PVISS  QL F+  +++    +P AL
Sbjct: 81  EGVTLRLYAPEARVFVLSGIWPGTERRFFENDLVPVISSDEQLAFWMAVLADYGDYPCAL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
            VDTGFNRLGL + +A+    +          L++SHLACADDP+  +N  QLE F  + 
Sbjct: 141 HVDTGFNRLGLHIDDAIALADDVSRPASFAPVLVMSHLACADDPTHAMNRQQLESFHRVS 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + Y+GI++SLA+S+GI LG +YHF LTRPGI+LYGG      ++PM+ V TAEARII +R
Sbjct: 201 AAYEGIDSSLAASAGIFLGEDYHFDLTRPGIALYGGEAVCGMANPMRPVATAEARIIQVR 260

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AGE VSYG   +L R+S +A+A+ GYADGY  + S         V  GG+GFI G+ 
Sbjct: 261 SVEAGETVSYGRALQLRRESRLAIASAGYADGYMRSQSSGGVPLRQVVPQGGQGFIAGHK 320

Query: 307 VPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           VP+ G+ITMD+T+FDITD    ++  GDY+++FG ++ +DDVA ASGT  Y++L  +G R
Sbjct: 321 VPVAGRITMDLTIFDITDLPDNAVRAGDYVELFGKNMPVDDVARASGTIGYEILTSMGLR 380

Query: 365 YAKFY 369
           + + Y
Sbjct: 381 HERRY 385


>gi|227821452|ref|YP_002825422.1| alanine racemase [Sinorhizobium fredii NGR234]
 gi|227340451|gb|ACP24669.1| alanine racemase [Sinorhizobium fredii NGR234]
          Length = 409

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 242/375 (64%), Gaps = 6/375 (1%)

Query: 1   MHSNEFL----RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAG 56
           MHS EFL    RL IDLTA+ +NW +MN  SG AR AAV+K NAYG+G  + AP LY AG
Sbjct: 31  MHSPEFLAASNRLTIDLTAIADNWRTMNERSGKARAAAVLKANAYGIGVAQAAPTLYAAG 90

Query: 57  VQDFFVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM 116
            +DFFV   EEG +LR   P ARI++L G+ PG E+  F  +L+P+I+S  QL  +   +
Sbjct: 91  ARDFFVADAEEGAELRPLLPDARIYILAGMWPGNEEFFFANDLVPIINSEEQLAVFMAAL 150

Query: 117 SCGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNS 176
           S    HP  L VDTG NRLGLS++EA+   H+          L++SHLAC DDP   +N 
Sbjct: 151 SERGDHPCVLHVDTGMNRLGLSVEEAIALAHDPARPASFSPVLVMSHLACGDDPRHPMNL 210

Query: 177 VQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVV 236
            QL+RFR + + ++G+ ASLA+S G+ LG +YHF LTRPGI++YGG    +  +PM+ VV
Sbjct: 211 YQLQRFREVTAAFEGVPASLANSGGVFLGEDYHFDLTRPGIAVYGGEAVNDALNPMKPVV 270

Query: 237 TAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFL 296
           TAEARI+ +R   +G   SYG   +  RDS IA  AIGYADGY  ++SG       +   
Sbjct: 271 TAEARILQLRTVPSGGTASYGASARFARDSRIATVAIGYADGYHRSVSGGGVTLRQATPS 330

Query: 297 GGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTN 354
           G  GF+ G  VP +G++TMD+++FD+TD    ++  GDYI++FG ++ +DDVA A GT  
Sbjct: 331 GAYGFLHGKKVPHVGRVTMDLSLFDVTDLPERAVRAGDYIELFGRNVAIDDVARAGGTIG 390

Query: 355 YDLLVRIGTRYAKFY 369
           Y+LL  +G RY + Y
Sbjct: 391 YELLTSLGHRYCRTY 405


>gi|327187996|gb|EGE55226.1| putative alanine racemase [Rhizobium etli CNPAF512]
          Length = 386

 Score =  352 bits (903), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 185/365 (50%), Positives = 247/365 (67%), Gaps = 2/365 (0%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL +DLTAL  NW  M   SG AR AAVVK +AYG+G E    ALY AG +DFFV +V+
Sbjct: 18  LRLTVDLTALTENWRDMARRSGAARAAAVVKADAYGMGIEDAGEALYTAGARDFFVATVD 77

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           EGV LRLY P+ARIFVL GI PG E+  FD +L+PVISS  QL F+  +++    +P AL
Sbjct: 78  EGVTLRLYAPEARIFVLSGIWPGTERRFFDNDLVPVISSEEQLAFWMAVLADYGDYPCAL 137

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
            VDTGFNRLGL + +A+    +          L++SHLAC DDPS  +N  QLE FR + 
Sbjct: 138 HVDTGFNRLGLHIDDAIALADDVSRPASFAPVLVMSHLACGDDPSHAMNRQQLESFRRVT 197

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + Y+G+++SLA+S+GI LG +YHF+LTRPGI+LYGG      ++PM+ V TAEARII +R
Sbjct: 198 AAYEGVDSSLAASAGIFLGEDYHFELTRPGIALYGGEAVCGMANPMRPVATAEARIIQVR 257

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AGE VSYG   +L RDS +A+ + GYADGY  + S         V  GG+GFI G+ 
Sbjct: 258 TVKAGETVSYGRALQLPRDSRLAIVSAGYADGYMRSQSSGGVPLRQVVPQGGQGFIAGHK 317

Query: 307 VPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           VP+ G+ITMD+T+FD+TD    ++  GDY+++FG ++ LDDVA A+GT  Y++L  +G R
Sbjct: 318 VPVAGRITMDLTIFDVTDLPENAVRAGDYVELFGKNVALDDVARAAGTIGYEILTSMGLR 377

Query: 365 YAKFY 369
           + + Y
Sbjct: 378 HERRY 382


>gi|209548649|ref|YP_002280566.1| alanine racemase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534405|gb|ACI54340.1| alanine racemase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 388

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 188/368 (51%), Positives = 249/368 (67%), Gaps = 8/368 (2%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL +DLTAL  NW  M   SG AR AAVVK +AYG+G E    ALY AG +DFFV +V+
Sbjct: 19  LRLTVDLTALTENWRDMAQRSGAARAAAVVKADAYGMGIEDAGEALYMAGARDFFVATVD 78

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           EGV LRLY P ARIFVL GI PG E+  F+ +L+PVISS  QL F+  +++    +P AL
Sbjct: 79  EGVTLRLYAPDARIFVLSGIWPGTERRFFENDLVPVISSDEQLAFWMAVLADYGDYPCAL 138

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
            VDTGFNRLGL + +A+    +          L++SHLAC D+PS  +N  QLE FR + 
Sbjct: 139 HVDTGFNRLGLHMDDAIALADDVSRPASFAPVLVMSHLACGDEPSHAMNRQQLESFRRVS 198

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + Y+GI++SLA+S+GI LG +YHF LTRPGI+LYGG      ++PM+ V TAEARII +R
Sbjct: 199 AAYEGIDSSLAASAGIFLGEDYHFDLTRPGIALYGGEAVCGLANPMRPVATAEARIIQVR 258

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP---SVFLGGKGFIK 303
              AGE VSYG   +L R S +A+A+ GYADGY   + GL S   P   +V  GG+GFI 
Sbjct: 259 SVEAGETVSYGRALQLRRKSRLAIASAGYADGY---MRGLSSGGVPLRQAVPQGGQGFIA 315

Query: 304 GYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           G+ VP+ G+ITMD+T+FDITD    ++  GDY+++FG ++ LDDVA A+GT  Y++L  +
Sbjct: 316 GHKVPVAGRITMDLTIFDITDLPDNAVRAGDYVELFGKNMPLDDVARAAGTIGYEILTSM 375

Query: 362 GTRYAKFY 369
           G R+ + Y
Sbjct: 376 GLRHERRY 383


>gi|15964880|ref|NP_385233.1| putative alanine racemase protein [Sinorhizobium meliloti 1021]
 gi|307300951|ref|ZP_07580720.1| alanine racemase [Sinorhizobium meliloti BL225C]
 gi|307321854|ref|ZP_07601240.1| alanine racemase [Sinorhizobium meliloti AK83]
 gi|20137219|sp|Q92R07|ALR_RHIME RecName: Full=Alanine racemase
 gi|15074059|emb|CAC45706.1| Putative alanine racemase [Sinorhizobium meliloti 1021]
 gi|306892523|gb|EFN23323.1| alanine racemase [Sinorhizobium meliloti AK83]
 gi|306903906|gb|EFN34492.1| alanine racemase [Sinorhizobium meliloti BL225C]
          Length = 379

 Score =  345 bits (885), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 243/375 (64%), Gaps = 6/375 (1%)

Query: 1   MHSNEFL----RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAG 56
           M S EFL    RL +DLTAL +NW +MN  SG AR AAV+K +AYGLG    APALY AG
Sbjct: 1   MQSPEFLSASSRLTVDLTALADNWRAMNERSGKARAAAVLKADAYGLGVVHAAPALYAAG 60

Query: 57  VQDFFVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM 116
            +DFFV SVEEG  LR   P  RI++L G+ PG E++ F+ +L+P+I+S  QL  +   +
Sbjct: 61  ARDFFVASVEEGADLRPLVPDGRIYILAGMWPGNEELFFENDLVPIINSEEQLAVFMAAL 120

Query: 117 SCGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNS 176
           S    HP  L VDTG NRLGLS +EAL   H+          L++SHLACADDP   +N 
Sbjct: 121 SERGDHPCVLHVDTGMNRLGLSPEEALALAHDPARPASFSPVLVMSHLACADDPGHPMNR 180

Query: 177 VQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVV 236
            QL+RFR + + ++G+ ASLA+S G+ LG +YHF LTRPGI++YGG       +PM+ VV
Sbjct: 181 YQLQRFREVTAAFEGVPASLANSGGVFLGADYHFDLTRPGIAVYGGEAVNGAVNPMKAVV 240

Query: 237 TAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFL 296
           TAEARI+ +R   +G   SYG   +  RDS IA  AIGYADGY  ++SG       ++  
Sbjct: 241 TAEARIVQVRTVPSGGTASYGASVRFGRDSRIATVAIGYADGYHRSVSGGGVTLRQAMPS 300

Query: 297 GGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTN 354
           G  GF+ G  VP +G++TMD+++FD+TD    ++  GDYI++FG ++ +DDVA A GT  
Sbjct: 301 GAFGFLHGMKVPHVGRVTMDLSLFDVTDLPEAAVRAGDYIEVFGRNVVIDDVARAGGTIG 360

Query: 355 YDLLVRIGTRYAKFY 369
           Y+LL  +G RY + Y
Sbjct: 361 YELLTSLGRRYHRTY 375


>gi|150395954|ref|YP_001326421.1| alanine racemase [Sinorhizobium medicae WSM419]
 gi|150027469|gb|ABR59586.1| alanine racemase [Sinorhizobium medicae WSM419]
          Length = 408

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 178/364 (48%), Positives = 239/364 (65%), Gaps = 2/364 (0%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL +DL AL +NW  MN  SG AR AAV+K NAYGLG  + APALY AG +DFFV SVEE
Sbjct: 41  RLTVDLAALADNWRMMNERSGRARAAAVLKGNAYGLGVMQAAPALYAAGARDFFVASVEE 100

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           G +LR   P+ R++VL G+ PG E + F+ +L+P+I+S  QL ++   +S    HP  L 
Sbjct: 101 GAELRPLVPEGRVYVLAGMWPGNEALFFENDLVPIINSQEQLAYFMAALSERGDHPCVLH 160

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           VDTG NRLGLS +EAL   H+          L++SHLACADDP   +N  QL+RFR + +
Sbjct: 161 VDTGMNRLGLSPEEALRLVHDPVRPASFSPVLVMSHLACADDPGHPMNRHQLQRFREVTA 220

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            ++G+ ASLA+S G+ LG +YHF LTRPGI++YGG       +PM+ VV AEARI+ IR 
Sbjct: 221 FFEGVPASLANSGGVFLGEDYHFDLTRPGIAVYGGEAVDGDVNPMKPVVIAEARIVQIRT 280

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
             +GE  SYG   +  RDS IA  AIGYADGY  ++SG       ++  G  GF+ G  V
Sbjct: 281 VPSGESASYGASVRFGRDSRIATVAIGYADGYHRSVSGGGVTLRQAMPSGAFGFLHGRKV 340

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           P +G++TMD+++FD+TD    ++  GDYI++FG +I +DDVA A GT  Y+LL  +G RY
Sbjct: 341 PHVGRVTMDLSLFDVTDLPESTVRAGDYIELFGRNIPIDDVARAGGTIGYELLTSLGRRY 400

Query: 366 AKFY 369
            + Y
Sbjct: 401 HRTY 404


>gi|190891117|ref|YP_001977659.1| alanine racemase [Rhizobium etli CIAT 652]
 gi|190696396|gb|ACE90481.1| alanine racemase protein [Rhizobium etli CIAT 652]
          Length = 333

 Score =  325 bits (833), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 160/329 (48%), Positives = 221/329 (67%), Gaps = 2/329 (0%)

Query: 43  LGCEKIAPALYNAGVQDFFVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPV 102
           +G E    ALY AG +DFFV +V+EGV LRLY P+ARIFVL GI PG E+  FD +L+PV
Sbjct: 1   MGIEDAGEALYTAGARDFFVATVDEGVTLRLYAPEARIFVLSGIWPGTERRFFDNDLVPV 60

Query: 103 ISSVPQLTFYSKLMSCGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIIS 162
           ISS  Q  F+  +++    +P AL VDTGFNRLGL + +A+    +          L++S
Sbjct: 61  ISSDEQFAFWMAVLADYGDYPCALHVDTGFNRLGLHIDDAIALADDVSRPASFAPVLVMS 120

Query: 163 HLACADDPSSHVNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGG 222
           HLAC DDPS  +N  QLE FR + + Y+G+++SLA+S+GI LG +YHF+LTRPGI+LYGG
Sbjct: 121 HLACGDDPSHAMNRQQLESFRRVTAAYEGVDSSLAASAGIFLGEDYHFELTRPGIALYGG 180

Query: 223 TDKINKSHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLT 282
                 ++PM+ V TAEAR+I +R   AGE VSYG   +L RDS +A+ + GYADGY  +
Sbjct: 181 EVVCGMANPMRPVATAEARVIQVRTVKAGETVSYGRALQLPRDSRLAIVSAGYADGYMRS 240

Query: 283 LSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPD 340
            S         V  GG+GFI G+ VP+ G+ITMD+T+FD+TD    ++  GDY+++FG +
Sbjct: 241 QSSGGVPLRQVVPQGGQGFIAGHKVPVAGRITMDLTIFDVTDLPENAVRAGDYVELFGKN 300

Query: 341 IKLDDVALASGTTNYDLLVRIGTRYAKFY 369
           + LDDVA A+GT  Y++L  +G R+ + Y
Sbjct: 301 VALDDVARAAGTIGYEILTSMGLRHERRY 329


>gi|86357070|ref|YP_468962.1| alanine racemase protein [Rhizobium etli CFN 42]
 gi|86281172|gb|ABC90235.1| alanine racemase protein [Rhizobium etli CFN 42]
          Length = 333

 Score =  322 bits (824), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 161/329 (48%), Positives = 220/329 (66%), Gaps = 2/329 (0%)

Query: 43  LGCEKIAPALYNAGVQDFFVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPV 102
           +G E    ALY AG +DFFV +V+EGV LRLY P+ARIFVL GI PG E+  FD +L+PV
Sbjct: 1   MGIEDAGEALYLAGARDFFVATVDEGVTLRLYAPEARIFVLSGIWPGTERRFFDNDLVPV 60

Query: 103 ISSVPQLTFYSKLMSCGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIIS 162
           ISS  Q  F+  +++    +P AL VDTGFNRLGL + +A+    +          L++S
Sbjct: 61  ISSDEQFAFWMAVLADYGDYPCALHVDTGFNRLGLHIDDAIALADDVSRPASFAPVLVMS 120

Query: 163 HLACADDPSSHVNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGG 222
           HLAC DDPS  +N  QLE FR + + Y+GI++SLA+S+GI LG +YHF LTRPGI+LYGG
Sbjct: 121 HLACGDDPSHLMNRQQLESFRKVTAAYEGIDSSLAASAGIFLGEDYHFDLTRPGIALYGG 180

Query: 223 TDKINKSHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLT 282
                 ++PM+ V T EARII +R   AGE VSYG   +L RDS +A+ + GYADGY  +
Sbjct: 181 EAVCGVTNPMRPVATTEARIIQVRTVKAGETVSYGRALQLHRDSRLAIVSAGYADGYMRS 240

Query: 283 LSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPD 340
            S        +V  GG+GFI G+ VP+ G+ITMD+T+FD+TD    ++  GDY+++FG +
Sbjct: 241 QSSGGVPLRQAVPQGGQGFIAGHKVPVAGRITMDLTIFDVTDLPENAVRAGDYVELFGKN 300

Query: 341 IKLDDVALASGTTNYDLLVRIGTRYAKFY 369
           + LDDVA A+GT  Y++L  +G R+ + Y
Sbjct: 301 MALDDVARAAGTIGYEILTSMGLRHERRY 329


>gi|163760547|ref|ZP_02167628.1| putative alanine racemase protein [Hoeflea phototrophica DFL-43]
 gi|162282162|gb|EDQ32452.1| putative alanine racemase protein [Hoeflea phototrophica DFL-43]
          Length = 374

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 161/365 (44%), Positives = 219/365 (60%), Gaps = 9/365 (2%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           R+ +DLTAL  NW S+  LSG+AR  A VK + YG+G  + A  L   G +DFFV    E
Sbjct: 16  RMSVDLTALAANWLSLRELSGSARCGAAVKADGYGIGAIEAASRLAREGCRDFFVADANE 75

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           G  LR + P  RI VL G+       I   +L+PVI+S  Q  F++          YAL 
Sbjct: 76  GASLRPHLPDVRIHVLNGVFEDSFAQILAHDLVPVINSTEQAAFWTGTAD---GRAYALH 132

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGL+ ++A  +  +         +L++SH ACAD+P   +N+ Q+E F  L +
Sbjct: 133 IDTGMNRLGLTPEQAAAYAQSDAPPP----ALLMSHFACADEPGHPLNARQIEMFEALKA 188

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            +  IEASLA+S+GI LG   H  LTRPGISLYGG    + +  M+ VVTAE R++ IR+
Sbjct: 189 CFPSIEASLANSAGIHLGKPAHHDLTRPGISLYGGNPVADANPKMRPVVTAETRVLQIRQ 248

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
           A AG+ VSYG    L+RDS IAV  IGYADG+    SG       +   G  G I G  V
Sbjct: 249 ARAGQPVSYGAAHFLSRDSRIAVCGIGYADGFLRAGSGAGVPLRSAAPKGAFGAINGKRV 308

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           P++GKITMD+TMFD+TD     I  G +I++FGP I L++ A A+GT +Y++L  +G R+
Sbjct: 309 PVIGKITMDLTMFDVTDLGEDEIGAGSWIELFGPTISLEEAAQAAGTISYEMLTSLGRRH 368

Query: 366 AKFYT 370
           A+ YT
Sbjct: 369 ARRYT 373


>gi|218662157|ref|ZP_03518087.1| putative alanine racemase [Rhizobium etli IE4771]
          Length = 325

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 163/316 (51%), Positives = 207/316 (65%), Gaps = 11/316 (3%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL +DLTAL  NW  M   SG AR AAVVK +AYGLG E    ALY AG +DFFV +V+
Sbjct: 21  LRLTVDLTALTENWRDMARRSGAARAAAVVKADAYGLGIEDAGEALYTAGARDFFVATVD 80

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           EGV LRLY P ARIFVL GI PG E+  FD +L+PVISS  QL F+  +++    +  AL
Sbjct: 81  EGVTLRLYAPDARIFVLSGIWPGTERRFFDNDLVPVISSDEQLAFWMAVLADYGDYSCAL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
            VDTGF   G         T  SF   L     ++SHLAC DDP++ +N  QLE FR + 
Sbjct: 141 HVDTGFTGWGCIS------TMPSFAPVL-----VMSHLACGDDPTNAMNRQQLESFRRVT 189

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + Y+GI++SLA+S+GI LG +YHF LTRPGI+LYGG      ++PM+ V TAEARII +R
Sbjct: 190 AAYEGIDSSLAASAGIFLGEDYHFDLTRPGIALYGGEAVCGMANPMRPVATAEARIIQVR 249

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AGE VSYG   +L RDS +A+ + GYADGY  + S        +V  GG+GFI G+ 
Sbjct: 250 TVGAGETVSYGRALQLPRDSRLAIVSAGYADGYMRSQSSGGVPLRQAVPQGGQGFIAGHK 309

Query: 307 VPILGKITMDMTMFDI 322
           VP+ G+ITMD+T+FD+
Sbjct: 310 VPVAGRITMDLTIFDV 325


>gi|110633340|ref|YP_673548.1| alanine racemase [Mesorhizobium sp. BNC1]
 gi|110284324|gb|ABG62383.1| alanine racemase [Chelativorans sp. BNC1]
          Length = 389

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 155/369 (42%), Positives = 229/369 (62%), Gaps = 11/369 (2%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL +DL+AL  N+  +   S  A  AAV+K +AYGLG + +  AL+ AG + FFV   +E
Sbjct: 20  RLTVDLSALVANYQLLARRSAPAGAAAVLKADAYGLGLKPVGSALWAAGCRRFFVALPQE 79

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIF-DTNLIPVISSVPQLTFY-SKLMSCGVSHPYA 125
           G++LR   P+A IFVL G+   +    + +  LIPV++S   ++ + +   +   S P A
Sbjct: 80  GIELRAILPEAEIFVLTGLFAVESAAAYREARLIPVLNSQSDISIWEAHGWNDQRSRPCA 139

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLS--LIISHLACADDPSSHVNSVQLERFR 183
           + VDTG NRLGL+ + A        N   G L+  L++SHLACAD P   +N  QLE F+
Sbjct: 140 VHVDTGMNRLGLTPERARSLAEE--NALTGALTPILLMSHLACADTPDHPLNRRQLELFQ 197

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARII 243
            + + +   E+SL +S+GI LG ++   LTRPGI+LYGG      ++PM+ V T EAR++
Sbjct: 198 AVRTLFPQSESSLCNSAGIFLGSDFLCDLTRPGIALYGGAPVKGIANPMRAVATVEARVV 257

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R   AGE VSYG    L RDS+IAV + GYADGY L  SG       +V    +GFI 
Sbjct: 258 QVRHVRAGETVSYGA-TPLARDSVIAVCSAGYADGYHLAGSGDRVPLRRAVRKAAEGFIH 316

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEV---GDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
           G  VP++G++TMD+T+FD+T+ + ++V   GD+I++FGP++ +D+VA A+GT  Y+LL  
Sbjct: 317 GRRVPVVGRVTMDLTLFDVTE-VGMDVIAPGDHIELFGPNMPIDEVAEAAGTIAYELLTS 375

Query: 361 IGTRYAKFY 369
           +G RY + Y
Sbjct: 376 LGRRYYREY 384


>gi|307946726|ref|ZP_07662061.1| alanine racemase [Roseibium sp. TrichSKD4]
 gi|307770390|gb|EFO29616.1| alanine racemase [Roseibium sp. TrichSKD4]
          Length = 400

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 204/366 (55%), Gaps = 10/366 (2%)

Query: 8   RLKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           RL IDL A+  NW  + N LS  A  AA VK +AYG G  + + ALY+ G + FFV    
Sbjct: 37  RLTIDLKAITANWTILKNKLSDRAECAATVKADAYGTGLTQASKALYDDGCRTFFVALPV 96

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCGVSHPYA 125
           E +KL    P A I+VL G+ PG  K + +  + PV++S  ++  ++      G  HP A
Sbjct: 97  EALKLCRGMPDATIYVLDGLFPGTAKTLAENGIRPVLASTDEVQEWAAFCRETGQHHPAA 156

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           L VDTG +RLGLS  E  +   N   +++   SLI+SHLAC  DP   +NS QL+RF+ L
Sbjct: 157 LHVDTGIHRLGLSAAEFEEVMLNGDIREVFTPSLIMSHLACGADPEHPMNSEQLKRFKNL 216

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
            S Y  I  SLA+S+G+ LG +YHF L RPGISLYGG       +PMQ  V  EARI++ 
Sbjct: 217 TSAYPDIPKSLANSAGVFLGEDYHFDLVRPGISLYGGKALDTMPNPMQPAVKVEARIMMA 276

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    G+ + YG  +   RD  +AV A GYADG       +    S  +  G    I+G+
Sbjct: 277 RSVPQGDTIGYGAMQTARRDLRVAVVAAGYADGM------MRRAGSTDIAPGAYAMIEGH 330

Query: 306 MVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
             P+LG+++MDM   D+TD        G ++++ GP +   D+A  + T +Y+ L  +G 
Sbjct: 331 KAPLLGRVSMDMITLDVTDISPHLTRRGAFVEMMGPQLAASDLAAYADTIDYEYLTNLGR 390

Query: 364 RYAKFY 369
           R+ + Y
Sbjct: 391 RFLRRY 396


>gi|298291077|ref|YP_003693016.1| alanine racemase [Starkeya novella DSM 506]
 gi|296927588|gb|ADH88397.1| alanine racemase [Starkeya novella DSM 506]
          Length = 374

 Score =  255 bits (651), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 142/365 (38%), Positives = 211/365 (57%), Gaps = 13/365 (3%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL+AL  N+  + A    A+ AAVVK +AYGLG    A  L++AG + FFV  + E 
Sbjct: 15  LTIDLSALAANFRDVAARVAPAKCAAVVKGDAYGLGLVPTASTLWHAGARTFFVALLSEA 74

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYALQ 127
            KLR   P A IFVL G+ PG E       L+PV+ SVP++  + +     G   P AL 
Sbjct: 75  RKLRELLPDAEIFVLNGLFPGTEATYQQHALLPVLGSVPEIERWQQFCERTGEPLPAALH 134

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLG-QLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           VDTG NRLGLS  EA++        +LG  L+L++SHLACAD+P   +   QLE F+ ++
Sbjct: 135 VDTGMNRLGLSAAEAVNVAEG--RDELGFPLALLMSHLACADEPGHPLTDRQLEDFQAIV 192

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + +  + ASLA+S+G L  P+ HF L RPGI++YG   + + + P+Q VV  + RI+ IR
Sbjct: 193 ALFPDVRASLANSAGALGDPSLHFDLVRPGIAVYGARPRADVA-PLQPVVRLDLRIVQIR 251

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
           +   GE + YG      R+S +A+ + GYADG P   S  D      +  G +  + G+ 
Sbjct: 252 RVHEGETIGYGAAHTAKRESRVAILSAGYADGIPRLASASD------LRPGAEAVVGGHR 305

Query: 307 VPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
            P++G+I+MD+   DIT  D  ++  GD+  + G  + L+D+A  S T +Y++L  +G R
Sbjct: 306 CPLIGRISMDLLAVDITDVDEDAVAAGDFATLLGDGLALEDLARHSATIDYEILTSLGRR 365

Query: 365 YAKFY 369
           Y + +
Sbjct: 366 YHRRW 370


>gi|154253914|ref|YP_001414738.1| alanine racemase [Parvibaculum lavamentivorans DS-1]
 gi|154157864|gb|ABS65081.1| alanine racemase [Parvibaculum lavamentivorans DS-1]
          Length = 408

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 145/367 (39%), Positives = 202/367 (55%), Gaps = 7/367 (1%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  N+  + A +  A  +AVVK NAYGLG   +A  L   G + FFV    EG
Sbjct: 29  LTIDLDAVAANYDMLRAEAAGAEVSAVVKANAYGLGMGPVARRLAAEGCRSFFVAEANEG 88

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQV 128
             LR   P A I+VL G+ PG         L+P ++S+ ++  + +    G S   AL  
Sbjct: 89  AALRALLPDAEIYVLNGLFPGTAGFYAAHGLVPCLASMAEVAEWREAAKGG-SLKAALHF 147

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR----T 184
           DTG NRLG+S  +A             ++ LI+SHLACADD +S +N+ QL RFR     
Sbjct: 148 DTGMNRLGMSEADAAALAAEGALTAGIEVRLIMSHLACADDAASPMNARQLARFRGLRTI 207

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           L   + G +ASLA+S GI LG +YHF L RPG+SLYGG+    + HP +  VT EAR++ 
Sbjct: 208 LAGRFAGAKASLANSGGIYLGKDYHFDLVRPGVSLYGGSPFTGREHPFRPAVTVEARVLA 267

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R+  A E   YG   K    + +AV A GYADGY   LS            GG+  I G
Sbjct: 268 VREMAAEETAGYGATWKARGTARMAVLAAGYADGYMRALSSPRPNGDGGDDYGGQVRIAG 327

Query: 305 YMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
           Y  P+ G+I+MDM + D++     +++ GD  ++ GP I +DDV L +GT  Y++L  +G
Sbjct: 328 YTAPVAGRISMDMLIVDVSGLPEGAVKRGDMAELIGPHITVDDVGLKAGTLGYEILTSLG 387

Query: 363 TRYAKFY 369
            RY + Y
Sbjct: 388 GRYMRIY 394


>gi|46201989|ref|ZP_00208341.1| COG0787: Alanine racemase [Magnetospirillum magnetotacticum MS-1]
          Length = 371

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 145/365 (39%), Positives = 201/365 (55%), Gaps = 14/365 (3%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L ID+ A+  NW  ++AL   A  +AVVK + YGLG E IAPAL  AG Q FFV  V EG
Sbjct: 11  LTIDVAAIVANWKRLSALVAPAEASAVVKADCYGLGMEHIAPALSAAGCQSFFVACVNEG 70

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA-LQ 127
           + LR   P A I VL G   G E      NLIPV++S+ Q+T ++     G   P A + 
Sbjct: 71  IALRRILPAAVIHVLSGPLGGDEGEFAAHNLIPVLNSLAQITGWAGFAKKGSGAPAAAIH 130

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGLS  E              +  L++SHLACADD  S +N+ QL   R L S
Sbjct: 131 IDTGMNRLGLSETELERLAAKPEITAAIRPILVMSHLACADDADSPMNARQLTTLRRLAS 190

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
           H   +  S+A+SSGI LG  +H  L RPG +LYG      + +PM  VV  + +I+ +R 
Sbjct: 191 HLPALPQSIAASSGIFLGRGFHLGLVRPGAALYGLNPMPGRPNPMSQVVKLQGKIVQVRD 250

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
             + + V YG   ++     +AV A+GYADG+  +LS             G G I G  V
Sbjct: 251 VDSPQTVGYGATHRVEGKRKLAVVAVGYADGWFRSLSNR-----------GHGMIGGMKV 299

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           P+ G+I+MD+T FD+TD  +     G +I++ GPD+  D VA  +GT  Y++L  +G R+
Sbjct: 300 PVAGRISMDLTTFDVTDVPAEHAHPGAWIELIGPDLSPDRVADEAGTIGYEILTSLGRRH 359

Query: 366 AKFYT 370
            + +T
Sbjct: 360 HRRWT 364


>gi|328544029|ref|YP_004304138.1| Alanine racemase, biosynthetic [polymorphum gilvum SL003B-26A1]
 gi|326413773|gb|ADZ70836.1| Alanine racemase, biosynthetic [Polymorphum gilvum SL003B-26A1]
          Length = 415

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 202/366 (55%), Gaps = 10/366 (2%)

Query: 9   LKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L +D  A+ +NW ++   L   AR AA VK +AYG G      AL  +G   FFV    E
Sbjct: 49  LTVDTAAIADNWRALAGQLGPGARCAATVKADAYGCGIPATVRALAASGCDTFFVALPAE 108

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCGVSHPYAL 126
           G+ +R   P A I+VL G+ PG      +  L PV+ S+P+L  ++    S  V    A+
Sbjct: 109 GIAVREAAPGATIYVLDGLFPGTAPAYAEARLRPVLGSLPELEEWALFCRSRKVRLEAAV 168

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
            VDTG NRLGL+ QEA     +        L+L+ISHLAC  +P   +N  QLERFRTL 
Sbjct: 169 HVDTGMNRLGLTEQEAERLAGDRDLLDSFALALVISHLACGAEPGHPLNRQQLERFRTLS 228

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
            H+     SLA+S+GI LG +YHF L RPGI+LYGG    +  +PM+ V   EARI+ +R
Sbjct: 229 GHFPDAVRSLANSAGIFLGADYHFDLVRPGIALYGGKALDSFDNPMRPVARVEARILQLR 288

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AGE V YG  + + RD+ +AV A GYADG      G D         GG G+I G+ 
Sbjct: 289 TVRAGEGVGYGLAQTVRRDTRLAVVAAGYADGLLRRAGGSDDRP------GGHGWIVGHR 342

Query: 307 VPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           VP+ G+I+MDM   D+TD  +  +  G  +++ GP +   ++A  + T +Y+ L  +G R
Sbjct: 343 VPVFGRISMDMQALDVTDVPAALLRRGAMVELIGPHVAASELAAVADTIDYEYLTALGRR 402

Query: 365 YAKFYT 370
           + + Y 
Sbjct: 403 FHRRYA 408


>gi|254473465|ref|ZP_05086862.1| alanine racemase [Pseudovibrio sp. JE062]
 gi|211957581|gb|EEA92784.1| alanine racemase [Pseudovibrio sp. JE062]
          Length = 383

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 138/366 (37%), Positives = 210/366 (57%), Gaps = 9/366 (2%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVV-KDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           +L IDLTAL++NW  +N   G+  T AVV K N YG G  ++   LY+AG + FFV   E
Sbjct: 21  KLTIDLTALRSNWCYLNGKVGDGCTCAVVLKANGYGTGAAEVGKTLYHAGARVFFVALPE 80

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL-MSCGVSHPYA 125
           EG++LR   P A I+VL G+   +EK  +D +L PV++S+ ++  +S    S     P A
Sbjct: 81  EGIELRKELPHAEIYVLNGLFRHREKFYYDFDLKPVLNSLEEVAEWSSFAQSLQEELPAA 140

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           L  DTG +RLG+S+ +AL    ++   K  ++ L++SHLACAD P   +N  QL RF+ +
Sbjct: 141 LHFDTGMHRLGMSIGDALQIGESAHLLKSIRIDLVMSHLACADTPDHGLNEKQLNRFQRV 200

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
              +     SL++S+GI LG +YHF + RPGI+LYGG    ++++PM  V   +A II +
Sbjct: 201 CELFPEARKSLSNSAGIFLGDDYHFDMVRPGIALYGGNPVPDETNPMLPVAHVQAEIISL 260

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+   G+ V YG  +   R S IA    GYADG    +   D + +     G + +I G+
Sbjct: 261 REVPHGDPVGYGASRVTPRKSRIATINAGYADGLHRLVGSSDDQPN-----GARVYIGGH 315

Query: 306 MVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
             PI G+++MDM   D+TD     +  G  ++I G  + +D++A  + T  Y+LL  +G 
Sbjct: 316 FAPIFGRVSMDMIAVDVTDIPEEHLSRGAPVEIMGAHVNVDELAEFAQTIPYELLCSLGA 375

Query: 364 RYAKFY 369
           RY + Y
Sbjct: 376 RYTRHY 381


>gi|154246344|ref|YP_001417302.1| alanine racemase [Xanthobacter autotrophicus Py2]
 gi|154160429|gb|ABS67645.1| alanine racemase [Xanthobacter autotrophicus Py2]
          Length = 357

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 145/363 (39%), Positives = 210/363 (57%), Gaps = 11/363 (3%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL A+ +NW ++ AL+  A  AAVVK NAYGLG +++AP L+ AG ++FFV   +E V 
Sbjct: 1   MDLGAIADNWRTIAALAAPAECAAVVKANAYGLGIDRVAPVLWRAGARNFFVAHFKEAVA 60

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK-LMSCGVSHPYALQVD 129
           LR   P+A I+VL G+ P         NL PV+ S P+++ +S      GV  P A+ VD
Sbjct: 61  LRALLPEAIIYVLNGLLPDCAADYAAANLRPVLGSTPEISDWSDYCRDAGVKLPAAIHVD 120

Query: 130 TGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHY 189
           TG +RLGLSL+EA+  +  +F       SLI+SHLACAD P   + + Q   F  ++  +
Sbjct: 121 TGMHRLGLSLEEAVQLS-GTFRLLGFTPSLIMSHLACADTPGHVLTARQRMVFADVVRRF 179

Query: 190 KGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKAL 249
            GI  SLA+S+G LLG ++ F+L RPGI LYGG   IN   P++ VV  E +++ +  A 
Sbjct: 180 PGIPGSLANSAGTLLGRDFRFELVRPGIFLYGGI-AINGVPPLRPVVRLEVKVVQVSTAP 238

Query: 250 AGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPI 309
           AGE V YG  ++L R S +A  +IGYADG         +  S     G +  + G    +
Sbjct: 239 AGETVGYGAAQRLKRPSRLATVSIGYADGL------FRAGGSTDAIKGVEAIVHGQRCHL 292

Query: 310 LGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           +G+++MD+   DITD     ++ GD     G  I +DD+A  SGT  Y++L  +G RYA+
Sbjct: 293 VGRVSMDLATLDITDLPDGVVQRGDTAVFLGDGISVDDLAARSGTIGYEVLTSLGARYAR 352

Query: 368 FYT 370
            Y 
Sbjct: 353 HYV 355


>gi|170751205|ref|YP_001757465.1| alanine racemase [Methylobacterium radiotolerans JCM 2831]
 gi|170657727|gb|ACB26782.1| alanine racemase [Methylobacterium radiotolerans JCM 2831]
          Length = 377

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 141/365 (38%), Positives = 199/365 (54%), Gaps = 16/365 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  N+  + A +G A  AAVVK +AYGLG +++AP L  AG + FFV  V EG
Sbjct: 22  LTIDLAALAENYRLLAARAGTATCAAVVKADAYGLGADRVAPVLAAAGCRHFFVAQVGEG 81

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLT-FYSKLMSCGVSHPYAL 126
           V LR +  P A I VL G  PG E    D +L+PV++ + QL  +           P  L
Sbjct: 82  VALRSILGPGAVIAVLNGAAPGSEATCADHDLVPVLNDLSQLDGWQGLARRRARRLPAIL 141

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           QVDTG  R G +  E               L L++SHLACA +P S VN+ QL  FR + 
Sbjct: 142 QVDTGMARFGFAPDEVGALLDRPDALAGLDLRLVMSHLACAGEPDSPVNAAQLSVFRAVR 201

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
                + ASLA+SSGI LGP++HF L RPG +LYG   +    +PM+ V+   AR++  R
Sbjct: 202 RRLPAVPASLAASSGIFLGPDFHFDLVRPGAALYGIAPQEGAPNPMRPVIGLRARVMQTR 261

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AG  V YG    + RDS +A  AIGYADG+  + +            GG  +  G  
Sbjct: 262 SVPAGTPVGYGHAATVARDSRLATVAIGYADGFFRSTA------------GGAAWFGGVR 309

Query: 307 VPILGKITMDMTMFDITDSL--SIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           +P++G+++MD  + D+TD+   ++  G  + I GP+  +D  A A+GT  Y++L  +G R
Sbjct: 310 LPVVGRVSMDSLVLDVTDAAPGTLGPGALVDIVGPERDVDAAAAAAGTIGYEVLTNLGHR 369

Query: 365 YAKFY 369
           + + Y
Sbjct: 370 FHRVY 374


>gi|118588136|ref|ZP_01545546.1| alanine racemase [Stappia aggregata IAM 12614]
 gi|118439758|gb|EAV46389.1| alanine racemase [Stappia aggregata IAM 12614]
          Length = 380

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 144/369 (39%), Positives = 210/369 (56%), Gaps = 16/369 (4%)

Query: 8   RLKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           RL IDL A+ +NW  + + + G    AAV+K +AYG G +K A ALY AG + FFV    
Sbjct: 17  RLTIDLDAIVSNWSLLKDKVGGGTDCAAVLKADAYGTGQDKTAAALYQAGCRTFFVAVPT 76

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCGVSHPYA 125
           E + LR   P A I+VL G+ PG  +     ++ PV+ S+ +L  +S++      S P A
Sbjct: 77  EALTLRASLPDAVIYVLDGLFPGTAEHFLKHDIRPVLGSLEELVEWSEICRGASKSFPAA 136

Query: 126 LQVDTGFNRLGLSLQEALDFTHN-SFNKKLG--QLSLIISHLACADDPSSHVNSVQLERF 182
           + V+TG +RLGL+ +E   FT   S    LG  Q SL++SHLAC  +P   +N  QL+ F
Sbjct: 137 VHVNTGIHRLGLTPEE---FTQALSDTAALGPFQPSLVMSHLACGSNPDHPMNRRQLKLF 193

Query: 183 RTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARI 242
               + +  I  SLA+S+G+LLGP YHF + RPGI+LYGG     + +PM+ V   EARI
Sbjct: 194 TETTAPFPLIPRSLANSAGVLLGPEYHFDVVRPGIALYGGLAIETEPNPMKPVAKVEARI 253

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           +++R    G+ + YG ++  TR    AV A GYADG  +  +G   E       GG G I
Sbjct: 254 MMVRDVPKGDTIGYGAKQTATRPLRNAVVAAGYADGM-IRRAGSTDERP-----GGFGTI 307

Query: 303 KGYMVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
            GY  PILG+I+MDM   D+TD     +  G ++++ GP +   D+A  + T +Y+ L  
Sbjct: 308 GGYKAPILGRISMDMITLDVTDVPDHLLRRGAFVEMLGPGVAASDLAAYAETIDYEYLTS 367

Query: 361 IGTRYAKFY 369
           +G R+ + Y
Sbjct: 368 LGRRFERVY 376


>gi|58040489|ref|YP_192453.1| alanine racemase [Gluconobacter oxydans 621H]
 gi|58002903|gb|AAW61797.1| Alanine racemase [Gluconobacter oxydans 621H]
          Length = 367

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 138/364 (37%), Positives = 211/364 (57%), Gaps = 18/364 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L + L A+  N++ + AL   A  A VVK +AYGL  +++AP L   G   FFV  ++EG
Sbjct: 17  LGVSLRAIAENYNLVAALGAGAECAVVVKADAYGLSADRVAPVLAARGAGTFFVAHLDEG 76

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCGVSHPYALQ 127
           + LR   P+ RIFVL+G  PG E  +   NL PV++ + Q+  + +L    G + P ALQ
Sbjct: 77  IALRAILPEVRIFVLHGFMPGCEGSMQAHNLFPVLNDLEQVRSWQRLCREKGCAFPAALQ 136

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
            DTG +R GLS Q   D    S  + L  L L++SHLACAD P +  N++Q +RF  + +
Sbjct: 137 FDTGMSRFGLSDQ---DLEDRSVFEGL-NLQLVMSHLACADTPDNPANAIQRKRFVEMAA 192

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+  SLA+SSGI LGP+YHF+L RPG +LY G      S  +  VV+ +ARI+ IR 
Sbjct: 193 GFPGVPRSLAASSGIFLGPDYHFELIRPGAALY-GIAPFEGSRVLNPVVSLDARIVQIRT 251

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
             AG+ V YG     T+ + IA   +GYADG+    +G    H  +V+ G         +
Sbjct: 252 VQAGDRVGYGLGWTATKPTRIATLGLGYADGFFRAQAG----HG-AVWYGQT------RL 300

Query: 308 PILGKITMDMTMFDITDSLS-IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
           P++G+++MD    D+TD+ + ++ GD + + GP   +D +A ++GT  Y++L  +G+R+ 
Sbjct: 301 PVIGRVSMDSISVDLTDAPAGLKAGDVLSVLGPAQDVDALARSAGTIGYEVLTALGSRFH 360

Query: 367 KFYT 370
           + Y 
Sbjct: 361 RVYV 364


>gi|218459378|ref|ZP_03499469.1| alanine racemase protein [Rhizobium etli Kim 5]
          Length = 255

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 169/250 (67%), Gaps = 2/250 (0%)

Query: 122 HPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
           +P AL VDTGFNRLGL + +A+    +          L++SHLAC DDP++ +N  QLE 
Sbjct: 2   YPCALHVDTGFNRLGLHIDDAIALADDVSRPASFAPVLVMSHLACGDDPTNAMNRQQLES 61

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEAR 241
           FR + + Y+GI++SLA+S+GI LG +YHF LTRPGI+LYGG      ++PM+ V TAEAR
Sbjct: 62  FRRVTAAYEGIDSSLAASAGIFLGEDYHFDLTRPGIALYGGEAVCGMANPMRPVATAEAR 121

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           II +R   AGE VSYG   +L RDS +A+ + GYADGY  + S        +V  GG+GF
Sbjct: 122 IIQVRTVGAGETVSYGRALQLPRDSRLAIVSAGYADGYMRSQSSGGVPLRQAVPQGGQGF 181

Query: 302 IKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
           I G+ VP+ G+ITMD+T+FD+TD    ++  GDY+++FG ++ LDDVA A+GT  Y++L 
Sbjct: 182 IAGHKVPVAGRITMDLTIFDVTDLPENAVRAGDYVELFGKNMPLDDVARAAGTIGYEILT 241

Query: 360 RIGTRYAKFY 369
            +G R+ + Y
Sbjct: 242 SMGLRHERRY 251


>gi|83591749|ref|YP_425501.1| alanine racemase [Rhodospirillum rubrum ATCC 11170]
 gi|123527432|sp|Q2RXD1|ALR_RHORT RecName: Full=Alanine racemase
 gi|83574663|gb|ABC21214.1| alanine racemase [Rhodospirillum rubrum ATCC 11170]
          Length = 374

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 136/366 (37%), Positives = 200/366 (54%), Gaps = 16/366 (4%)

Query: 9   LKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L +DL A+ +NW ++   L   A  A VVK NAYGLG  K+ PAL  AG +DF V  ++E
Sbjct: 11  LTVDLDAIADNWLALRGRLRPGASCAGVVKANAYGLGARKVVPALLAAGCRDFVVAQIDE 70

Query: 68  GVK-LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYA 125
           G+  L L    AR+FVL G   G E  + D+ LIPV++S  Q+  ++K  +  G   P A
Sbjct: 71  GLDILDLLPADARLFVLSGPPEGAEDEVLDSALIPVLNSPDQIDRWAKACARAGRKAPAA 130

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           L VDTG  RLGL+  E      +          L+++HLACAD+P   +N+ Q   F   
Sbjct: 131 LHVDTGMRRLGLTPLELDALLADPRPLAAFTPVLVMTHLACADEPDHPLNAEQRALFAAA 190

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
            + + G+ ASLA++SGI LGP +HF L RPGI LYGG   +  ++PM+ VV  + +I+ +
Sbjct: 191 AARFPGLRASLANTSGIFLGPEWHFDLARPGIGLYGGNPTVGTANPMRQVVKLQGKILQV 250

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+      V YG        S IA   +GYADG+P +                 G + G 
Sbjct: 251 RRIDTPLSVGYGATHTAPAGSTIATVGVGYADGFPRSAGNR-----------AMGLLAGR 299

Query: 306 MVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            VP++G+++MD+  FD++D        G  I + GPD+ +D +A  + T +Y++L R+G 
Sbjct: 300 SVPVVGRVSMDLLTFDVSDVPENLARPGAMIDLLGPDLSVDALADRADTVSYEILTRLGA 359

Query: 364 RYAKFY 369
           RY + Y
Sbjct: 360 RYPRRY 365


>gi|83311194|ref|YP_421458.1| alanine racemase [Magnetospirillum magneticum AMB-1]
 gi|82946035|dbj|BAE50899.1| Alanine racemase [Magnetospirillum magneticum AMB-1]
          Length = 409

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 198/364 (54%), Gaps = 14/364 (3%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L ID+ A+  NW  ++AL   A  +AVVK + YGLG ++IAPAL+ AG + FFV  V EG
Sbjct: 49  LTIDVAAIVANWKRLSALVAPAEASAVVKADCYGLGMDRIAPALFAAGCRSFFVACVNEG 108

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP-YALQ 127
           + LR   P A I VL G   G E       LIPV++S+ Q+T ++     G   P  A+ 
Sbjct: 109 IALRRLLPGAMIHVLSGPMGGDEAEFAAHGLIPVLNSLSQMTGWASFAKKGSGAPAVAIH 168

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG +RLGLS  E              +  L++SHLACADD  S +N+ QL   R L S
Sbjct: 169 IDTGMSRLGLSEPELERLAAKPEILAAMRPILVMSHLACADDSDSPMNARQLTTLRRLAS 228

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
           H   +  S+A+SSGI LG  +H  + RPG +LYG      + +PM  V+  E +I+ +R 
Sbjct: 229 HLPALPQSIAASSGIFLGRGFHLGMVRPGAALYGLNPMPGRPNPMSQVIKLEGKIVQVRD 288

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
             + + V YG   ++     +A+ A+GYADG+  +LS             G G I G  V
Sbjct: 289 VDSPQTVGYGATHRVEGKRRLAIVAVGYADGWFRSLSNR-----------GHGMIGGVKV 337

Query: 308 PILGKITMDMTMFDITDSL--SIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           P++G+++MD+T FD+TD    S   G  IQ+ GP    D +A  + T  Y++L  +G R+
Sbjct: 338 PVVGRVSMDLTTFDVTDVPVESAHPGGLIQLIGPGYGPDHLAAEADTIGYEVLTALGRRH 397

Query: 366 AKFY 369
            + +
Sbjct: 398 LRRW 401


>gi|16125907|ref|NP_420471.1| alanine racemase [Caulobacter crescentus CB15]
 gi|221234670|ref|YP_002517106.1| alanine racemase [Caulobacter crescentus NA1000]
 gi|20137228|sp|Q9A7Q9|ALR_CAUCR RecName: Full=Alanine racemase
 gi|13423069|gb|AAK23639.1| alanine racemase [Caulobacter crescentus CB15]
 gi|220963842|gb|ACL95198.1| alanine racemase [Caulobacter crescentus NA1000]
          Length = 364

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 137/373 (36%), Positives = 210/373 (56%), Gaps = 18/373 (4%)

Query: 1   MHSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDF 60
           M   +  R+ IDL AL +N+ ++ A +G+A  A  VK +AYGLG   +A  L+  G + F
Sbjct: 1   MTDAQDTRITIDLDALAHNYAALRARAGDAEVAPAVKADAYGLGAAPVADRLWAEGARSF 60

Query: 61  FVTSVEEGVKLR--LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC 118
           +V  + EGV LR  L   +A I+VL G  PG  + +    L+PV++S+PQ+  ++     
Sbjct: 61  YVARLAEGVALRRSLGDREATIYVLDGATPGSGEALEGAQLVPVLNSLPQVEAWNVQARS 120

Query: 119 GVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNK-KLGQLSLIISHLACADDPSSHVNSV 177
           G     AL +DTG NRLGL  +E L     SF++ K   + L++SHLACAD P   +N+ 
Sbjct: 121 GRLR-AALHIDTGMNRLGLRPEE-LKVLVGSFDRLKRLDVELVVSHLACADTPEHPLNAT 178

Query: 178 QLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP-MQTVV 236
           QL RF+   +   G+  SLA+S G+ LG  Y F  TRPG+SLYGG  +  + HP ++ V 
Sbjct: 179 QLARFQEAAALLPGVRRSLANSGGLFLGEAYRFDQTRPGVSLYGGGPE-GRPHPEIRAVA 237

Query: 237 TAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFL 296
           T EA I+ +R    GE + YG     + ++ +A+ A GYADG P            + F 
Sbjct: 238 TVEAPILQVRVVPRGESIGYGAGWTASDNTRVAIVAAGYADGVPR-----------AAFP 286

Query: 297 GGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYD 356
            G+ +  G   P+LG+++MD+   D+TD  +   G  +++FG ++ +DD A A+GT+ Y+
Sbjct: 287 RGEVWFDGARRPMLGRVSMDLIAVDVTDCDAARPGAMVELFGANLPVDDAADAAGTSAYE 346

Query: 357 LLVRIGTRYAKFY 369
            L R+  R  + Y
Sbjct: 347 RLTRLTLRGVRRY 359


>gi|330992271|ref|ZP_08316219.1| Alanine racemase [Gluconacetobacter sp. SXCC-1]
 gi|329760470|gb|EGG76966.1| Alanine racemase [Gluconacetobacter sp. SXCC-1]
          Length = 382

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 139/366 (37%), Positives = 208/366 (56%), Gaps = 16/366 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L+I L A+  N+  + A +G A  AAVVK +AYGLG  ++AP L  AG + FFV  +EEG
Sbjct: 22  LEISLGAVAANYRLLRARTGQATCAAVVKADAYGLGAHQVAPVLEQAGAKVFFVAHLEEG 81

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH--PYA 125
           ++LR + +P A+IFVL+G  PG E+      L+PV++S+ Q+  + +  +    H  P A
Sbjct: 82  IRLRPHVSPTAQIFVLHGPMPGTERAFTHHALLPVLNSMEQIAGW-RAHASKAQHALPAA 140

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           LQVDTG +R GLS  +              +  L++SHLACAD P+S  N++Q +R R +
Sbjct: 141 LQVDTGMSRFGLSDADVTALADTPALLDGIETRLVMSHLACADTPASPANALQRDRLRAM 200

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
            +       +L++SSGI LGP+YHF L RPG +LYG     +  +P+Q  V  +ARI+  
Sbjct: 201 AARLPAAPLALSASSGIFLGPDYHFDLVRPGAALYGLAPNADAPNPLQPTVRLQARIVQR 260

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R   AG+ V YG     +    IA   IGYADG+     G  +        GG  ++  Y
Sbjct: 261 RTIKAGDGVGYGLTWHASGPRRIATLGIGYADGF--LRQGASN--------GGCAWLDSY 310

Query: 306 MVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            +PILG+I+MD T  D+T      ++   ++ + GP   +DDVA A+GT  Y++L  +G+
Sbjct: 311 RLPILGRISMDSTTVDVTGVPESVLDQATHVDMIGPRRSVDDVAHAAGTIGYEVLTALGS 370

Query: 364 RYAKFY 369
           R+ + Y
Sbjct: 371 RFHRVY 376


>gi|300023238|ref|YP_003755849.1| alanine racemase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525059|gb|ADJ23528.1| alanine racemase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 380

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 128/364 (35%), Positives = 197/364 (54%), Gaps = 9/364 (2%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           + +DL  +  NW ++ A    A+ AAVVK +AYGLG E++  AL +AG   FF+ + EE 
Sbjct: 18  ITVDLAQIAANWRALAAKVAPAQCAAVVKADAYGLGAERVIAALSHAGCTTFFIATPEEA 77

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYALQ 127
              R   P+A IF L G+  G      +  + PV+S++  +  ++ L    G + P AL 
Sbjct: 78  ETARKLAPEAHIFALDGLVGGCATAFANQGVTPVLSTLDDIAAWAALARMRGETLPAALH 137

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGL +++    T +       +L L++SHLA AD+P    N  QL  F TL +
Sbjct: 138 IDTGLNRLGLPVRDVRRLTADPSVLSGLRLELVMSHLASADNPRDPKNRDQLLAFETLTA 197

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+  SLA+S G++LGP YHF L RPG ++YGG        P++  V   ARI+ +  
Sbjct: 198 LFPGVPRSLAASDGLMLGPAYHFNLVRPGYAIYGGQASQLAPAPVKPAVRVAARILAVAD 257

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V Y    +  R S IA  A GYADG P   S  D         GG   I G++ 
Sbjct: 258 VAPGETVGYSATWRAKRPSRIATIAAGYADGVPRNSSAPDGRP------GGHVLIDGHLA 311

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           P++G+++MD+   D+TD    +++  D+  + G  + ++D  +A+ T  Y++L R+G R+
Sbjct: 312 PLVGRVSMDLITVDVTDLPDGAVKPHDFATLIGEGLTIEDAGIAAATIGYEILTRLGPRF 371

Query: 366 AKFY 369
            + Y
Sbjct: 372 TRLY 375


>gi|332716082|ref|YP_004443548.1| Alanine racemase [Agrobacterium sp. H13-3]
 gi|325062767|gb|ADY66457.1| Alanine racemase [Agrobacterium sp. H13-3]
          Length = 388

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 132/365 (36%), Positives = 208/365 (56%), Gaps = 15/365 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++ A++  ++TAAVVK +AYGLG + ++  L++AG ++FFV  ++E 
Sbjct: 18  LTIDLGALRDNYLALAAMAPTSQTAAVVKADAYGLGADIVSQVLFDAGCRNFFVAHIDEA 77

Query: 69  VKLRL-YTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK-LMSCGVSHPYAL 126
           + LRL  + +ARIFVL G+ PG E       + PV++S+ Q+  ++    + G + P A+
Sbjct: 78  LALRLRLSAEARIFVLNGLQPGNEASCAAMAVTPVLNSLEQIAQWAAHAKNLGKTLPAAV 137

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG  RLGLS +E               ++ ++SHLACAD+P    N+ QL   R   
Sbjct: 138 QIDTGMCRLGLSPEELEVLASRPQLLDDIDVAFVMSHLACADEPDHLSNAAQLSVMRKAA 197

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
             +  +    ++S GI LG +YH  L RPGI+LYGG   + + +PM+ VV  +  +I  R
Sbjct: 198 VAFPDVSVCFSNSGGIFLGNDYHNSLLRPGIALYGGAPSVTRPNPMKPVVRLDVAVIQTR 257

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AG LV YGG  +    + +A  A GYADG P +LS             G  +  G  
Sbjct: 258 DVPAGSLVGYGGSFEAAGPTRLATIAAGYADGLPRSLSNR-----------GAAWYNGVR 306

Query: 307 VPILGKITMDMTMFDITDSL--SIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           +PI G+++MD  + DI+     ++  G ++Q+ GPD  L+D+A  +GT  Y++L  +G R
Sbjct: 307 LPIAGRVSMDSIILDISALPLGTLTQGSFVQMIGPDQTLEDIAEDAGTIAYEILTGLGRR 366

Query: 365 YAKFY 369
           Y + Y
Sbjct: 367 YRRNY 371


>gi|163797505|ref|ZP_02191456.1| alanine racemase [alpha proteobacterium BAL199]
 gi|159177254|gb|EDP61813.1| alanine racemase [alpha proteobacterium BAL199]
          Length = 381

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 139/374 (37%), Positives = 206/374 (55%), Gaps = 31/374 (8%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL IDL A++ N+  +    G    A VVK + YGLG  ++APAL   G + FFV +++E
Sbjct: 14  RLTIDLGAVRRNYRRLVKELGGVPCAGVVKADGYGLGAARVAPALSAEGCRIFFVATLDE 73

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFY-SKLMSCGVSHPYAL 126
            V+LR   P A +  L G+  G E +     ++PV++++ Q+T + +     G S P  L
Sbjct: 74  AVRLRPVLPDATVCCLNGLLAGTEDVFVAHRIVPVLNALDQITRWQTHGGRLGRSLPAIL 133

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLG--------QLSLIISHLACADDPSSHVNSVQ 178
            VDTG NRLGL   E        +++ LG            +ISHLA AD+P +  N++Q
Sbjct: 134 HVDTGMNRLGLGDDE--------WDRVLGTPGVLDGVDWQYLISHLAVADEPDNPANALQ 185

Query: 179 LERFRTLISHY-KGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVT 237
           L RF+ +      G++ASLA+SSGI LG  YHF L RPG++LYGG       +P++  + 
Sbjct: 186 LARFQRVRQRMPNGMKASLANSSGIFLGTPYHFDLGRPGVALYGGRPSSIGPNPLECPIR 245

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
            E R++ +R   AG+ V YG      R S IA  A GYADGY  +LSG     + +V LG
Sbjct: 246 LEGRVLQVRDVPAGDSVGYGNSWTAGRRSRIATVAAGYADGYLRSLSG-----AGTVALG 300

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEV--GDYIQIFGPDIKLDDVALASGTTNY 355
            +        P++G+++MD+   D+TD    E+  G ++++ GP I  D  A A+GT  Y
Sbjct: 301 AR------TCPVVGRVSMDLITVDVTDVPPAEIAPGTFVEVLGPTITPDAAADAAGTIGY 354

Query: 356 DLLVRIGTRYAKFY 369
           +LL  +G RY + Y
Sbjct: 355 ELLTALGRRYVRHY 368


>gi|299133317|ref|ZP_07026512.1| alanine racemase [Afipia sp. 1NLS2]
 gi|298593454|gb|EFI53654.1| alanine racemase [Afipia sp. 1NLS2]
          Length = 383

 Score =  236 bits (601), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 134/377 (35%), Positives = 206/377 (54%), Gaps = 19/377 (5%)

Query: 1   MHSNEFLR---LKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAG 56
           M  N   R   L +DL A+++N+  + + L  +   A VVK + YGLG   ++ AL+  G
Sbjct: 1   MEKNGRFRGGTLAVDLRAVRSNYRLLRSRLRASTLCAGVVKADGYGLGATYVSRALFAEG 60

Query: 57  VQDFFVTSVEEGVKLRLYTPQ-ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL 115
            + FFV  ++EG+ LR Y P+ A IF+L G+  G E+      L+PV++S  Q   ++  
Sbjct: 61  CRHFFVAHLDEGLALRPYLPRSAAIFILNGLPRGAERECAAAGLVPVLNSPEQAGAWAGC 120

Query: 116 MSC-GVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHV 174
               G   P  LQVD+G NRLGL+  EA  F        +  L  I+SHLACAD P+   
Sbjct: 121 ARTRGQRLPAVLQVDSGMNRLGLTAGEAARFAETPARSGVVDLRYIMSHLACADTPAHEA 180

Query: 175 NSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQT 234
           N++QL  FR L   +  +  SLA+SSGI LGP+YHF L RPG +LYG       ++PMQ+
Sbjct: 181 NAMQLATFRQLAGLFPDVPRSLANSSGIFLGPDYHFSLVRPGSALYGVNPDPAATNPMQS 240

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           VV   A++I +R  + G+ V YG   +   ++ +A  ++GYADG+               
Sbjct: 241 VVRLTAKVIQLRNVMPGDCVGYGWDARARGEARLATLSLGYADGFHRAWG---------- 290

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVG--DYIQIFGPDIKLDDVALASGT 352
             GG  F +G  +P++G+++MD  + D +      +G    +++ G D  LDD+A  +GT
Sbjct: 291 -KGGAVFFEGLRLPVVGRVSMDSIVIDASAIAPGRLGPDSEVEVIGDDQPLDDLASVAGT 349

Query: 353 TNYDLLVRIGTRYAKFY 369
             Y++L  +G+RY + Y
Sbjct: 350 IGYEVLTGLGSRYQRIY 366


>gi|304392032|ref|ZP_07373974.1| alanine racemase [Ahrensia sp. R2A130]
 gi|303296261|gb|EFL90619.1| alanine racemase [Ahrensia sp. R2A130]
          Length = 378

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 195/365 (53%), Gaps = 8/365 (2%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           R+ IDL ALK N+  +  L+  A   AVVK N YG G E + PAL++AG + FFV    E
Sbjct: 12  RVTIDLDALKANYTHLAKLAAPAECGAVVKANGYGCGIEVVVPALWDAGCRTFFVAVSSE 71

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYAL 126
           G+++    P AR F+L G+  G E  + D  LIP + SV Q+  ++      G   P A+
Sbjct: 72  GLRVMKTAPDARCFILNGLFTGAENALADAGLIPCLGSVTQIENWAATAKQRGTPLPCAI 131

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
            +D+G NRLGLS  E               + L ++H ACADD        Q ERF    
Sbjct: 132 HMDSGMNRLGLSYDELARTVEQPHLMDHLDVQLFMTHYACADDIGHPQTEAQRERFLQGA 191

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
               G+  S A+S+  L   ++ F L RPGI+LYGG    +  +PM+ VVT E R++  R
Sbjct: 192 DLLPGVPRSAANSAADLQATDHTFDLARPGIALYGGEALNDVDNPMRPVVTLEGRVVQTR 251

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI--KG 304
               G  V YG  + +TR + +A  + GYADGY    S       P  F+        KG
Sbjct: 252 WVERGGAVGYGASETMTRRTRLAYVSTGYADGYHRAASNFG---VPMRFVAPAAVTHYKG 308

Query: 305 YMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
           + +  +G+I+MD+  FD+TD    +I  GD+I++FG ++ +DDVA A+GT  Y+LL  +G
Sbjct: 309 HTLKGVGRISMDLAAFDVTDMPDDAIGEGDWIELFGNNVPVDDVARAAGTIGYELLTGLG 368

Query: 363 TRYAK 367
            RYA+
Sbjct: 369 ARYAR 373


>gi|254501958|ref|ZP_05114109.1| alanine racemase [Labrenzia alexandrii DFL-11]
 gi|222438029|gb|EEE44708.1| alanine racemase [Labrenzia alexandrii DFL-11]
          Length = 380

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 141/374 (37%), Positives = 202/374 (54%), Gaps = 26/374 (6%)

Query: 8   RLKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           RL +DL A+  NW  + + L+  +  AA +K NAYG G  + A  L+  G + FFV    
Sbjct: 17  RLTVDLDAIAANWSLLRSRLAPGSECAATIKANAYGTGQAETAKRLFEEGCRTFFVAVPT 76

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCGVSHPYA 125
           E + LR   P A I+ L G+ P    ++   ++ PV+ S+ +L  ++ L  +   S P A
Sbjct: 77  EAMALRQTLPSATIYALDGLFPDTADLLLQHDVRPVLGSLDELKEWAALCRTARKSFPAA 136

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQL--------SLIISHLACADDPSSHVNSV 177
           + VDTG +RLGLS  E        F   L  L        SL +SHLAC  DP   +N  
Sbjct: 137 VHVDTGIHRLGLSGDE--------FGTALADLELMGPFKPSLFMSHLACGSDPDHPMNQE 188

Query: 178 QLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVT 237
           QL RF  L S +KG+  SLA+S+G+L+GP+YHF L RPGISLYGG    +  +PMQ V  
Sbjct: 189 QLARFTELTSPFKGVPRSLANSAGVLMGPDYHFDLVRPGISLYGGRAFDHGDNPMQPVAK 248

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
            EARI+++R    G+ + YG  +   R    AV A GYADG  L      S+  P    G
Sbjct: 249 VEARIMIVRNVPKGDAIGYGATQTAKRALRNAVVAAGYADG--LLRRASSSDDRP----G 302

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALASGTTNY 355
           G G I G+   ILG+I+MDM   D+TD     ++ G  +++ GP++   D+A  + T +Y
Sbjct: 303 GFGMIGGHKASILGRISMDMITLDVTDIPEHLVQRGGLVEMLGPNVAAADMAAYAETIDY 362

Query: 356 DLLVRIGTRYAKFY 369
           + L  +G R+ + Y
Sbjct: 363 EYLTSLGRRFERIY 376


>gi|162148204|ref|YP_001602665.1| alanine racemase, catabolic [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209542849|ref|YP_002275078.1| alanine racemase [Gluconacetobacter diazotrophicus PAl 5]
 gi|161786781|emb|CAP56364.1| putative alanine racemase, catabolic [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530526|gb|ACI50463.1| alanine racemase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 383

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 139/372 (37%), Positives = 200/372 (53%), Gaps = 15/372 (4%)

Query: 2   HSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFF 61
           H+     L IDL A++ N+ ++  L+  A  AAVVK +AYGLG  ++APAL   G + FF
Sbjct: 13  HARAGATLTIDLDAIRANYRTVRNLAAGAECAAVVKADAYGLGAARVAPALQEEGARTFF 72

Query: 62  VTSVEEGVKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCG 119
           V  ++EG+ LR + +  ARI VL+G  PG EK     +LIPV++SV Q+  +  L    G
Sbjct: 73  VAHLDEGMALRRHVSADARIIVLHGAVPGAEKDCLHDDLIPVLNSVDQIQRWRGLAHEAG 132

Query: 120 VSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQL 179
            + P  LQ+DTG +R GLS  E      +    +   L L+ISHLACADDP    ++ Q 
Sbjct: 133 RALPSILQLDTGMSRFGLSENEIRAIVADPDGLRGIDLRLVISHLACADDPDDPASTRQR 192

Query: 180 ERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAE 239
            R   + +       SLA+SSG+ LG ++HF L RPG +LYG        +PM+ VV  +
Sbjct: 193 ARLVRMRALLPPAPVSLAASSGVFLGRDFHFDLVRPGAALYGVAPNAATPNPMRPVVRLQ 252

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           ARI+  R     + V YG   + +    IA  A GYADG+    SG            G 
Sbjct: 253 ARILQTRHVSPNDGVGYGLTYRPSAMRRIATIATGYADGF--MRSGAAR---------GC 301

Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
            ++    +P+LG+I+MD    D+TD+       G  + + GP   +DDVA A+GT  Y++
Sbjct: 302 AWLGDMQLPVLGRISMDSMTVDVTDAPETLTRPGTMVDLLGPRRGVDDVARAAGTIGYEI 361

Query: 358 LVRIGTRYAKFY 369
           L  +G RY + Y
Sbjct: 362 LTSLGHRYHRAY 373


>gi|222107011|ref|YP_002547802.1| alanine racemase [Agrobacterium vitis S4]
 gi|221738190|gb|ACM39086.1| alanine racemase [Agrobacterium vitis S4]
          Length = 374

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 137/374 (36%), Positives = 204/374 (54%), Gaps = 16/374 (4%)

Query: 1   MHSNEF-LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD 59
           M+++ F  RL IDL AL +N+  + A +  A T+AVVK +AYGLG  ++ PALY AG + 
Sbjct: 9   MNADAFSARLVIDLDALADNYRQLAAETTPAETSAVVKADAYGLGAARVGPALYRAGCRK 68

Query: 60  FFVTSVEEGVKLRLYTP-QARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS- 117
           FFV +V+E   LR + P  A +F+L G+ PG E        IPV++S+ QL  +SK+ S 
Sbjct: 69  FFVANVQEAAGLRQHLPGDAELFILNGLQPGAEPFAAANGFIPVLNSLEQLANWSKMASE 128

Query: 118 CGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSV 177
            G + P  LQ DTG +RLG S +EA     +        +  I+SHLA ADD +S  N+ 
Sbjct: 129 FGRTLPAILQFDTGMSRLGFSPEEANVLAGDPALLSGLSIRYIMSHLASADDSASTQNAA 188

Query: 178 QLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVT 237
           Q    R  ++ + GI    ++S GI +   +H  L RPG++LYG          M+ VV 
Sbjct: 189 QFSVMRERLAQFPGIALCFSNSGGIFIDKQFHGALVRPGVALYGAVPSDLAGRRMKPVVR 248

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
            +A++I  R   AG  V YG     T+++ +A  AIGYADG P  LS             
Sbjct: 249 VDAKVIQTRTVPAGACVGYGATYVATKETRLATIAIGYADGLPRCLSDR----------- 297

Query: 298 GKGFIKGYMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
           G  +     +PI+G+++MD    DI+     ++ +G  +++ GP   L+DVA A+GT  Y
Sbjct: 298 GAAYYGDIRLPIVGRVSMDSMTLDISALPPGTLTLGSLVEMIGPHQSLEDVAQAAGTIAY 357

Query: 356 DLLVRIGTRYAKFY 369
           ++L  +G RY + Y
Sbjct: 358 EILTSLGHRYHRDY 371


>gi|114704797|ref|ZP_01437705.1| alanine racemase [Fulvimarina pelagi HTCC2506]
 gi|114539582|gb|EAU42702.1| alanine racemase [Fulvimarina pelagi HTCC2506]
          Length = 396

 Score =  232 bits (591), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 141/375 (37%), Positives = 217/375 (57%), Gaps = 22/375 (5%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           R++ID  ALK NW ++ ++  NA+T A VK + YGLG  +++ AL+ AG ++FFV   EE
Sbjct: 29  RVEIDRGALKRNWAALASIHPNAQTGAAVKADGYGLGAVEVSRALFEAGCRNFFVAWPEE 88

Query: 68  GVKLR-LYTPQ---ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK-LMSCGVSH 122
           G  +R    P+   AR+FVL G+ P   + + D +L+PV+SS   LT +++ L +     
Sbjct: 89  GQIVRSALAPKNKNARVFVLQGMEPAAVRFLTDHDLVPVLSSPDDLTIWTEGLTALARRA 148

Query: 123 PYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERF 182
           P ALQ++TG NRLGL  +  L            +++L+++HLA AD  S   +  Q  RF
Sbjct: 149 PAALQLETGMNRLGLD-ERGLGKAMALVEAGELEVALLLTHLASADV-SPEDSEAQRIRF 206

Query: 183 RTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARI 242
             + + +  I  SLA+S+G++ G ++   LTRPGI+LYGG   +      + V    A +
Sbjct: 207 SAMSARFPYISRSLANSAGLVCGESFGLDLTRPGIALYGGMGCLGGLIATEPVARLSAAV 266

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSG------LDSEHSPSVFL 296
           I +R+  AGE V Y G  +LTR ++IA   IGY DGY   LSG      +D   + +V  
Sbjct: 267 IQVREVEAGEKVGYAGAARLTRRTIIATLGIGYGDGYLRALSGAGVPLRMDRPAASAV-- 324

Query: 297 GGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTN 354
                I G  VP+LG+I+MD+T+ D+TD  + S+  GD  ++FGP++ +D VA A+GT  
Sbjct: 325 -----ISGCAVPVLGRISMDLTLLDVTDLPAGSVRPGDRAELFGPNMPIDKVAEAAGTIP 379

Query: 355 YDLLVRIGTRYAKFY 369
           Y+LL  +G R  + +
Sbjct: 380 YELLTGLGPRVQRVW 394


>gi|190894994|ref|YP_001985287.1| alanine racemase [Rhizobium etli CIAT 652]
 gi|190700655|gb|ACE94737.1| alanine racemase protein [Rhizobium etli CIAT 652]
          Length = 377

 Score =  229 bits (585), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 132/368 (35%), Positives = 200/368 (54%), Gaps = 19/368 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  N+  + ++    R  AVVK +AYGLG E++A  LY+ G + FFV    E 
Sbjct: 23  LTIDLAALGRNYLKLASMLAPVRAGAVVKADAYGLGAERVAQTLYDQGCRHFFVAQFVEA 82

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYS---KLMSCGVSHPY 124
           V+LR      A+IFVL G+ PG E    ++ +IPV++S+ Q   +S   +L++   S P 
Sbjct: 83  VRLRPALAEDAQIFVLNGLQPGNEVACAESGIIPVLNSLAQWRQWSATARLLT--RSLPA 140

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
            LQ DTG +RLG   +E  +      +    ++  I+SHLACAD+  S  N  QL     
Sbjct: 141 VLQFDTGMSRLGFPWEERAELAAVIGDGANVEILFIMSHLACADELDSGQNGDQLAEMAR 200

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           +   + G + S A+S G+ LG  YH  L RPGI+LYGG      ++PM+ VV  +  ++ 
Sbjct: 201 IADEFPGFDISFANSGGVFLGDAYHGVLARPGIALYGGAPNAGGTNPMEPVVRLDVAVVQ 260

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
            R   +G  + YGG     R++ +A  A GYADG P +L              G  + KG
Sbjct: 261 TRTVPSGARIGYGGAHVTRRETRLATIAAGYADGLPRSLGDC-----------GAVYHKG 309

Query: 305 YMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
             +PI+G+++MD    DIT     ++ +G  +++ GP+  L+DVA A+GT +Y++L  +G
Sbjct: 310 IRLPIVGRVSMDSATVDITALPEGALRLGSLVEVLGPNQTLEDVAGAAGTISYEILTGLG 369

Query: 363 TRYAKFYT 370
            RY + Y 
Sbjct: 370 DRYDRQYC 377


>gi|327193285|gb|EGE60191.1| alanine racemase protein [Rhizobium etli CNPAF512]
          Length = 377

 Score =  229 bits (583), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 132/368 (35%), Positives = 200/368 (54%), Gaps = 19/368 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  N+  + ++    R  AVVK +AYGLG E++A  LY+ G + FFV    E 
Sbjct: 23  LTIDLAALGRNYLKLASMLAPVRAGAVVKADAYGLGAERVAQTLYDQGCRHFFVAQFVEA 82

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYS---KLMSCGVSHPY 124
           V+LR      A+IFVL G+ PG E    ++ +IPV++S+ Q   +S   +L++   S P 
Sbjct: 83  VRLRPALAEDAQIFVLNGLQPGNEVACAESGIIPVLNSLAQWRQWSATARLLT--RSLPA 140

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
            LQ DTG +RLG   +E  +      +    ++  I+SHLACAD+  S  N  QL     
Sbjct: 141 VLQFDTGMSRLGFPWEERAELAAVIGDGANVEILFIMSHLACADELDSGQNGDQLAEMAR 200

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           +   + G + S A+S G+ LG  YH  L RPGI+LYGG      ++PM+ VV  +  ++ 
Sbjct: 201 IADEFPGFDISFANSGGLFLGDAYHGVLARPGIALYGGAPNAGGTNPMEPVVRLDVAVVQ 260

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
            R   +G  + YGG     R++ +A  A GYADG P +L              G  + KG
Sbjct: 261 TRTVPSGARIGYGGAHVTRRETRLATIAAGYADGLPRSLGDC-----------GAVYHKG 309

Query: 305 YMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
             +PI+G+++MD    DIT     ++ +G  +++ GP+  L+DVA A+GT +Y++L  +G
Sbjct: 310 IRLPIVGRVSMDSATVDITALPEGALRLGSLVEVLGPNQTLEDVAGAAGTISYEILTGLG 369

Query: 363 TRYAKFYT 370
            RY + Y 
Sbjct: 370 DRYDRQYC 377


>gi|15891641|ref|NP_357313.1| alanine racemase [Agrobacterium tumefaciens str. C58]
 gi|20137303|sp|P58737|ALR2_AGRT5 RecName: Full=Alanine racemase, catabolic
 gi|15160087|gb|AAK90098.1| alanine racemase [Agrobacterium tumefaciens str. C58]
          Length = 388

 Score =  229 bits (583), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 131/365 (35%), Positives = 203/365 (55%), Gaps = 15/365 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++  ++  ++TAAVVK +AYGLG + ++  L+ AG ++FFV  ++E 
Sbjct: 18  LTIDLGALRDNYLTLAGMAPASQTAAVVKADAYGLGADVVSQTLFEAGCRNFFVAHIDEA 77

Query: 69  VKLRL-YTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK-LMSCGVSHPYAL 126
           + LRL  + +ARIFVL G+ PG E       + PV++S+ Q+  +S      G +   A+
Sbjct: 78  LALRLRLSAKARIFVLNGLQPGNETSCAAMAITPVLNSLEQIAQWSAHARELGKTLTAAV 137

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG  RLGLS +E    +         +++ ++SHLACAD+P    N+ QL   R   
Sbjct: 138 QIDTGMCRLGLSPEELEILSAKQQLLDGIEIAFVMSHLACADEPDHVSNAAQLAVMRKAA 197

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + +       ++S GI LG +YH  L RPGI+LYGG       +PM+ VV  +  +I  R
Sbjct: 198 TAFPETPVCFSNSGGIFLGNDYHNALLRPGIALYGGAPSAAGPNPMKPVVRLDVAVIQTR 257

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AG LV YGG    +  + +A  A GYADG P +LS             G  +  G  
Sbjct: 258 TVPAGSLVGYGGSFTASVPTRLATIAAGYADGLPRSLSNR-----------GAAWYNGVR 306

Query: 307 VPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           +PI G+++MD  + DI+     ++  G  +Q+ GPD  L+D+A  +GT  Y++L  +G R
Sbjct: 307 LPIAGRVSMDSIILDISALPEGTLTQGSLVQMIGPDQTLEDIAEDAGTIAYEILTGLGRR 366

Query: 365 YAKFY 369
           Y + Y
Sbjct: 367 YRRSY 371


>gi|296445363|ref|ZP_06887321.1| alanine racemase [Methylosinus trichosporium OB3b]
 gi|296257124|gb|EFH04193.1| alanine racemase [Methylosinus trichosporium OB3b]
          Length = 380

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 193/364 (53%), Gaps = 12/364 (3%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL AL  NW  + A +  A  AAVVK +AYG+G E    AL  AG + FFV +  EG
Sbjct: 23  LCVDLAALVANWRLLAARAPGADCAAVVKADAYGIGLEPATRALAAAGCRTFFVATAGEG 82

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL-MSCGVSHPYALQ 127
            +LR   P+A ++VL G+  G    +    L PV++S+ ++  +     S G   P ALQ
Sbjct: 83  ERLRAVAPRAIVYVLEGLPQGGAFTLAAARLRPVLASLEEIGEWGAFGRSIGRRLPAALQ 142

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGLS +EA      + +    +L+L++SH  CA  P    N+ Q+  F   + 
Sbjct: 143 LDTGMNRLGLSPREAPAAAAAAQDI---ELTLVMSHFICAQWPDDPRNARQIAAFEAALG 199

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G  ASL +SSG+ L    H  L RPG +LYGG       +PM+ VV  EA ++ +R+
Sbjct: 200 CFPGAPASLCNSSGVFLSEKPHHDLLRPGYALYGGNPTPLCPNPMRPVVRLEASVLAVRE 259

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
             AGE V Y G     R + +A   +GY DG P   S      S     G +  I GY  
Sbjct: 260 IAAGETVGYDGVWTAARPTRLATLGLGYGDGLPAGAS------SGPGRAGAEAVIGGYRC 313

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           P++G+++MD  M D+TD     +  G   +I G  I +D++A  SGT  Y++L R+G RY
Sbjct: 314 PLVGRVSMDFVMLDVTDIPEAIVHRGASAEILGETIGVDELAARSGTIGYEILTRLGRRY 373

Query: 366 AKFY 369
            + Y
Sbjct: 374 ERRY 377


>gi|27379181|ref|NP_770710.1| alanine racemase [Bradyrhizobium japonicum USDA 110]
 gi|27352332|dbj|BAC49335.1| alanine racemase [Bradyrhizobium japonicum USDA 110]
          Length = 423

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 194/364 (53%), Gaps = 10/364 (2%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+  NW  +   +  A  AAV+K +AYG G  ++A AL+ AG + FFV ++EE 
Sbjct: 33  LTVDLDAIIANWRKLEKTAVPAECAAVIKADAYGCGAAQVARALHKAGCKTFFVATIEEA 92

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYALQ 127
            K+R   P+  I+VL G      +     N  PVI  + +L  +       G +   A+ 
Sbjct: 93  RKVRAAVPEPTIYVLGGYFQNTGEHYAQINCRPVIGDLNELAEWDVFCRRTGWNGGAAVH 152

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGL+L EA        N     ++L++SHL  A+  +S VN+ QL  FR + S
Sbjct: 153 IDTGMNRLGLTLAEAQAIIPR-INAGDHGITLVMSHLVSAEQLNSPVNAKQLASFRGIAS 211

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+ A+LA+SSGI LG  + F L RPG +LYG        +PMQ VV  +ARI+ IR 
Sbjct: 212 EFSGVPAALANSSGIFLGAPFQFDLVRPGAALYGVNPTPEADNPMQPVVDLKARIVQIRN 271

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V YGG     R + +A+ A+GYADGY    S  D      V + GK        
Sbjct: 272 VERGESVGYGGTWTARRPTKLAIIAVGYADGYFRAASSNDGTRGAEVIVAGK------RC 325

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           P+ G+++MD+   DITD    +   G  + + G  I +D++A   GT  Y++L  +G RY
Sbjct: 326 PVAGRVSMDLIAIDITDLPPNAARRGHLVTLIGEGITVDELAHHFGTIGYEVLTSLGHRY 385

Query: 366 AKFY 369
           A+ Y
Sbjct: 386 ARVY 389


>gi|110632757|ref|YP_672965.1| alanine racemase [Mesorhizobium sp. BNC1]
 gi|110283741|gb|ABG61800.1| alanine racemase [Chelativorans sp. BNC1]
          Length = 385

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 127/364 (34%), Positives = 196/364 (53%), Gaps = 16/364 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+  NW  +   +  A  AAVVK +AYGLG  ++A AL +AG + FFV  +EEG
Sbjct: 11  LTVDLEAVTANWLLLAGRAAGAECAAVVKADAYGLGAAEVATALQDAGCRTFFVAHLEEG 70

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYAL 126
           + LR      +RIFVL G  P  ++      L PV+ ++ +L  + K  +      P AL
Sbjct: 71  LSLRRTLGSGSRIFVLNGTPPDTQEEFGQAALTPVVGTINELQAWRKHAATKRGPIPVAL 130

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG +RLGLS  +      ++   +   + L++SHLACAD+P    N  Q  RF+ L 
Sbjct: 131 QLDTGMSRLGLSPSDVSGIAADTTLLRGIHIELVMSHLACADEPGHSANESQRSRFQRLR 190

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
                  AS+A+SSG  LG  +HF + RPG +LYG      + +PM  VV   AR++ +R
Sbjct: 191 RMLPQAPASIANSSGTFLGKGFHFSMIRPGAALYGINPTPYQPNPMCQVVKVAARVLQVR 250

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
           +A AG  + YG   +  R S++A  A+GYADG+P   S             G  + +G  
Sbjct: 251 QARAGTGIGYGHAARARRLSMLATIALGYADGWPCQAS-------------GAAYYRGQR 297

Query: 307 VPILGKITMDMTMFDITD-SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           +P +G+++MD  + D+T  S     GD ++   P   +D++   +G+  Y++L R+G R+
Sbjct: 298 LPFIGRVSMDSIILDVTGCSNPPREGDLVEFICPSQTVDEIGRLAGSIGYEVLTRLGRRF 357

Query: 366 AKFY 369
            + Y
Sbjct: 358 HRRY 361


>gi|299133691|ref|ZP_07026885.1| alanine racemase [Afipia sp. 1NLS2]
 gi|298591527|gb|EFI51728.1| alanine racemase [Afipia sp. 1NLS2]
          Length = 396

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 133/364 (36%), Positives = 194/364 (53%), Gaps = 10/364 (2%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  NW ++ + +  A  +AVVK +AYG G   +   L + G + FFV +++E 
Sbjct: 23  LTIDLDALATNWKALESRAVPAECSAVVKADAYGCGLTPVTRKLVSIGCKTFFVATLDEA 82

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYALQ 127
            + R   P+A I+VL G            +  PVI  + +L  +       G +   ALQ
Sbjct: 83  KRAREAAPKAAIYVLDGFFANCGDDFAKIDCRPVIGDLNELAEWDAFRRTRGWTGLAALQ 142

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLG +  EA            G ++L++SHLACA+D S+ +N+ QL  FR++ S
Sbjct: 143 IDTGMNRLGFTPDEARGLVPRIKQADHG-IALVMSHLACAEDMSNAMNARQLAAFRSVAS 201

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + GI ASLA+SSGI LG ++H  + RPG +LYG        +PMQ VV  + RI  IR 
Sbjct: 202 EFSGITASLANSSGIFLGSHFHMDMVRPGAALYGVNPTPEADNPMQPVVGLKVRIAQIRN 261

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V YG      R + +A+ + GYADGY    SG++   S       +  + G   
Sbjct: 262 VPKGETVGYGALWHAKRPTRLAIVSAGYADGYFRAASGIEGTRS------AQAIVAGQRC 315

Query: 308 PILGKITMDMTMFDITDSL--SIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           PI+G+I+MD+   DITD     I  G +I + G  + LD++    GT  Y++L  +G RY
Sbjct: 316 PIVGRISMDLMAIDITDVPHGGIRRGHFITLIGEGLTLDELGHHFGTIGYEVLTSLGRRY 375

Query: 366 AKFY 369
           A+ Y
Sbjct: 376 ARDY 379


>gi|188583600|ref|YP_001927045.1| alanine racemase [Methylobacterium populi BJ001]
 gi|179347098|gb|ACB82510.1| alanine racemase [Methylobacterium populi BJ001]
          Length = 363

 Score =  226 bits (577), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 129/362 (35%), Positives = 195/362 (53%), Gaps = 14/362 (3%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL +DL A+  NW ++ A +  A   AVVK +AYG G   +APAL+ AG + FFV  + E
Sbjct: 14  RLTVDLAAIAANWRALGACAPQAECGAVVKADAYGCGLAAVAPALWRAGCRTFFVAHLSE 73

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           G+  R   P+A I+VL G+ PG  +      L PV+    +L  ++       + P AL 
Sbjct: 74  GIAARKILPEAAIYVLNGLVPGHAEAFRAHGLRPVLGDRGELLEWAAATD--GAAPAALH 131

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           VDTG NRLGL ++EAL    +    + G + L++SHL  A+ P   +N+ Q E F  +  
Sbjct: 132 VDTGMNRLGLRVEEALALAGDPLIARAG-IDLVMSHLVSAERPDDPLNAGQAEAFARVRD 190

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            +  + ASLA+SSG  L       L RPG +L+GG  +  + +PM+ VV  EA I+ +R 
Sbjct: 191 AFPPLRASLANSSGTCLAARARHDLLRPGYALFGGNPEPGQRNPMRPVVRLEATILQLRA 250

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
             AGE   Y G+ +      +A  ++GYADGYP + S  +S H+          + G   
Sbjct: 251 VEAGESCGYNGRWQAPAPRRLATLSLGYADGYPRSAS--NSGHA---------LVGGVPC 299

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           PI+G I+MD+ + D+TD+     G    + G  + +D V  A+GT  Y++L  +G+RY +
Sbjct: 300 PIVGLISMDLIILDVTDASEARRGATATLIGDSLDIDTVGQAAGTIGYEILTGLGSRYVR 359

Query: 368 FY 369
            Y
Sbjct: 360 SY 361


>gi|323138212|ref|ZP_08073284.1| alanine racemase [Methylocystis sp. ATCC 49242]
 gi|322396464|gb|EFX98993.1| alanine racemase [Methylocystis sp. ATCC 49242]
          Length = 382

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 125/364 (34%), Positives = 199/364 (54%), Gaps = 12/364 (3%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL+AL +NW +++ L G A   AVVK + YG+G   +  AL  AG + FFV +V EG
Sbjct: 25  LTVDLSALVSNWRALSTLGGQAECGAVVKADGYGVGQIPVMRALLAAGCRTFFVATVVEG 84

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL-MSCGVSHPYALQ 127
              R   P+A I+VL G+ PG    +    L P I S  +L  ++    + G     A+ 
Sbjct: 85  ETARALAPEATIYVLDGVAPGCALRLAAARLRPAIGSFAELEEWAAAGRTLGRKLEAAIH 144

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
            DTG NRLG S  +A D    +   K    ++++SHL+ +  P + VN+ Q+  F     
Sbjct: 145 FDTGMNRLGFSPADAADVAERA---KAIAPTVVMSHLSTSQIPEAPVNARQIAAFEETRR 201

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
           H+ G+ AS+A+SS + L    HF+LTRPG +LYGG      ++PM+ VV+  ARII +R 
Sbjct: 202 HFPGLAASMANSSAVFLPEKPHFELTRPGYALYGGNPTPGAANPMRAVVSLHARIIAMRD 261

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              G+ V Y G     R S +A    GYADG P++ +    + +      G+  + G   
Sbjct: 262 LAPGDCVGYDGIWTAARPSRVATIGAGYADGLPVSATAAPKKPA------GEAIVGGVRC 315

Query: 308 PILGKITMDMTMFDITDSL--SIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           P +G+++MD  + D+TD+   + + G ++++ G  I ++++A  + T  Y++L R+G RY
Sbjct: 316 PFIGRVSMDYIVLDVTDAPREAAQRGAWVELLGETIDVEELAGRARTIGYEVLTRLGRRY 375

Query: 366 AKFY 369
           A+ Y
Sbjct: 376 ARRY 379


>gi|114328882|ref|YP_746039.1| alanine racemase [Granulibacter bethesdensis CGDNIH1]
 gi|114317056|gb|ABI63116.1| alanine racemase [Granulibacter bethesdensis CGDNIH1]
          Length = 360

 Score =  226 bits (575), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 130/364 (35%), Positives = 191/364 (52%), Gaps = 13/364 (3%)

Query: 8   RLKIDLTALKNNWHSMNALSGNAR-TAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           RL+IDL A+  NW  +    G  R T AVVK + YGLG   IA  L   G    FV   +
Sbjct: 3   RLEIDLEAIAANWRFLRTTHGTNRITGAVVKADGYGLGAAVIAQRLVQEGCDHIFVAHPQ 62

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYA 125
           E + LR   P A + VL G+ PG E    D  LIP + S+ ++  + +  +      P  
Sbjct: 63  EALTLRPLIPSATLIVLNGLWPGWEAAYTDHGLIPALGSLAEIEAWRQEATRREQALPAF 122

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           L VDTG NRLGL  QE               L  I++HL  A+ P    N++Q +RF   
Sbjct: 123 LHVDTGINRLGLDPQERDRLAERPELLDGITLRAIMTHLISAEIPDHDSNTLQRQRFAAA 182

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
            S       S+A+SSGI LGP++   + RPG +LYG      + +PM+ V+   AR++ I
Sbjct: 183 CSRLPPAPRSIANSSGIFLGPDFASDIARPGAALYGINPVPGRPNPMRPVLRLSARVLQI 242

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R   AGE+V Y G     R S IAV ++GYADG+   L    S  + + F G +      
Sbjct: 243 RPVEAGEIVGYNGIWVAQRPSRIAVCSVGYADGFQRAL----SSRAEAAFDGAR------ 292

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
            +P++G+++MD+T +D+TD   I VG ++++ GP++  D+VA  + T  Y++L  +G RY
Sbjct: 293 -IPLVGRVSMDLTTYDVTDDPRITVGSWLELIGPEVSPDEVAARASTNGYEVLTSLGRRY 351

Query: 366 AKFY 369
            + Y
Sbjct: 352 ERVY 355


>gi|254437149|ref|ZP_05050643.1| alanine racemase [Octadecabacter antarcticus 307]
 gi|198252595|gb|EDY76909.1| alanine racemase [Octadecabacter antarcticus 307]
          Length = 345

 Score =  225 bits (573), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 136/363 (37%), Positives = 196/363 (53%), Gaps = 26/363 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL AL +NW S++A++ +  T AVVK N YGLG  K+  AL  AGV+ FFV   +EG
Sbjct: 6   LSVDLDALSSNWRSLDAMT-DVETCAVVKANGYGLGVAKVGRALMKAGVKRFFVAVAQEG 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           V LR    P   I +  G   G   +I D  L P+I++V QLT + + +     HP+ +Q
Sbjct: 65  VTLRQALGPNVEICIFAGHMRGDTDMIADMMLTPIINTVGQLTRHLEALP---EHPFGVQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGL + E       + ++      L++SHLACAD P   +N  QL++F  L++
Sbjct: 122 IDTGMNRLGLEIDEWASVAEIALSQNC---RLVMSHLACADTPDHPMNRQQLDQFH-LMT 177

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
               +  SLA++ GILLGP YHF +TRPGI LYGG      + P   V   +  +I +R 
Sbjct: 178 DGINVPRSLAATGGILLGPEYHFDMTRPGIGLYGGA-PFTDALP---VAYLDLPVIQVRD 233

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V Y       R S IA  + GYADG    LS            G   +     V
Sbjct: 234 VNVGETVGYANAWTAQRQSKIATVSGGYADGLTRALSA-----------GANLWHGAQAV 282

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           P++G+++MD+   D+TD    E+   + I GPD  +D +A  +GT  Y++L  +G+RY +
Sbjct: 283 PLVGRVSMDLITADVTD--LPELPGVLSILGPDQTVDQLAERAGTIGYEILTSLGSRYQR 340

Query: 368 FYT 370
            Y+
Sbjct: 341 RYS 343


>gi|86748627|ref|YP_485123.1| alanine racemase [Rhodopseudomonas palustris HaA2]
 gi|86571655|gb|ABD06212.1| alanine racemase [Rhodopseudomonas palustris HaA2]
          Length = 388

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 133/373 (35%), Positives = 202/373 (54%), Gaps = 18/373 (4%)

Query: 2   HSNEFLRLKIDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDF 60
           H +    L IDL A++ N+  +  + G   R   VVK +AYGLG  ++APALY AG +DF
Sbjct: 5   HRHAGATLTIDLAAIRWNYRRLAEMVGPKVRCGGVVKADAYGLGARQVAPALYGAGCRDF 64

Query: 61  FVTSVEEGVKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SC 118
           +V  ++E + LR +  P A I VL G+  G E    D  ++PV++S+ QL  +S      
Sbjct: 65  YVAHLDEALDLRPHLPPDASIVVLNGLPRGGEDDCADAGIVPVLNSLAQLDDWSACARKA 124

Query: 119 GVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQ 178
           G      +Q+D+G +RLGLS +E  + +H         + L++SHLACAD      N+ Q
Sbjct: 125 GRVLGAIVQIDSGMSRLGLSPRELDELSHARLRGI--DIRLVMSHLACADVADHAANAYQ 182

Query: 179 LERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTA 238
             RF  L   + GI  SLA+SSGI LGP++H+   RPG +LYG     ++ +PM+ VV  
Sbjct: 183 RARFCALADRFGGIPKSLANSSGIFLGPDFHYDAARPGAALYGINPTSSRPNPMRPVVRL 242

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            A I+  R+  AG+ V YG   ++ R S +A  +IGYADG    L              G
Sbjct: 243 AAAIVQTREIEAGDHVGYGWDFRVERPSRLATLSIGYADGLHRALG-----------RAG 291

Query: 299 KGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYD 356
             + +G  + I G+++MD    D+ D  +  +  G  I++ GP   +D++A ASGT  Y+
Sbjct: 292 AVYFEGRALAIAGRVSMDSITVDLGDLPAERLGRGAEIELIGPHQSVDELASASGTIGYE 351

Query: 357 LLVRIGTRYAKFY 369
           +L  +G R+ + Y
Sbjct: 352 ILTSLGDRFRRIY 364


>gi|126728695|ref|ZP_01744510.1| alanine racemase [Sagittula stellata E-37]
 gi|126710625|gb|EBA09676.1| alanine racemase [Sagittula stellata E-37]
          Length = 345

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 142/368 (38%), Positives = 203/368 (55%), Gaps = 34/368 (9%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL IDL AL+ NW ++ ALS    T AVVK +AYGLG EK AP L  AG + FFV   EE
Sbjct: 5   RLTIDLGALRANWTALAALS-EGETGAVVKADAYGLGAEKCAPVLAAAGARTFFVAIAEE 63

Query: 68  GVKL-RLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           G++L R+  P   I V  G  PG    I D +L+P+I+S+ Q+  + + +     HP+ +
Sbjct: 64  GLRLRRILGPGPEICVFSGHMPGDRDAIRDADLVPMINSIDQMLMHVEGLP---GHPFGI 120

Query: 127 QVDTGFNRLGLSLQE--ALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           Q+D+G NRLG+   E  AL     + N +     L++SHLACAD+P   +N+ QL  FR 
Sbjct: 121 QLDSGMNRLGMEPAEWSALRDIALAQNPR-----LVMSHLACADEPDHAMNARQLAAFRD 175

Query: 185 LISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARI 242
           +     GI+A  SL ++ G LLGP YHF +TRPG+ LYGG   ++     Q VV+ +  +
Sbjct: 176 MT---DGIDAPRSLGATGGTLLGPEYHFDMTRPGVGLYGGLPFVDA----QPVVSLDIPV 228

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I  R  L GE V YG     +  S +A  A GYADG    +       S +    G+   
Sbjct: 229 IQTRDVLPGETVGYGNTWTASAPSRVATIAGGYADGIHRAMG------SAAYVWAGETRC 282

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
           K     ILG+I+MD+   D+T     E+ D++++ G    +D +A  +GT  Y++L  +G
Sbjct: 283 K-----ILGRISMDLIAVDVTG--LPELPDHVELIGLHQGVDTLADWAGTIGYEVLTSLG 335

Query: 363 TRYAKFYT 370
            RY + YT
Sbjct: 336 ARYDRSYT 343


>gi|170750293|ref|YP_001756553.1| alanine racemase [Methylobacterium radiotolerans JCM 2831]
 gi|170656815|gb|ACB25870.1| alanine racemase [Methylobacterium radiotolerans JCM 2831]
          Length = 364

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 197/362 (54%), Gaps = 15/362 (4%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL IDL A+  NW  + A    A  AAVVK +AYG G  ++ PAL+ AG + FFV  + E
Sbjct: 16  RLTIDLGAIAANWRILAARGAGADCAAVVKADAYGCGIGRVGPALWAAGCRTFFVAHLSE 75

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           GV  R   P+A I+VL G+  G         L PV+ S  +L+ ++     G   P AL 
Sbjct: 76  GVAARAALPEAAIYVLNGLPLGAAAAFAAHGLRPVLGSAEELSDWAAF--AGNRPPAALH 133

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           VDTG NRLGLS+ EALD   ++   + G + L++SH   A+ P   VN+ Q+  F  + +
Sbjct: 134 VDTGMNRLGLSVPEALDLAGDARIAEAG-IDLLLSHFVSAETPDDPVNARQIADFARVRA 192

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            Y G+ ASLA+SSGI L    H  L RPG +L+GG      ++PM+ VV  EA I  +R 
Sbjct: 193 AYPGLRASLANSSGIFLDGARH-DLLRPGYALFGGNPTPGAANPMRPVVRLEATIAQVRG 251

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
             AG    Y G+   T  S +A  ++GYADG+P ++SG            G+  + G   
Sbjct: 252 VAAGATAGYNGRWTATAPSRLATLSLGYADGFPRSISGR-----------GQALVGGVPC 300

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           PILG ++MD+ + D+T + +   G    + G  + +D V  A+GT  Y++L  +G+RY +
Sbjct: 301 PILGSVSMDLIILDVTAAPAARRGAAAVLIGDRLDIDTVGRAAGTIGYEILTGLGSRYVR 360

Query: 368 FY 369
            Y
Sbjct: 361 TY 362


>gi|312113724|ref|YP_004011320.1| alanine racemase [Rhodomicrobium vannielii ATCC 17100]
 gi|311218853|gb|ADP70221.1| alanine racemase [Rhodomicrobium vannielii ATCC 17100]
          Length = 384

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 129/364 (35%), Positives = 197/364 (54%), Gaps = 9/364 (2%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L I L AL+ N+      S  A TAAVVK NAYGLG + +  AL     + FFV +++E 
Sbjct: 24  LVIRLPALRRNYRRAAEASLKAETAAVVKANAYGLGIQPVLTALQKETARTFFVATLDEA 83

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYALQ 127
           + LR +   A I+ L G+ PG   +  D  L PV++S+ ++  +S       +  P A+Q
Sbjct: 84  LALRTFANDATIYTLNGLMPGTSAVYRDARLRPVLNSLAEVEEWSAYCREHEARLPAAIQ 143

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
            DTG  R+GL  + A          +  + ++++SHL  AD+P   +N VQ +RF  + S
Sbjct: 144 FDTGMCRVGLEPEAADALAEKPELLQPFRPAVLMSHLVRADEPMHPLNEVQFKRFEAVTS 203

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + GI  SL +S+G LL   YH  L RPGI++YGG  +  +    + VV    RI+ +R 
Sbjct: 204 LFPGIAKSLVNSAGCLLRRKYHLDLARPGIAIYGGNPQKVEPSQFEPVVWLFGRIVQVRH 263

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              G  V YGG + L RDS IA   +GYADGY   +S  D++       G  G I  + +
Sbjct: 264 GEKGFTVGYGGTETLRRDSRIATVGVGYADGYFRGVSSSDAKP------GAVGHIGEHAL 317

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           P++G+++MD+T FD TD     +  G ++++ G    +DD+A  +GT  Y++L  +G RY
Sbjct: 318 PLIGRVSMDLTTFDATDVPEALVHRGGFVELLGEKTTVDDLARHAGTIGYEVLTSLGRRY 377

Query: 366 AKFY 369
            + Y
Sbjct: 378 HRVY 381


>gi|83269232|ref|YP_418523.1| alanine racemase [Brucella melitensis biovar Abortus 2308]
 gi|20531982|sp|Q8YD03|ALR_BRUME RecName: Full=Alanine racemase
 gi|123545437|sp|Q2YIU9|ALR_BRUA2 RecName: Full=Alanine racemase
 gi|82939506|emb|CAJ12478.1| Alanine racemase:Protein of unknown function
           UPF0001:ATP/GTP-binding site motif A (P-loop) [Brucella
           melitensis biovar Abortus 2308]
          Length = 396

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 138/378 (36%), Positives = 203/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 18  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 77

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 78  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 137

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P + VN+ QL +   L+
Sbjct: 138 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAVNARQLAKMTALL 197

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 198 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 257

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 258 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 309

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 310 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 366

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 367 TIPYEILTALGNRYARVY 384


>gi|254690758|ref|ZP_05154012.1| Alr, alanine racemase [Brucella abortus bv. 6 str. 870]
 gi|256255941|ref|ZP_05461477.1| Alr, alanine racemase [Brucella abortus bv. 9 str. C68]
 gi|260756329|ref|ZP_05868677.1| alanine racemase [Brucella abortus bv. 6 str. 870]
 gi|260882153|ref|ZP_05893767.1| alanine racemase [Brucella abortus bv. 9 str. C68]
 gi|297249298|ref|ZP_06932999.1| alanine racemase [Brucella abortus bv. 5 str. B3196]
 gi|260676437|gb|EEX63258.1| alanine racemase [Brucella abortus bv. 6 str. 870]
 gi|260871681|gb|EEX78750.1| alanine racemase [Brucella abortus bv. 9 str. C68]
 gi|297173167|gb|EFH32531.1| alanine racemase [Brucella abortus bv. 5 str. B3196]
          Length = 399

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 138/378 (36%), Positives = 203/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P + VN+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAVNARQLAKMMALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 369

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 370 TIPYEILTALGNRYARVY 387


>gi|17988719|ref|NP_541352.1| alanine racemase, catabolic [Brucella melitensis bv. 1 str. 16M]
 gi|62317251|ref|YP_223104.1| alanine racemase [Brucella abortus bv. 1 str. 9-941]
 gi|189022512|ref|YP_001932253.1| Alr, alanine racemase [Brucella abortus S19]
 gi|237816811|ref|ZP_04595803.1| alanine racemase [Brucella abortus str. 2308 A]
 gi|254695937|ref|ZP_05157765.1| Alr, alanine racemase [Brucella abortus bv. 3 str. Tulya]
 gi|254698537|ref|ZP_05160365.1| Alr, alanine racemase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731984|ref|ZP_05190562.1| Alr, alanine racemase [Brucella abortus bv. 4 str. 292]
 gi|256043789|ref|ZP_05446711.1| Alr, alanine racemase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256111166|ref|ZP_05452202.1| Alr, alanine racemase [Brucella melitensis bv. 3 str. Ether]
 gi|260544489|ref|ZP_05820310.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260564974|ref|ZP_05835459.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260759757|ref|ZP_05872105.1| alanine racemase [Brucella abortus bv. 4 str. 292]
 gi|260762996|ref|ZP_05875328.1| alanine racemase [Brucella abortus bv. 2 str. 86/8/59]
 gi|261216365|ref|ZP_05930646.1| alanine racemase [Brucella abortus bv. 3 str. Tulya]
 gi|265990216|ref|ZP_06102773.1| alanine racemase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265992677|ref|ZP_06105234.1| alanine racemase [Brucella melitensis bv. 3 str. Ether]
 gi|17984530|gb|AAL53616.1| alanine racemase, catabolic [Brucella melitensis bv. 1 str. 16M]
 gi|62197444|gb|AAX75743.1| Alr, alanine racemase [Brucella abortus bv. 1 str. 9-941]
 gi|189021086|gb|ACD73807.1| Alr, alanine racemase [Brucella abortus S19]
 gi|237787624|gb|EEP61840.1| alanine racemase [Brucella abortus str. 2308 A]
 gi|260097760|gb|EEW81634.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260152617|gb|EEW87710.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260670075|gb|EEX57015.1| alanine racemase [Brucella abortus bv. 4 str. 292]
 gi|260673417|gb|EEX60238.1| alanine racemase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260917972|gb|EEX84833.1| alanine racemase [Brucella abortus bv. 3 str. Tulya]
 gi|262763547|gb|EEZ09579.1| alanine racemase [Brucella melitensis bv. 3 str. Ether]
 gi|263000885|gb|EEZ13575.1| alanine racemase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 399

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 138/378 (36%), Positives = 203/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P + VN+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAVNARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 369

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 370 TIPYEILTALGNRYARVY 387


>gi|256262185|ref|ZP_05464717.1| alanine racemase [Brucella melitensis bv. 2 str. 63/9]
 gi|263091881|gb|EEZ16203.1| alanine racemase [Brucella melitensis bv. 2 str. 63/9]
 gi|326411074|gb|ADZ68138.1| Alr, alanine racemase [Brucella melitensis M28]
 gi|326554365|gb|ADZ89004.1| Alr, alanine racemase [Brucella melitensis M5-90]
          Length = 399

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 138/378 (36%), Positives = 203/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P + VN+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAVNARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVEMIGPHQRLEDVARDCD 369

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 370 TIPYEILTALGNRYARVY 387


>gi|225686682|ref|YP_002734654.1| alanine racemase [Brucella melitensis ATCC 23457]
 gi|225642787|gb|ACO02700.1| alanine racemase [Brucella melitensis ATCC 23457]
          Length = 396

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 138/378 (36%), Positives = 203/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 18  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 77

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 78  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 137

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P + VN+ QL +   L+
Sbjct: 138 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAVNARQLAKMTALL 197

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 198 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 257

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 258 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 309

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 310 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVEMIGPHQRLEDVARDCD 366

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 367 TIPYEILTALGNRYARVY 384


>gi|51104395|gb|AAT96856.1| DadX [Rhizobium etli]
          Length = 377

 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 132/368 (35%), Positives = 196/368 (53%), Gaps = 19/368 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  N+  + ++    R  AVVK +AYGLG E++A  LY+ G + FFV    E 
Sbjct: 23  LTIDLAALGRNYLKLASMLAPVRAGAVVKADAYGLGAERVAQTLYDQGCRHFFVAQFVEA 82

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYS---KLMSCGVSHPY 124
           V+LR      A+IFVL G+ PG E    ++ +IPV++S+ Q   +S   +L++   S P 
Sbjct: 83  VRLRPALAEDAQIFVLNGLQPGNEVACAESGIIPVLNSLAQWRQWSATARLLT--RSLPA 140

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
            LQ DTG +RLG   +E  +      +    ++  I+SHLACAD+  S  N  QL     
Sbjct: 141 VLQFDTGMSRLGFPWEERAELAAVIGDGANVEILFIMSHLACADELDSGQNGDQLAEMAR 200

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           +   + G + S A+S G+ LG  YH  L RPGI+LYGG      ++PM+ VV  +  ++ 
Sbjct: 201 IADEFPGFDISFANSGGLFLGDAYHGVLARPGIALYGGAPNAGGTNPMEPVVRLDVAVVQ 260

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
            R   +G  + YGG     R++ +A  A GYADG P +L              G  + KG
Sbjct: 261 TRTVPSGARIGYGGAHVTRRETRLATIAAGYADGLPRSLGDC-----------GAVYHKG 309

Query: 305 YMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
             +PI+G+++MD    DIT       E     ++ GP+  L+DVA A+GT +Y++L  +G
Sbjct: 310 IRLPIVGRVSMDSATVDITALPEGGAEAWKPCRMLGPNQTLEDVAGAAGTISYEILTGLG 369

Query: 363 TRYAKFYT 370
            RY + Y 
Sbjct: 370 DRYDRQYC 377


>gi|84515510|ref|ZP_01002872.1| alanine racemase [Loktanella vestfoldensis SKA53]
 gi|84510793|gb|EAQ07248.1| alanine racemase [Loktanella vestfoldensis SKA53]
          Length = 345

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 139/361 (38%), Positives = 205/361 (56%), Gaps = 26/361 (7%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL IDL A+  NW +++A++ N +TAAV+K + YGLG   IA AL+ AGV+ FFV   EE
Sbjct: 5   RLTIDLDAVVANWRALDAMT-NCKTAAVIKADGYGLGSVNIAKALFKAGVRQFFVAVAEE 63

Query: 68  GVKLRL-YTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
              +R    P+  I V  G   G    I D NL P+++SV Q+T + + +     HP+ +
Sbjct: 64  AAPIRAELGPRPEINVFSGHMKGDTAAIRDLNLTPMLNSVEQVTHHFETLP---GHPFGI 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG NRLGL +QE       + ++     +L++SHLACAD+P   +N  QL  F  ++
Sbjct: 121 QLDTGMNRLGLEMQEWAAIAGLALDQN---PTLVMSHLACADEPDHPMNPHQLANFH-MM 176

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           +    +  SL+++ GILLGP+YHF LTRPGI LY G D  +   P   V+  E  ++ IR
Sbjct: 177 TDGISVPRSLSATGGILLGPDYHFDLTRPGIGLY-GADPFSDGTP---VIELEFPVVQIR 232

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               GE+V YG   +  R S IA  + GYADG   +LS        ++F  GK   K   
Sbjct: 233 DVAQGEVVGYGNSWQAERASRIATISGGYADGIIRSLS------DRAIFYHGKTPCK--- 283

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
             ++G+++MD+   D+TD LS E    + +   +  +DDVA  +GT  Y+LL ++G RY 
Sbjct: 284 --LVGRVSMDLMTIDVTD-LS-EDPKALSLICAEQTVDDVARRAGTIGYELLTQLGGRYT 339

Query: 367 K 367
           +
Sbjct: 340 R 340


>gi|254703242|ref|ZP_05165070.1| Alr, alanine racemase [Brucella suis bv. 3 str. 686]
 gi|260567824|ref|ZP_05838293.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261753873|ref|ZP_05997582.1| alanine racemase [Brucella suis bv. 3 str. 686]
 gi|260154489|gb|EEW89570.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261743626|gb|EEY31552.1| alanine racemase [Brucella suis bv. 3 str. 686]
          Length = 399

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 137/378 (36%), Positives = 202/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 369

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 370 TIPYEILTALGNRYARVY 387


>gi|260167680|ref|ZP_05754491.1| Alr, alanine racemase [Brucella sp. F5/99]
 gi|261757116|ref|ZP_06000825.1| alanine racemase [Brucella sp. F5/99]
 gi|261737100|gb|EEY25096.1| alanine racemase [Brucella sp. F5/99]
          Length = 399

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 137/378 (36%), Positives = 202/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 369

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 370 TIPYEILTALGNRYARVY 387


>gi|254720214|ref|ZP_05182025.1| Alr, alanine racemase [Brucella sp. 83/13]
 gi|265985224|ref|ZP_06097959.1| alanine racemase [Brucella sp. 83/13]
 gi|306838644|ref|ZP_07471480.1| alanine racemase [Brucella sp. NF 2653]
 gi|264663816|gb|EEZ34077.1| alanine racemase [Brucella sp. 83/13]
 gi|306406287|gb|EFM62530.1| alanine racemase [Brucella sp. NF 2653]
          Length = 399

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 137/378 (36%), Positives = 202/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTILSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NKS--HPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKEPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVAKGPMRIATIAVGYADGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 369

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 370 TIPYEILTALGNRYARVY 387


>gi|326405358|ref|YP_004285440.1| alanine racemase [Acidiphilium multivorum AIU301]
 gi|325052220|dbj|BAJ82558.1| alanine racemase [Acidiphilium multivorum AIU301]
          Length = 357

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 132/360 (36%), Positives = 194/360 (53%), Gaps = 14/360 (3%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L ID  A+  NW ++ A       A VVK +AYGLG   IAPAL  AG + FFV +++E 
Sbjct: 6   LTIDPGAVAANWQALAARHAG-EVAGVVKADAYGLGAALIAPALAAAGCRSFFVATLDEA 64

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQV 128
           + LR   P ARI VL G  PG+E+ +    L PV+ S+     +        + P  L +
Sbjct: 65  LSLRALLPAARIGVLNGCPPGEEETMRARELRPVLGSLAACARWRGAAGDDEAPPSFLHL 124

Query: 129 DTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           DTG NRLGL   EA     H +    LG L+ +++HL  A++P +  N+ Q ERF    +
Sbjct: 125 DTGMNRLGLDRDEAAHLIAHPTLLDGLG-LTHVMTHLVAAEEPDASANAAQRERFAAFAA 183

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            +  +  SLA+SSG+ LGP +   L RPG +LYGG      ++PM+  +   A I+ IR 
Sbjct: 184 RFPWLRTSLANSSGLFLGPGFGSDLARPGYALYGGNPTPTAANPMRPAIALAAPILQIRA 243

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
             +GE V Y G  +  R S IA   +GYADG P +LS   +              +G ++
Sbjct: 244 IASGETVGYNGTWRAARPSRIATIGVGYADGLPRSLSNRLTAR-----------WQGKII 292

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           P+ G+++MD+T FD+T+   I  GD I++ GP   +D +A  +GT  Y++L  +G RY +
Sbjct: 293 PVAGRLSMDLTTFDVTEHPDIAPGDVIELIGPGHDIDAIAAEAGTIGYEILTSLGPRYRR 352


>gi|225629379|ref|ZP_03787412.1| alanine racemase [Brucella ceti str. Cudo]
 gi|254705613|ref|ZP_05167441.1| Alr, alanine racemase [Brucella pinnipedialis M163/99/10]
 gi|256029226|ref|ZP_05442840.1| Alr, alanine racemase [Brucella pinnipedialis M292/94/1]
 gi|261313023|ref|ZP_05952220.1| alanine racemase [Brucella pinnipedialis M163/99/10]
 gi|265986214|ref|ZP_06098771.1| alanine racemase [Brucella pinnipedialis M292/94/1]
 gi|225615875|gb|EEH12924.1| alanine racemase [Brucella ceti str. Cudo]
 gi|261302049|gb|EEY05546.1| alanine racemase [Brucella pinnipedialis M163/99/10]
 gi|264658411|gb|EEZ28672.1| alanine racemase [Brucella pinnipedialis M292/94/1]
          Length = 399

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 137/378 (36%), Positives = 202/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 369

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 370 TIPYEILTALGNRYARVY 387


>gi|260433528|ref|ZP_05787499.1| alanine racemase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417356|gb|EEX10615.1| alanine racemase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 344

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 198/365 (54%), Gaps = 30/365 (8%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL I+L AL NNW +++A + +  T AVVK +AYGLG   +A AL   GV+ FFV   EE
Sbjct: 5   RLTINLHALVNNWRALDAKT-DVETGAVVKADAYGLGAGPVASALAEEGVRKFFVAVTEE 63

Query: 68  GVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           G  +R    P   IFV  G   G   ++ D +L+P+++S  Q   + + +     HP+ L
Sbjct: 64  GAAVRRAIGPGPLIFVFSGHMEGDADLLRDHDLVPLLNSPEQFQRHIQALPV---HPFGL 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG NRLGL   E  D++      +     L++SHLACAD+P   +N  QLE FR + 
Sbjct: 121 QLDTGMNRLGL---EPADWSALRNRAEALNPVLVMSHLACADEPDHPMNRQQLEAFRGMT 177

Query: 187 SHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
              +G+ A  SLA++ G+LLGP YHF L RPGI LYGG      + P   VVT +  +I 
Sbjct: 178 ---EGVSAPRSLAATGGMLLGPEYHFDLCRPGIGLYGGL-PFTAAKP---VVTVDLPVIQ 230

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R    GE V YG   K  R S IA  A GYADG    + G           G   F   
Sbjct: 231 VRDLAVGESVGYGNTWKARRPSRIATVAAGYADGLHRAIGG-----------GIDAFAGN 279

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
              P++G+I+MD+   D+TD       + ++I      +DD+A A+GT  Y++L  +G+R
Sbjct: 280 LPCPVVGRISMDLITIDVTDLPHTP--ERLRILNGHQTVDDLAEAAGTIGYEILTSLGSR 337

Query: 365 YAKFY 369
           Y++ Y
Sbjct: 338 YSRGY 342


>gi|306846133|ref|ZP_07478695.1| alanine racemase [Brucella sp. BO1]
 gi|306273384|gb|EFM55245.1| alanine racemase [Brucella sp. BO1]
          Length = 399

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 137/378 (36%), Positives = 202/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVALLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NKS--HPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKEPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVAKGPMRIATIAVGYADGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 369

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 370 TIPYEILTALGNRYARVY 387


>gi|218532193|ref|YP_002423009.1| alanine racemase [Methylobacterium chloromethanicum CM4]
 gi|218524496|gb|ACK85081.1| alanine racemase [Methylobacterium chloromethanicum CM4]
          Length = 342

 Score =  222 bits (566), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 188/351 (53%), Gaps = 14/351 (3%)

Query: 19  NWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLRLYTPQA 78
           NW ++ A +  A   AVVK +AYG G   +APAL+ AG + FFV  + EG+  R   P+A
Sbjct: 4   NWRALGACAPQAECGAVVKADAYGCGLAAVAPALWRAGCRTFFVAHLSEGIAARKMLPEA 63

Query: 79  RIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVDTGFNRLGLS 138
            ++VL G+ PG  +      L PV+    +L  +++ M  G   P AL VDTG NRLGLS
Sbjct: 64  ALYVLNGLPPGHAEAFRAHRLRPVLGDAQELAEWAEAMQGG--GPAALHVDTGMNRLGLS 121

Query: 139 LQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHYKGIEASLAS 198
           + EAL    +    + G + L++SHL  A+ P   +N+ Q   F  + + +  + ASLA+
Sbjct: 122 VAEALALAGDPVIARAG-IDLVMSHLVSAELPDDPLNARQAADFARVRAAFPQMRASLAN 180

Query: 199 SSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKALAGELVSYGG 258
           SSG  L  +    L RPG +L+GG     + +PM+ VV  EA I+ +R   AG    Y  
Sbjct: 181 SSGTCLANDARHDLLRPGYALFGGNPDPGQPNPMRPVVRLEATILQVRDVEAGATCGYNA 240

Query: 259 QKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMT 318
           + +      +A  ++GYADGYP + S  +S H+          + G   PI+G I+MD+ 
Sbjct: 241 RWQAPAPRRLATLSLGYADGYPRSAS--NSGHA---------LVGGMPCPIVGLISMDLI 289

Query: 319 MFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFY 369
           + D+TD+     G    + G  + +D V  A+GT  Y++L  +G+RY + Y
Sbjct: 290 ILDVTDASQARRGGTATLIGDSLDIDTVGQAAGTIGYEILTSLGSRYVRNY 340


>gi|163853336|ref|YP_001641379.1| alanine racemase [Methylobacterium extorquens PA1]
 gi|163664941|gb|ABY32308.1| alanine racemase [Methylobacterium extorquens PA1]
          Length = 342

 Score =  222 bits (565), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 122/351 (34%), Positives = 189/351 (53%), Gaps = 14/351 (3%)

Query: 19  NWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLRLYTPQA 78
           NW ++ A +  A   AVVK +AYG G   +APAL+ AG + FFV  + EG+  R   P+A
Sbjct: 4   NWRALGACAPQAECGAVVKADAYGCGLAAVAPALWRAGCRTFFVAHLSEGIAARKILPEA 63

Query: 79  RIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVDTGFNRLGLS 138
            ++VL G+ PG+ +      L PV+    +L  +++ M    + P AL VDTG NRLGLS
Sbjct: 64  ALYVLNGLPPGRAEAFRAHRLRPVLGDAQELAEWAEAMQG--AGPAALHVDTGMNRLGLS 121

Query: 139 LQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHYKGIEASLAS 198
           + EAL    +    + G + L++SHL  A+ P   +N+ Q   F  + + +  + ASLA+
Sbjct: 122 VAEALALAGDPVIARAG-IDLVMSHLVSAERPGDPLNARQAADFARVRAAFPQMRASLAN 180

Query: 199 SSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKALAGELVSYGG 258
           SSG  L  +    L RPG +L+GG     + +PM+ VV  EA I+ +R   AG    Y  
Sbjct: 181 SSGTCLANDARHDLLRPGYALFGGNPDPGQPNPMRPVVRLEATILQVRDVEAGATCGYNA 240

Query: 259 QKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMT 318
           + +      +A  ++GYADGYP + S  +S H+          + G   PI+G I+MD+ 
Sbjct: 241 RWQAPAPRRLATLSLGYADGYPRSAS--NSGHA---------LVGGVPCPIVGLISMDLI 289

Query: 319 MFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFY 369
           + D+TD+     G    + G  + +D V  A+GT  Y++L  +G+RY + Y
Sbjct: 290 ILDVTDATQARRGGTATLIGDSLDIDTVGHAAGTIGYEILTSLGSRYVRNY 340


>gi|254700123|ref|ZP_05161951.1| Alr, alanine racemase [Brucella suis bv. 5 str. 513]
 gi|261750615|ref|ZP_05994324.1| alanine racemase [Brucella suis bv. 5 str. 513]
 gi|261740368|gb|EEY28294.1| alanine racemase [Brucella suis bv. 5 str. 513]
          Length = 399

 Score =  222 bits (565), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 137/378 (36%), Positives = 202/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAAYAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 369

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 370 TIPYEILTALGNRYARVY 387


>gi|23500650|ref|NP_700090.1| alanine racemase [Brucella suis 1330]
 gi|161620975|ref|YP_001594861.1| alanine racemase [Brucella canis ATCC 23365]
 gi|31076598|sp|Q8FVC1|ALR_BRUSU RecName: Full=Alanine racemase
 gi|189027529|sp|A9MCK3|ALR_BRUC2 RecName: Full=Alanine racemase
 gi|23464295|gb|AAN34095.1| alanine racemase [Brucella suis 1330]
 gi|161337786|gb|ABX64090.1| alanine racemase [Brucella canis ATCC 23365]
          Length = 396

 Score =  222 bits (565), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 137/378 (36%), Positives = 202/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 18  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 77

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 78  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 137

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 138 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 197

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 198 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 257

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 258 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 309

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 310 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 366

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 367 TIPYEILTALGNRYARVY 384


>gi|167646468|ref|YP_001684131.1| alanine racemase [Caulobacter sp. K31]
 gi|167348898|gb|ABZ71633.1| alanine racemase [Caulobacter sp. K31]
          Length = 360

 Score =  222 bits (565), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 138/366 (37%), Positives = 195/366 (53%), Gaps = 14/366 (3%)

Query: 4   NEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVT 63
            E  RL +DL AL +N   + A +G A  A  VK + YGLG   +A  L++ G + F+V 
Sbjct: 2   TETSRLTLDLDALASNHAVLRAAAGGAEIAPAVKADGYGLGAALVAGRLWDEGARSFYVA 61

Query: 64  SVEEGVKLR--LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVS 121
            + EG+ LR  L    A I++L G+ PG    I   +L PV++S+PQ+  ++   + G +
Sbjct: 62  RLSEGLALRRALGDRAAAIYLLDGVTPGSAPAIEGASLTPVLNSLPQVEAWNS-HARGRA 120

Query: 122 HPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              AL +DTG NRLGL  +EA          K   ++L+ISHLACA +P   +N+ QL R
Sbjct: 121 LDAALHIDTGMNRLGLRPEEAAVLVAAMDRLKHVNITLVISHLACASEPDHPLNARQLAR 180

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEAR 241
           F    + +     SLA+S GI LG  YHF   RPGISLYGG  +      +Q VVT EA 
Sbjct: 181 FTEAAALFPNARRSLANSGGIFLGDPYHFDQCRPGISLYGGGPRDIPDTRIQAVVTLEAP 240

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           ++  R    GE + YG        + +A+ A GYADG P            +    G  +
Sbjct: 241 VLQTRVVPRGESIGYGAAFTAQETTRVAILAAGYADGVPR-----------AAHPRGAVW 289

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
             G   P+LG+++MD+   DITD  +   G  +QI GPD+ +DD A A+GTT Y+LL RI
Sbjct: 290 FDGARRPMLGRVSMDLIAVDITDCDAARPGAMMQILGPDVLVDDAAAAAGTTAYELLTRI 349

Query: 362 GTRYAK 367
             R  +
Sbjct: 350 APRARR 355


>gi|148261853|ref|YP_001235980.1| alanine racemase [Acidiphilium cryptum JF-5]
 gi|226711024|sp|A5G2H9|ALR_ACICJ RecName: Full=Alanine racemase
 gi|146403534|gb|ABQ32061.1| alanine racemase [Acidiphilium cryptum JF-5]
          Length = 357

 Score =  222 bits (565), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 133/360 (36%), Positives = 192/360 (53%), Gaps = 14/360 (3%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L ID  A+  NW ++ A       A VVK +AYGLG   IAPAL  AG + FFV +++E 
Sbjct: 6   LTIDPGAVAANWQALAARH-TGEVAGVVKADAYGLGAALIAPALAAAGCRSFFVATLDEA 64

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQV 128
           + LR   P ARI VL G  PG+E  +    L PV+ S+     +        + P  L +
Sbjct: 65  LSLRALLPAARIGVLNGCPPGEEGTMRARELRPVLGSLAACARWRGAAGDDKAPPSFLHL 124

Query: 129 DTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           DTG NRLGL   EA     H +    LG L+ +++HL  A++P +  N+ Q ERF    +
Sbjct: 125 DTGMNRLGLDRDEAAHLIAHPTLLDGLG-LTHVMTHLVAAEEPDASANAAQRERFAAFAA 183

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            +  +  SLA+SSG+ LGP +   L RPG +LYGG      ++PM+  +   A I+ IR 
Sbjct: 184 RFPWLRTSLANSSGLFLGPGFGSDLARPGYALYGGNPTPTAANPMRPAIALAAPILQIRA 243

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
             +GE V Y G  +  R S IA   +GYADG P +LS   +              +G ++
Sbjct: 244 IASGETVGYNGTWRAARPSRIATIGVGYADGLPRSLSNRLTAR-----------WQGKII 292

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           P+ G+++MD+T FD+TD   I  GD I++ GP   +D  A  +GT  Y++L  +G RY +
Sbjct: 293 PVAGRLSMDLTTFDVTDHPDIAPGDVIELIGPGHDIDAFAAEAGTIGYEILTSLGPRYRR 352


>gi|227818945|ref|YP_002822916.1| alanine racemase, catabolic [Sinorhizobium fredii NGR234]
 gi|227337944|gb|ACP22163.1| alanine racemase, catabolic [Sinorhizobium fredii NGR234]
          Length = 377

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 137/367 (37%), Positives = 200/367 (54%), Gaps = 19/367 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL+ N+  ++A    A  AAVVK +AYGLG E+++ AL+  G + FFV  + E 
Sbjct: 23  LTIDLAALQRNYRKLSAAVAPASAAAVVKADAYGLGAEQVSKALHAQGCRHFFVAHLPEA 82

Query: 69  VKLRLYTPQ-ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYS-KLMSCGVSHPYAL 126
           +KLR   P    IFVL G+ PG E    + +++PV++S+ Q   +S      G   P  L
Sbjct: 83  LKLRPLLPNDTHIFVLNGLQPGAEITCTNADVVPVLNSLEQFRRWSFTAEKLGRVFPAVL 142

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL--IISHLACADDPSSHVNSVQLERFRT 184
           Q DTG +RLG+  QE          K  G L +  I+SH+ACAD+     N+ QL   R 
Sbjct: 143 QFDTGMSRLGVPPQERTALAAEL--KGCGNLEILFIMSHVACADEADKKQNADQLAEMRV 200

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           + + + G++   A+S G+ LG +YH  L RPGI+LYGG     + +PM+ VV  E  +I 
Sbjct: 201 IAAEFAGLDVCFANSGGVFLGGDYHGVLARPGIALYGGAPTAGRYNPMEPVVRLEVAVIQ 260

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
            R   AG  V YGG    +  + +A  A GYADG P +LS             G  F  G
Sbjct: 261 TRTVPAGTRVGYGGAHVTSAKTRLATIAAGYADGLPRSLSDC-----------GAVFYDG 309

Query: 305 YMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
             +PI+G+++MD    DIT     ++ +G  +++ GP   L+DVA A+GT +Y++L  +G
Sbjct: 310 VRLPIVGRVSMDSITVDITALPEGTLSLGSLVEVLGPHQTLEDVAEAAGTISYEILTSLG 369

Query: 363 TRYAKFY 369
            RY + Y
Sbjct: 370 RRYERRY 376


>gi|163845038|ref|YP_001622693.1| alanine racemase [Brucella suis ATCC 23445]
 gi|189027530|sp|A9WVT5|ALR_BRUSI RecName: Full=Alanine racemase
 gi|163675761|gb|ABY39871.1| alanine racemase [Brucella suis ATCC 23445]
          Length = 396

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 136/378 (35%), Positives = 202/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 18  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 77

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG +       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 78  VALKPFLKPDATLYVLNGLQPGTQAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 137

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 138 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 197

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 198 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 257

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 258 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 309

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 310 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 366

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 367 TIPYEILTALGNRYARVY 384


>gi|254712683|ref|ZP_05174494.1| Alr, alanine racemase [Brucella ceti M644/93/1]
 gi|254715753|ref|ZP_05177564.1| Alr, alanine racemase [Brucella ceti M13/05/1]
 gi|261217513|ref|ZP_05931794.1| alanine racemase [Brucella ceti M13/05/1]
 gi|260922602|gb|EEX89170.1| alanine racemase [Brucella ceti M13/05/1]
          Length = 399

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 137/378 (36%), Positives = 201/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP   L+DVA    
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQLLEDVARDCD 369

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 370 TIPYEILTALGNRYARVY 387


>gi|153008776|ref|YP_001369991.1| alanine racemase [Ochrobactrum anthropi ATCC 49188]
 gi|151560664|gb|ABS14162.1| alanine racemase [Ochrobactrum anthropi ATCC 49188]
          Length = 380

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 126/366 (34%), Positives = 199/366 (54%), Gaps = 19/366 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL+AL++N+ ++       R AAVVK +AYGLG  ++APA Y+AG +DFFV  + E 
Sbjct: 21  LTIDLSALRHNYSAIARHIAPTRAAAVVKADAYGLGASRVAPAFYDAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           + L+ +  P A ++VL G+ PG E+      ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  IALKPFIQPDATLYVLNGLQPGTEEACAREGILPVLNSLEQIENWAALATRQGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG +RLGLS +E   F  N+       +  +ISHLA  D+P +  N+ QL     L+
Sbjct: 141 QLDTGMSRLGLSPKEFERFLENATLLDAIDIKFVISHLASGDEPENAANARQLANMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           +    +  + A+S G  L   YHF L RPG++LYG    +     +  V+T  AR+I +R
Sbjct: 201 ARLPKLPVAFANSGGSFLDKTYHFDLARPGVALYG----VGPKSEIIPVLTLSARVIQVR 256

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G  V YGG         +A  A+GYADG+  +LS             G  F     
Sbjct: 257 DIDKGAAVGYGGAYIAEGPMRVATIAVGYADGWFRSLSN-----------KGAAFFGDTR 305

Query: 307 VPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           +PI+G+++MD    D++     ++++G  +++ GP  +L+DVA    T  Y++L  +G R
Sbjct: 306 LPIIGRVSMDSITLDVSALPEGTLKLGSLVELIGPHQRLEDVARDCDTIPYEILTALGNR 365

Query: 365 YAKFYT 370
           YA+ Y 
Sbjct: 366 YARVYV 371


>gi|295689700|ref|YP_003593393.1| alanine racemase [Caulobacter segnis ATCC 21756]
 gi|295431603|gb|ADG10775.1| alanine racemase [Caulobacter segnis ATCC 21756]
          Length = 360

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 138/365 (37%), Positives = 195/365 (53%), Gaps = 16/365 (4%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL IDL AL  N  ++ A +G+A  A  VK NAYGLG  ++A  L+  GV+ F+V  + E
Sbjct: 8   RLTIDLDALAANHAALQARAGDAEVAPAVKANAYGLGAARVADRLWAEGVRSFYVARLAE 67

Query: 68  GVKLR--LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           GV LR  L   +A I+VL G  PG    +    L PV++S+PQ+  ++     G     A
Sbjct: 68  GVALRAALGDREAAIYVLDGATPGAGDALEGARLTPVLNSLPQIEAWNAQARAG-RLKAA 126

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           L +DTG NRLGL  +E       +   K   L L+ISHLACAD P   +N+ QLERF   
Sbjct: 127 LHLDTGMNRLGLRPEELKVLLGATDRLKRLDLELVISHLACADVPDHPMNTRQLERFSEA 186

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP-MQTVVTAEARIIL 244
           ++       S A+S+G+ LG  Y F   RPGISLYGG  +  + HP ++ V T EA I+ 
Sbjct: 187 VAQLPNARKSFANSAGLFLGEAYRFDQARPGISLYGGGPE-GRPHPEIRAVATVEAPILQ 245

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R    GE V YG        + IA+   GYADG P       + H       G+ +  G
Sbjct: 246 VRVVPRGETVGYGATWTAPDTTRIAIVGAGYADGVP------RASHPK-----GQVWFDG 294

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
               +LG+++MD+   D+TD  +   G  +++ G ++ +DD A A+GTT Y+LL  I  R
Sbjct: 295 ARRQMLGRVSMDLMAVDVTDCDAARPGAMVELLGSNMPIDDAATAAGTTAYELLTNIAPR 354

Query: 365 YAKFY 369
             + Y
Sbjct: 355 ARRIY 359


>gi|261320388|ref|ZP_05959585.1| alanine racemase [Brucella ceti M644/93/1]
 gi|261293078|gb|EEX96574.1| alanine racemase [Brucella ceti M644/93/1]
          Length = 396

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 137/378 (36%), Positives = 201/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 18  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 77

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 78  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 137

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 138 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 197

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 198 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 257

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 258 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 309

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP   L+DVA    
Sbjct: 310 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQLLEDVARDCD 366

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 367 TIPYEILTALGNRYARVY 384


>gi|306841349|ref|ZP_07474058.1| alanine racemase [Brucella sp. BO2]
 gi|306288652|gb|EFM59988.1| alanine racemase [Brucella sp. BO2]
          Length = 399

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 138/379 (36%), Positives = 203/379 (53%), Gaps = 30/379 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           + L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  MALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NKS--HPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKEPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVAKGPMRIATIAVGYADGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLS---IEVGDYIQIFGPDIKLDDVALAS 350
               G  F     +PI+G+++MD    D+T SL    +++G  +++ GP  +L+DVA   
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVT-SLPEGMLKLGSLVELIGPHQRLEDVARDC 368

Query: 351 GTTNYDLLVRIGTRYAKFY 369
            T  Y++L  +G RYA+ Y
Sbjct: 369 DTIPYEILTALGNRYARVY 387


>gi|148557977|ref|YP_001257844.1| alanine racemase [Brucella ovis ATCC 25840]
 gi|166919547|sp|A5VVI9|ALR_BRUO2 RecName: Full=Alanine racemase
 gi|148369262|gb|ABQ62134.1| alanine racemase [Brucella ovis ATCC 25840]
          Length = 396

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 136/378 (35%), Positives = 201/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 18  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 77

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 78  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 137

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 138 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 197

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 198 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 257

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+   AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 258 PVLPLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 309

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 310 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 366

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 367 TIPYEILTALGNRYARVY 384


>gi|116249082|ref|YP_764923.1| putative alanine racemase [Rhizobium leguminosarum bv. viciae 3841]
 gi|109940037|sp|Q9RAE7|ALR2_RHIL3 RecName: Full=Alanine racemase, catabolic
 gi|115253732|emb|CAK12125.1| putative alanine racemase [Rhizobium leguminosarum bv. viciae 3841]
          Length = 377

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 130/368 (35%), Positives = 191/368 (51%), Gaps = 21/368 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  N+  + ++    R  AVVK +AYGLG E++A  LY+ G + FFV    E 
Sbjct: 23  LMIDLAALGRNYRKLVSMLAPVRAGAVVKADAYGLGAERVARTLYSEGCRHFFVAQFVEA 82

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK----LMSCGVSHP 123
           V+LR      A+IFVL G+ PG E    +  ++PV++S+ Q   +S     L  C    P
Sbjct: 83  VRLRPALAHDAQIFVLNGLQPGNEIACAEMGIVPVLNSLAQWRQWSAAARILKRC---LP 139

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR 183
             LQ DTG +RLG   +E  +      +    ++  I+SHLA ADD  S  N  Q     
Sbjct: 140 AVLQFDTGMSRLGFPREERRELAAALRDGSNVEILFIMSHLASADDMGSEQNGEQFAEMS 199

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARII 243
            +   + G + S A+S G+ LG  Y+  L RPGI+LYGG     + +PM+ VV+    ++
Sbjct: 200 RIADEFPGFDISFANSGGVFLGEAYYGVLARPGIALYGGAPNAGEKNPMEPVVSLNVAVV 259

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
             R   AG  V YGG     R++ +A  A GYADG P  LS             G  + K
Sbjct: 260 QTRTVPAGAKVGYGGAHVTQRETRLATIAAGYADGLPRCLSDR-----------GAVYFK 308

Query: 304 GYMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           G  +PI+G+++MD T  DIT     ++  G  +++ G    L+D+A  +GT +Y++L  +
Sbjct: 309 GVRLPIVGRVSMDSTTVDITALPEGALTFGSLVEVLGRHQTLEDIARDAGTISYEILTGL 368

Query: 362 GTRYAKFY 369
           G RY + Y
Sbjct: 369 GDRYDRQY 376


>gi|254563262|ref|YP_003070357.1| alanine racemase [Methylobacterium extorquens DM4]
 gi|254270540|emb|CAX26543.1| putative alanine racemase (alr-like) [Methylobacterium extorquens
           DM4]
          Length = 342

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 121/351 (34%), Positives = 185/351 (52%), Gaps = 14/351 (3%)

Query: 19  NWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLRLYTPQA 78
           NW ++ A +  A   AVVK +AYG G   +APAL+ AG + FFV  + EG+  R   P+A
Sbjct: 4   NWRALGACAPQAECGAVVKADAYGCGLAAVAPALWRAGCRTFFVAHLSEGIAARKILPEA 63

Query: 79  RIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVDTGFNRLGLS 138
            ++VL G+ PG  +      L PV+    +L  +++ M    + P AL VDTG NRLGLS
Sbjct: 64  ALYVLNGLPPGHAEAFRAHRLRPVLGDAQELAEWAEAMQG--AGPAALHVDTGMNRLGLS 121

Query: 139 LQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHYKGIEASLAS 198
           + EAL    +    + G + L++SHL  A+ P   +N+ Q   F  + + +  + ASLA+
Sbjct: 122 VAEALALAGDPVIARAG-IDLVMSHLVSAELPDDPLNTRQAADFARVRAAFPQMRASLAN 180

Query: 199 SSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKALAGELVSYGG 258
           SSG  L  +    L RPG +L+GG     + +PM+ VV  EA I+ +R   AG    Y  
Sbjct: 181 SSGTCLANDARHDLLRPGYALFGGNPDPGQPNPMRPVVRLEATILQVRDVEAGATCGYNA 240

Query: 259 QKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMT 318
           + +      +A  ++GYADGYP + S             G   + G   PI+G I+MD+ 
Sbjct: 241 RWQAPAPRRLATLSLGYADGYPRSASN-----------SGHALVGGVPCPIVGLISMDLI 289

Query: 319 MFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFY 369
           + D+TD+     G    + G  + +D V  A+GT  Y++L  +G+RY + Y
Sbjct: 290 ILDVTDATQARRGGTATLIGDALDIDTVGQAAGTIGYEILTSLGSRYVRDY 340


>gi|254488701|ref|ZP_05101906.1| alanine racemase [Roseobacter sp. GAI101]
 gi|214045570|gb|EEB86208.1| alanine racemase [Roseobacter sp. GAI101]
          Length = 376

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 139/363 (38%), Positives = 201/363 (55%), Gaps = 28/363 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NWH +N +S   +T AVVK +AYGLG +++AP L   G + FFV + +EG
Sbjct: 38  LTIDLHAIAANWHMLNRMS-QGQTGAVVKADAYGLGIDRVAPVLAQEGARQFFVATTKEG 96

Query: 69  VKL-RLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           V L R+  P   I +  G  PG  + I    L P+I+SV QL  + + +     HP+ LQ
Sbjct: 97  VALRRVLGPGPAINLFAGHMPGDAEKIRSAQLTPMINSVDQLIGHVETLP---GHPFGLQ 153

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           ++TG NRLG+   E       + ++      LIISHLACAD+P   +N+ QL+ FR + +
Sbjct: 154 LNTGMNRLGMDASEWGALRDIALSQ---HPRLIISHLACADEPGHKMNAAQLKSFRDMTA 210

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
             K I  SL ++ GILLG +YHF LTRPGI LYGG   ++     Q VVT +  +I +R+
Sbjct: 211 GLK-IPLSLGATGGILLGADYHFSLTRPGIGLYGGLPFVDA----QPVVTLDLPVIQVRE 265

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTL-SGLDSEHSPSVFLGGKGFIKGYM 306
             AG  V Y       R S IA  + GYADG    + +G    H+            G  
Sbjct: 266 VPAGGSVGYACGWIAPRPSRIATVSGGYADGLIRAMGNGATMTHN------------GTK 313

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
           VP++G+++MD+   DIT +L+   G ++Q+ G    +D VA  +GT  Y++L  +G RY 
Sbjct: 314 VPVVGRVSMDLITVDIT-TLTDTPG-HLQLLGQHQSVDTVAGFAGTIGYEILTSLGPRYD 371

Query: 367 KFY 369
           + Y
Sbjct: 372 RVY 374


>gi|256157422|ref|ZP_05455340.1| Alr, alanine racemase [Brucella ceti M490/95/1]
 gi|256253600|ref|ZP_05459136.1| Alr, alanine racemase [Brucella ceti B1/94]
 gi|261220737|ref|ZP_05935018.1| alanine racemase [Brucella ceti B1/94]
 gi|265995910|ref|ZP_06108467.1| alanine racemase [Brucella ceti M490/95/1]
 gi|260919321|gb|EEX85974.1| alanine racemase [Brucella ceti B1/94]
 gi|262550207|gb|EEZ06368.1| alanine racemase [Brucella ceti M490/95/1]
          Length = 399

 Score =  219 bits (558), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 136/378 (35%), Positives = 201/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYA G   +LS         
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYAAGLFRSLSN-------- 312

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 313 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 369

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 370 TIPYEILTALGNRYARVY 387


>gi|256015684|ref|YP_003105693.1| alanine racemase [Brucella microti CCM 4915]
 gi|255998344|gb|ACU50031.1| alanine racemase [Brucella microti CCM 4915]
          Length = 396

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 136/378 (35%), Positives = 201/378 (53%), Gaps = 28/378 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 18  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 77

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 78  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 137

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 138 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 197

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+L G         +DK+   NK   H + 
Sbjct: 198 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALCGIDPERQHDFSDKVAHENKKPKHSIL 257

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  AR+I +R    G  V YGG         IA  A+GYADG   +LS         
Sbjct: 258 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVGYADGLFRSLSN-------- 309

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASG 351
               G  F     +PI+G+++MD    D+T     ++++G  +++ GP  +L+DVA    
Sbjct: 310 ---KGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCD 366

Query: 352 TTNYDLLVRIGTRYAKFY 369
           T  Y++L  +G RYA+ Y
Sbjct: 367 TIPYEILTALGNRYARVY 384


>gi|5805088|emb|CAB53547.1| alanine racemase [Rhizobium leguminosarum bv. viciae]
          Length = 354

 Score =  219 bits (557), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 129/366 (35%), Positives = 190/366 (51%), Gaps = 21/366 (5%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL  N+  + ++    R  AVVK +AYGLG E++A  LY+ G + FFV    E V+
Sbjct: 2   IDLAALGRNYRKLVSMLAPVRAGAVVKADAYGLGAERVARTLYSEGCRHFFVAQFVEAVR 61

Query: 71  LR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK----LMSCGVSHPYA 125
           LR      A+IFVL G+ PG E    +  ++PV++S+ Q   +S     L  C    P  
Sbjct: 62  LRPALAHDAQIFVLNGLQPGNEIACAEMGIVPVLNSLAQWRQWSAAARILKRC---LPAV 118

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           LQ DTG +RLG   +E  +      +    ++  I+SHLA ADD  S  N  Q      +
Sbjct: 119 LQFDTGMSRLGFPREERRELAAALRDGSNVEILFIMSHLASADDMGSEQNGEQFAEMSRI 178

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
              + G + S A+S G+ LG  Y+  L RPGI+LYGG     + +PM+ VV+    ++  
Sbjct: 179 ADEFPGFDISFANSGGVFLGEAYYGVLARPGIALYGGAPNAGEKNPMEPVVSLNVAVVQT 238

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R   AG  V YGG     R++ +A  A GYADG P  LS             G  + KG 
Sbjct: 239 RTVPAGAKVGYGGAHVTQRETRLATIAAGYADGLPRCLSDR-----------GAVYFKGV 287

Query: 306 MVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            +PI+G+++MD T  DIT     ++  G  +++ G    L+D+A  +GT +Y++L  +G 
Sbjct: 288 RLPIVGRVSMDSTTVDITALPEGALTFGSLVEVLGRHQTLEDIARDAGTISYEILTGLGD 347

Query: 364 RYAKFY 369
           RY + Y
Sbjct: 348 RYDRQY 353


>gi|220924500|ref|YP_002499802.1| alanine racemase [Methylobacterium nodulans ORS 2060]
 gi|254802370|sp|B8IEC7|ALR_METNO RecName: Full=Alanine racemase
 gi|219949107|gb|ACL59499.1| alanine racemase [Methylobacterium nodulans ORS 2060]
          Length = 370

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/370 (34%), Positives = 195/370 (52%), Gaps = 15/370 (4%)

Query: 3   SNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFV 62
           S+   RL IDL AL  NW  + A +  A  AAV+K +AYG G  ++APAL++AG + FFV
Sbjct: 5   SSHGARLTIDLGALAANWRRLAAEAAGAECAAVIKADAYGCGIAQVAPALWDAGCRTFFV 64

Query: 63  TSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK-LMSCGVS 121
             + E  + R     A I+VL G  PG           PV+ S  ++  +++   S G  
Sbjct: 65  AHLSEAERTRAVLSDATIYVLNGFPPGSAPAYRAMGFRPVLGSRSEIAEWAQACRSLGER 124

Query: 122 HPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            P AL VDTG NRLGL+  EA+D   ++      Q +L++SHL  A+ P   + + Q+  
Sbjct: 125 LPAALHVDTGMNRLGLNPAEAIDLAGDAVLGAF-QPTLLMSHLVSAEVPGDAITARQIAE 183

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEAR 241
           F  +   Y  + ASLA+S+GI LG     ++ RPG +LYGG     + +PM+ VV  EA 
Sbjct: 184 FARVRMAYPALPASLANSAGIFLGKAARHEIVRPGYALYGGNPTPERENPMRPVVRLEAA 243

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           I+ +R+  AGE   Y  +       L+A  ++GYADGYP   SG             +  
Sbjct: 244 ILQLREVAAGETAGYNARWTAPGPRLLATLSLGYADGYPRAGSGR-----------AEAL 292

Query: 302 IKGYMVPILGKITMDMTMFDITDSL--SIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
           + G   P +G I+MD+ + D+T +   ++  G  + + G  + LD+V   +GT  Y++L 
Sbjct: 293 VGGVRCPFVGTISMDLVILDVTQAPPEAVRRGAPVVLIGDGLTLDEVGQRAGTIGYEILT 352

Query: 360 RIGTRYAKFY 369
            +G+RY + Y
Sbjct: 353 NLGSRYDRHY 362


>gi|209885499|ref|YP_002289356.1| alanine racemase [Oligotropha carboxidovorans OM5]
 gi|209873695|gb|ACI93491.1| alanine racemase [Oligotropha carboxidovorans OM5]
          Length = 412

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 127/364 (34%), Positives = 194/364 (53%), Gaps = 10/364 (2%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NW ++ + +  A  +AV+K +AYG G   +   L +AG + FFV ++ E 
Sbjct: 26  LTIDLDAIVANWKALESRTVPAECSAVIKADAYGCGLTPVTRKLASAGCKTFFVATLAEA 85

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYALQ 127
            + R   P+A I+VL G+           +  PVI  + +L  +       G     ALQ
Sbjct: 86  KQAREAAPKAVIYVLNGLFANCGDDFAKIDARPVIGDLNELAEWDAFRRTRGWRGQAALQ 145

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           ++TG NRLGL+  EA            G ++L++SHLACA+D ++ +N  QL  FR + S
Sbjct: 146 INTGMNRLGLNPDEARGLAPRIREPDHG-IALVLSHLACAEDVANPMNGRQLAAFRDVAS 204

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+ ASL +SSGI LGP++H  L RPG +LYG        +PMQ V+  + RI  IR 
Sbjct: 205 EFSGVPASLVNSSGIFLGPHFHMDLARPGAALYGLNPTPGSDNPMQPVIGLKVRIAQIRS 264

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
               E V YG      R + +A+ + GYADGY    SG++   S  V + G+        
Sbjct: 265 VPKDETVGYGALWHAKRPTRLAIVSAGYADGYFRAASGIEGTRSAQVVVAGQ------RC 318

Query: 308 PILGKITMDMTMFDITDSL--SIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           PI+G+++MD+   DITD    ++  G ++ + G  I  D+++   GT  Y++L  +G RY
Sbjct: 319 PIVGRVSMDLMAIDITDVPHGAVRRGHFVTLIGDGITADELSHHFGTIGYEVLTSLGHRY 378

Query: 366 AKFY 369
           A+ Y
Sbjct: 379 ARDY 382


>gi|182679264|ref|YP_001833410.1| alanine racemase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635147|gb|ACB95921.1| alanine racemase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 379

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 132/372 (35%), Positives = 198/372 (53%), Gaps = 22/372 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+  NW ++ A+ G A   AVVK +AYG+G E +   L  AG + +FV  V EG
Sbjct: 18  LSVDLAAIVRNWRTLQAVCGEAECGAVVKADAYGVGLEPVVRELSAAGCKTYFVAHVFEG 77

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQL-------TFYSKLMSCGVS 121
            + R     A I+VL G+ PG      +  L PV+ S+P++         + +  + G +
Sbjct: 78  RRARAIDASAIIYVLNGLVPGTAPAYLEHGLRPVLCSLPEIEEWLQFCALFGRRSAEGET 137

Query: 122 HPYALQVDTGFNRLGLSL---QEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQ 178
            P ALQ+DTG NRLGL L   + A D T  S N KL     I+S    +   +      Q
Sbjct: 138 LPAALQLDTGLNRLGLRLDQIERAADLTE-SLNIKL-----ILSQFIWSGQSNLARCETQ 191

Query: 179 LERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTA 238
           +  F ++   +K + AS+A+S+GI L     + L RPG +LYGG     + +PMQ V+  
Sbjct: 192 VSLFESMRQPWKQVPASIANSAGIFLERTPLYDLVRPGYALYGGNPAPGRPNPMQGVLRL 251

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           EARI+ +     GE V Y G+        +A  +IGYADG P   S L SE  P    GG
Sbjct: 252 EARILQVNHVEQGETVGYDGRYLAKSPRRLATISIGYADGIP--RSALGSEVHP----GG 305

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
           +  +KG   P +G+++MD+T+ DIT +     GD +++ G  I +D++A  S T  Y++L
Sbjct: 306 EVVVKGVRCPFVGRVSMDLTVVDITLAPEAMRGDTVELIGKAISIDELATRSRTIGYEIL 365

Query: 359 VRIGTRYAKFYT 370
             +G+R+ + YT
Sbjct: 366 TNLGSRFYRRYT 377


>gi|86361167|ref|YP_473054.1| alanine racemase protein [Rhizobium etli CFN 42]
 gi|86285269|gb|ABC94327.1| alanine racemase protein [Rhizobium etli CFN 42]
          Length = 377

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 128/367 (34%), Positives = 195/367 (53%), Gaps = 19/367 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  N+  + ++    R  AVVK +AYGLG E++A  LY+ G + FFV    E 
Sbjct: 23  LTIDLAALGRNYSKLASMLAPVRAGAVVKADAYGLGAERVAQTLYDQGCRHFFVAQFVEA 82

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V+LR      A+IFVL G+ PG E    ++ ++PV++S+ Q   +S+       S P  L
Sbjct: 83  VRLRPALAKAAQIFVLNGLQPGSELACAESGIVPVLNSLAQWRQWSETARRLKRSLPAVL 142

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLG   +E  +      +    ++  I+SHLACADD  S  N  Q+     + 
Sbjct: 143 QFDTGMSRLGFPEEERAELAAAIRDGANVEILFIMSHLACADDLESSQNGEQIAEMARIA 202

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
             + G + S A+S G+ LG  YH  L RPGI+LYGG       +PM+ V+  +  ++  R
Sbjct: 203 DEFPGFDISFANSGGVFLGDAYHGVLARPGIALYGGAPNAGGKNPMEPVLRLDVAVVQTR 262

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI--KG 304
              +G  + YGG       + +A  A GYADG P +             LG +G +  KG
Sbjct: 263 TVPSGTKIGYGGAYVTRSQTRLATIAAGYADGLPRS-------------LGDRGAVYHKG 309

Query: 305 YMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
             +PI+G+++MD    DIT     ++ +G  +++ GP+  L+DVA  +GT +Y++L  +G
Sbjct: 310 TRLPIVGRVSMDSATVDITALPEGALSLGSLVEVLGPNQTLEDVAGDAGTISYEILTGLG 369

Query: 363 TRYAKFY 369
            RY + Y
Sbjct: 370 DRYDRHY 376


>gi|218674907|ref|ZP_03524576.1| alanine racemase protein [Rhizobium etli GR56]
          Length = 338

 Score =  216 bits (550), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 122/347 (35%), Positives = 184/347 (53%), Gaps = 21/347 (6%)

Query: 31  RTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLR-LYTPQARIFVLYGIHPG 89
           R  AVVK +AYGLG E++A  LY+ G + FFV    E V+LR      A+IFVL G+ PG
Sbjct: 6   RAGAVVKADAYGLGAERVAQTLYDQGCRHFFVAQFVEAVRLRPALAESAQIFVLNGLQPG 65

Query: 90  QEKIIFDTNLIPVISSVPQLTFYS----KLMSCGVSHPYALQVDTGFNRLGLSLQEALDF 145
            E    ++ ++PV++S+ Q   +S    +L  C    P  LQ DTG +RLG   +E  + 
Sbjct: 66  NEVACAESGIVPVLNSLAQWRQWSATARRLKRC---LPAVLQFDTGMSRLGFPWEERAEL 122

Query: 146 THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHYKGIEASLASSSGILLG 205
                +    ++  I+SHLACADD  S  N  Q      +   + G + S A+S G+ LG
Sbjct: 123 AAALRDGANVEILFIMSHLACADDLESSQNGEQFAEMARIADEFPGFDISFANSGGVFLG 182

Query: 206 PNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRD 265
             YH  L RPGI+LYGG      ++PM+ VV  +  ++  R   +G  + YGG      +
Sbjct: 183 DAYHGVLARPGIALYGGAPSAGGTNPMEPVVRLDVAVVQTRTVPSGAKIGYGGTHVTRSE 242

Query: 266 SLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDIT-- 323
           + +A  A GYADG P +L              G  + KG  +PI+G+++MD    DIT  
Sbjct: 243 TRLATIAAGYADGLPRSLGDC-----------GAVYHKGIRLPIVGRVSMDSATVDITAL 291

Query: 324 DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFYT 370
              ++ +G  +++ GP+  L+DVA  +GT +Y++L  +G RY + Y 
Sbjct: 292 PEGALSLGSLVEVLGPNQTLEDVAGDAGTISYEILTGLGDRYDRHYC 338


>gi|240140752|ref|YP_002965232.1| putative alanine racemase (alr-like) [Methylobacterium extorquens
           AM1]
 gi|240010729|gb|ACS41955.1| putative alanine racemase (alr-like) [Methylobacterium extorquens
           AM1]
          Length = 342

 Score =  215 bits (548), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 119/354 (33%), Positives = 184/354 (51%), Gaps = 14/354 (3%)

Query: 16  LKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLRLYT 75
           +  NW ++ A +  A   AVVK +AYG G   +APAL+ AG + FFV  + EG+  R   
Sbjct: 1   MVTNWRALGACAPQAECGAVVKADAYGCGLAAVAPALWRAGCRTFFVAHLSEGIAARKIL 60

Query: 76  PQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVDTGFNRL 135
           P+A ++VL G+ PG  +      L PV+    +L  +++ M    + P AL VDTG NRL
Sbjct: 61  PEAALYVLNGLPPGHAEAFRAHRLRPVLGDAQELAEWAEAMQ--GAGPAALHVDTGMNRL 118

Query: 136 GLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHYKGIEAS 195
           GL + EAL    +    + G + L++SHL  A+ P   +N+ Q   F  + + +  + AS
Sbjct: 119 GLCVAEALALAGDPVIARAG-IDLVMSHLVSAELPDDPLNARQAADFARVRAAFPQMRAS 177

Query: 196 LASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKALAGELVS 255
           LA+SSG  L  +    L RPG +L+GG     + + M+ VV  EA I+ +R   AG    
Sbjct: 178 LANSSGTCLANDARHDLLRPGYALFGGNPDPGQPNSMRPVVRLEATILQVRNVEAGATCG 237

Query: 256 YGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITM 315
           Y  + +      +A  ++GYADGYP + S             G   + G   PI+G I+M
Sbjct: 238 YNARWQAPAPRRLATLSLGYADGYPRSASN-----------SGHALVGGVPCPIVGLISM 286

Query: 316 DMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFY 369
           D+ + D+TD+     G    + G  + +D V  A+GT  Y++L  +G+RY + Y
Sbjct: 287 DLIILDVTDATQARRGGTATLIGDSLDIDTVGQAAGTIGYEILTSLGSRYVRDY 340


>gi|89068949|ref|ZP_01156331.1| alanine racemase [Oceanicola granulosus HTCC2516]
 gi|89045530|gb|EAR51594.1| alanine racemase [Oceanicola granulosus HTCC2516]
          Length = 345

 Score =  215 bits (548), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 195/362 (53%), Gaps = 26/362 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  NW +++A+ G+A T AVVK + YGLG   +A  L+ AG + FFV   EEG
Sbjct: 6   LTIDLDALAANWRALDAM-GSAETGAVVKADGYGLGVAPVARTLHKAGARRFFVAVAEEG 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             LR    P   + V  G  PG  ++I D  L+P+++S+ Q+  + + +     HP+ +Q
Sbjct: 65  AALRQALGPNVDVCVFGGHMPGDSEMIGDLGLVPMLNSLEQVLRHFEALP---GHPFGIQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLG+ + E       +  +K     L++SHLACAD+P   +N+ QL  F  +  
Sbjct: 122 LDTGMNRLGMEMSEWAAVAEIALQQK---PVLVMSHLACADEPDHEMNTRQLAEFHRMTD 178

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
             K +  SLA++ GILLG  Y F LTRPGI LYGG     ++ P   VVT E  +I +R 
Sbjct: 179 GIK-VPRSLAATGGILLGQEYQFDLTRPGIGLYGGR-PFEEARP---VVTLELPVIQVRD 233

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V YG      R + +A  A GYADG    LS     +  S++ G          
Sbjct: 234 VEPGESVGYGNSWIAERRTRLATVAAGYADGITRHLS-----NRASLWHGDA------PC 282

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           PI G+++MD+   DITD    E  D + +      +DD+A  +GT  Y++L ++G RY +
Sbjct: 283 PIRGRVSMDLICADITD--LPETPDSLALLNGRQGVDDIADIAGTIGYEVLTQLGPRYTR 340

Query: 368 FY 369
            +
Sbjct: 341 RH 342


>gi|288962767|ref|YP_003453061.1| alanine racemase [Azospirillum sp. B510]
 gi|288915033|dbj|BAI76517.1| alanine racemase [Azospirillum sp. B510]
          Length = 375

 Score =  215 bits (547), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 128/371 (34%), Positives = 194/371 (52%), Gaps = 24/371 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+  NW  +      A  +AVVK +AYGLG  ++ PAL  AG + F V   EE 
Sbjct: 16  LTVDLGAVVANWAQLRDRVAPAECSAVVKADAYGLGVARVVPALAAAGCRTFVVAQFEEA 75

Query: 69  VKLRL----YTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCGVSHP 123
           + +R       PQA++F L G+ PG E       ++PV++ +  +  +     S G   P
Sbjct: 76  LAVRRALEPVAPQAQVFSLGGMPPGCEGEFLANRILPVLNHLSGIASWRAFAASRGEVLP 135

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR 183
             + +DTG NRLGL   E  D   +    +   +   ++HLACA+D  + +N  QL+RFR
Sbjct: 136 AVVHIDTGMNRLGLGPDELDDLAAHPEWLEGIDVRYWMTHLACAEDFDNPMNGEQLDRFR 195

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARII 243
             ++     +AS A+SSGI  G +YHF L RPG +LYG        +PM+  V  +AR++
Sbjct: 196 DALARLPKAKASFANSSGIFHGKDYHFDLARPGCALYGVNPTPRLPNPMRGTVRLDARLL 255

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG--F 301
            +R   +   V Y    K+T    IA   IGYADGY  +             LGGKG  F
Sbjct: 256 QVRNCASPMTVGYAAAHKVTGPVRIATIGIGYADGYMRS-------------LGGKGHVF 302

Query: 302 IKGYMVPILGKITMDMTMFDIT---DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
           + G   PI+G+I+MD+   D+T   +S++   G  +++ GP+  +D VA  +GT  Y+++
Sbjct: 303 VDGVAAPIVGRISMDLITIDVTGLPESVA-HAGRMVELIGPNRPVDRVAEEAGTIGYEIM 361

Query: 359 VRIGTRYAKFY 369
             +G RY + Y
Sbjct: 362 TSLGRRYHRVY 372


>gi|83942625|ref|ZP_00955086.1| alanine racemase [Sulfitobacter sp. EE-36]
 gi|83846718|gb|EAP84594.1| alanine racemase [Sulfitobacter sp. EE-36]
          Length = 344

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 132/363 (36%), Positives = 201/363 (55%), Gaps = 28/363 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NW ++N ++G   T AV+K NAYGLG +++AP L   G + FFV   EEG
Sbjct: 6   LSIDLNAIAANWQALNKMTG-CDTGAVIKANAYGLGVDRVAPVLAAQGARKFFVAVAEEG 64

Query: 69  VKL-RLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           V L R+  P   I V  G  PG   +I    L P+I+SV Q+  + + +     H + +Q
Sbjct: 65  VALRRVLGPGPAINVFAGHMPGDADMIRSAALTPMINSVDQMIAHVEALP---GHRFGVQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +++G NRLG+   E       +  +     +LI+SHLACAD+P+  +N+ QL+ FR +  
Sbjct: 122 LNSGMNRLGMDPAEWAALRDIALAQN---PTLIMSHLACADEPNHPMNARQLKTFREMTD 178

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
               +  SLA++ GI+LG +YHF LTRPGI +YGG    +       VVT +  +I +R+
Sbjct: 179 GLN-VPRSLAATGGIMLGRDYHFDLTRPGIGVYGGLPFADA----MPVVTLDVPVIQVRE 233

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTL-SGLDSEHSPSVFLGGKGFIKGYM 306
              G+ V YG      R +L+A  A GYADG    L +G    H            +G  
Sbjct: 234 VATGQPVGYGCAWTAPRPTLVATVAAGYADGLIRALGNGATFTH------------EGRK 281

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
           +P++G+++MD+   D+T SL+ EV +++Q+ G    +D VA  +GT  Y++L  +G RY 
Sbjct: 282 LPVVGRVSMDLITVDVT-SLT-EVPEHLQLIGNYQSVDTVAGFAGTIGYEVLTALGARYD 339

Query: 367 KFY 369
           + Y
Sbjct: 340 RVY 342


>gi|144899038|emb|CAM75902.1| Alanine racemase [Magnetospirillum gryphiswaldense MSR-1]
          Length = 369

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 133/371 (35%), Positives = 203/371 (54%), Gaps = 25/371 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+ +NW ++ A + NA  A VVK + YGLG   +A AL  AG   FFV +++EG
Sbjct: 11  LSIDLDAIADNWRTLAAHAPNAEAAGVVKADGYGLGAAPVARALRKAGCTTFFVATIDEG 70

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYALQ 127
           + LR +   ARI VL G+ PG         LIPV++S  Q+  +S   + G    P A+ 
Sbjct: 71  ISLRPHVNDARILVLGGVLPGTGADFIGHQLIPVLNSPEQIGLWSGFAAAGGRPLPAAIH 130

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLG--QLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +D+G NRLGL  + A++    + N++L   Q  L++SH+ACAD+    +N  QL+RF T+
Sbjct: 131 IDSGMNRLGLD-ETAVELL-AADNRRLDGIQPVLVMSHMACADERDHAMNRQQLDRF-TV 187

Query: 186 ISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARII 243
           ++   G+ A  SLA+SS I LG +YHF L RPG  LYG     +  +P++  V    +I+
Sbjct: 188 LADRLGVSAPRSLAASSTIFLGADYHFDLIRPGAGLYGINPMPDSPNPLRQTVRLHGKIL 247

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF-- 301
            +R     + V YG   +      +A  A GYADG   +             LG +GF  
Sbjct: 248 QVRDVDTPQTVGYGASHRFKSKGRVATIACGYADGLFRS-------------LGNRGFGV 294

Query: 302 IKGYMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
           I G  VP++G+I+MD+   D++      +  G  +++ GPD  +D +A  +GT  Y++L 
Sbjct: 295 IGGVKVPVVGRISMDLITLDVSAVAPAHVHAGALVELIGPDHDVDALAAEAGTIGYEILT 354

Query: 360 RIGTRYAKFYT 370
            +G RY + Y+
Sbjct: 355 SLGRRYLRDYS 365


>gi|83953866|ref|ZP_00962587.1| alanine racemase [Sulfitobacter sp. NAS-14.1]
 gi|83841811|gb|EAP80980.1| alanine racemase [Sulfitobacter sp. NAS-14.1]
          Length = 344

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 131/363 (36%), Positives = 201/363 (55%), Gaps = 28/363 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NW ++N ++G   T AV+K NAYGLG +++AP L   G + FFV   EEG
Sbjct: 6   LSIDLNAIAANWQALNKMTG-CDTGAVIKANAYGLGIDRVAPVLAAQGARKFFVAVAEEG 64

Query: 69  VKL-RLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           V L R+  P   I V  G  PG   +I    L P+I+SV Q+  + + +     H + +Q
Sbjct: 65  VALRRVLGPGPAINVFAGHMPGDADMIRSAALTPMINSVDQMIAHVEALP---GHRFGVQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +++G NRLG+   E       +  +     +LI+SHLACAD+P+  +N+ QL+ FR +  
Sbjct: 122 LNSGMNRLGMDPAEWAALRDIALAQN---PTLIMSHLACADEPNHPMNARQLKTFREMTD 178

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
               +  SLA++ GI+LG +YHF LTRPGI +YGG    +       VVT +  +I +R+
Sbjct: 179 GLN-VPRSLAATGGIMLGRDYHFDLTRPGIGVYGGLPFADA----MPVVTLDVPVIQVRE 233

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTL-SGLDSEHSPSVFLGGKGFIKGYM 306
              G+ V YG      R +++A  A GYADG    L +G    H            +G  
Sbjct: 234 VATGQTVGYGCAWTAPRPTMVATVAAGYADGLIRALGNGATFTH------------EGRK 281

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
           +P++G+++MD+   D+T SL+ EV +++Q+ G    +D VA  +GT  Y++L  +G RY 
Sbjct: 282 LPVVGRVSMDLITVDVT-SLT-EVPEHLQLIGNYQSVDTVAGFAGTIGYEVLTALGARYD 339

Query: 367 KFY 369
           + Y
Sbjct: 340 RVY 342


>gi|332557893|ref|ZP_08412215.1| alanine racemase [Rhodobacter sphaeroides WS8N]
 gi|332275605|gb|EGJ20920.1| alanine racemase [Rhodobacter sphaeroides WS8N]
          Length = 349

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 138/365 (37%), Positives = 199/365 (54%), Gaps = 30/365 (8%)

Query: 9   LKIDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L IDL A+  NW +++ ++  + +T AVVK ++YGLG  K+A AL  AG + FFV + EE
Sbjct: 6   LTIDLDAIAANWRALDQMTASDCQTGAVVKADSYGLGAAKVAHALARAGARRFFVATCEE 65

Query: 68  GVKLRLY---TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           G  +R      PQ  I V  G   G   +I D +L P+++S+ QLT + + +      P+
Sbjct: 66  GADVRRALGSGPQ--ICVFSGHMEGDTALIRDFDLTPMLNSIDQLTRHFEALG---GQPF 120

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
            LQ+D+G NRLGL   E        F  + G   L++SHLAC+DDP   +NS QL  FR 
Sbjct: 121 GLQLDSGMNRLGLEPGEWEAVA--GFALEAGP-ELLMSHLACSDDPDHPMNSEQLGAFRA 177

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           + +   G+  SL+++ GILLGP +HF+LTRPGI LYGG     ++ P   VV     +I 
Sbjct: 178 M-TDGTGVPRSLSATGGILLGPAWHFELTRPGIGLYGGR-PFEEARP---VVRLSLPVIQ 232

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R+   GE V Y         S IA  A GYADG P TLS      S +    G+     
Sbjct: 233 VREVEIGEPVGYSNTWTAEHTSTIATVAAGYADGLPRTLS------SRATLYAGR----- 281

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
              P++G+++MD+   D+  S   EV + + I GP    DD+A  +GT  Y++L  +G R
Sbjct: 282 VPCPLVGRVSMDLITVDV--SHLPEVPETLDILGPHQTPDDLADTAGTIGYEILTSLGRR 339

Query: 365 YAKFY 369
           Y + Y
Sbjct: 340 YQRRY 344


>gi|239832571|ref|ZP_04680900.1| alanine racemase [Ochrobactrum intermedium LMG 3301]
 gi|239824838|gb|EEQ96406.1| alanine racemase [Ochrobactrum intermedium LMG 3301]
          Length = 380

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 194/366 (53%), Gaps = 19/366 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       R AAVVK +AYGLG  ++APA Y+AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIARHIAPTRAAAVVKADAYGLGASRVAPAFYDAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           + L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  +  L +  G   P  L
Sbjct: 81  IALKPFLQPDATLYVLNGLQPGTEAACARDGILPVLNSLEQIENWGALAARQGRKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG +RLGLS  E      N        +  +ISHLA  D+P +  N+ QL     L+
Sbjct: 141 QLDTGMSRLGLSASEFERLLENFALLDNIDIKFVISHLASGDEPENAANARQLANMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
                +  + A+S G  L  +YHF L RPG++LYG    +   + +  V+T  AR+I +R
Sbjct: 201 VRLPKLPVAFANSGGSFLDKSYHFDLARPGVALYG----VGPENEIVPVLTLSARVIQVR 256

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G  V YGG         +A  A+GYADG+  +LS             G  F     
Sbjct: 257 DIDKGAAVGYGGTYVAEGPMRVATIAVGYADGWFRSLSN-----------KGSAFFGDTR 305

Query: 307 VPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           +PI+G+++MD    D++     ++++G  +++ GP  +L+DVA    T  Y++L  +G R
Sbjct: 306 LPIIGRVSMDSITLDVSALPEGTLKLGSLVELIGPHQRLEDVARDCDTIPYEILTALGNR 365

Query: 365 YAKFYT 370
           YA+ Y 
Sbjct: 366 YARVYV 371


>gi|315498295|ref|YP_004087099.1| alanine racemase [Asticcacaulis excentricus CB 48]
 gi|315416307|gb|ADU12948.1| alanine racemase [Asticcacaulis excentricus CB 48]
          Length = 376

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 126/365 (34%), Positives = 196/365 (53%), Gaps = 19/365 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L++DL ALK N+  +  L+     +AVVK +AYGLG + ++  L+  G + FFV    E 
Sbjct: 18  LRVDLGALKANYLKLCQLAAPTPVSAVVKADAYGLGVKAVSATLHAVGCRHFFVALTREA 77

Query: 69  VKLRLYTP-QARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCGVSHPYAL 126
            +LR + P  A ++VL G+ PG E    +  LIPV+    QL  ++ +    G + P  L
Sbjct: 78  FELRSHLPTDAALYVLNGLTPGSEARAAEARLIPVLDCPEQLDAWAAVARQRGQTLPALL 137

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLG-QLSLIISHLACADDPSSHVNSVQLERFRTL 185
           QVDTG +RLG  + E L     +  +  G ++  ++SHLACAD+P++  N  QLE F   
Sbjct: 138 QVDTGMSRLGF-MPEDLKALATAQERLQGLRIDYLMSHLACADEPANPANGQQLEAFEMA 196

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
              +       A+S G+ LG  YH  L RPGI+LYG    +++ +PMQ V+  +  ++  
Sbjct: 197 SRLFPDTPLCFANSGGLFLGAEYHADLCRPGIALYGAAPHLDRPNPMQPVIALDLAVLQT 256

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R   AG  + YGG         +A  + GYADG P  L              G  + KG 
Sbjct: 257 RTVPAGTRIGYGGTVVTDAPKRLATLSAGYADGLPRRLGD-----------QGAVYFKGT 305

Query: 306 MVPILGKITMDMTMFDITDSL---SIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            +P +G+++MD  + DI D+L   +++ GD++++ GP   LD VA A+GT  Y++L ++G
Sbjct: 306 RLPFIGRVSMDSIIIDI-DALPEGTLKTGDFVELIGPHQSLDAVAEAAGTIAYEILTQLG 364

Query: 363 TRYAK 367
            RY +
Sbjct: 365 PRYHR 369


>gi|114569759|ref|YP_756439.1| alanine racemase [Maricaulis maris MCS10]
 gi|114340221|gb|ABI65501.1| alanine racemase [Maricaulis maris MCS10]
          Length = 366

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 131/366 (35%), Positives = 190/366 (51%), Gaps = 21/366 (5%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL IDL A+K N+ ++  L+  A   AVVK N YGLG  ++ PAL +AG + F+V    E
Sbjct: 16  RLIIDLAAIKRNYAALQTLAPTASVGAVVKANGYGLGAAQVVPALADAGCRCFYVAHTSE 75

Query: 68  GVKLR--LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
             + R  L    A IFV  G  P +   +   +L PVI+ + QL     L +     P A
Sbjct: 76  AREAREALAGRPADIFVFNGFWPSELAELRQLSLFPVINDLQQL---EDLRALAPDLPCA 132

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +  DTG +RLGL   E      +        +  I+SHLAC+DDP   +N  Q +RF  +
Sbjct: 133 IHFDTGMSRLGLDAAETEALLADPARIDALDVRQIMSHLACSDDPDHPLNEQQRQRFERI 192

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
                GI ASL++S+G LLG  YHF + RPG++L+ G     ++ P + VV  +A I+ I
Sbjct: 193 RHALPGIPASLSNSTGTLLGQAYHFDMLRPGLALFSGMPAPGQASPFEPVVAIDAPILQI 252

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    G+ V YG      R   +A  A GYADG                  GG G I   
Sbjct: 253 RTLQPGDTVGYGACWTADRPRRVATVAAGYADGLLRAFGN-----------GGYGRIGET 301

Query: 306 MVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            VPILG+++MD+   DI D++   +  GD ++  GPDI  +++A ++ T +Y+ LVR+G 
Sbjct: 302 QVPILGRVSMDLICVDI-DAVEEPVRPGDPVRFLGPDI--ENMADSAATISYEFLVRLGI 358

Query: 364 RYAKFY 369
           R+ + Y
Sbjct: 359 RFDRSY 364


>gi|222081869|ref|YP_002541234.1| alanine racemase [Agrobacterium radiobacter K84]
 gi|221726548|gb|ACM29637.1| alanine racemase [Agrobacterium radiobacter K84]
          Length = 377

 Score =  213 bits (542), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 130/370 (35%), Positives = 207/370 (55%), Gaps = 25/370 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL+ N+ ++ A    A+ AAVVK +AYGLG +++APALY++G +DFFV    E 
Sbjct: 23  LTIDLVALRRNYETIAAAVAPAKAAAVVKADAYGLGADRVAPALYHSGCRDFFVAQFGEA 82

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH----P 123
            KLR +    ARI+VL G+ PG E     T ++PV++S+ Q   Y +  S  ++     P
Sbjct: 83  EKLRPHLEADARIYVLNGLQPGAEGTCAQTGVVPVLNSMEQ---YKRWRSTALAQNRVLP 139

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR 183
            ALQ DTG  RLG+  ++   F     +  + ++  I+SHLA AD+  +  N+ QL   R
Sbjct: 140 AALQFDTGMTRLGIPPEDRAAFAAELTHTDVVEIRFIMSHLASADETDNGQNAQQLAEMR 199

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARII 243
            + + +     S A+S G+ LG +YH  LTR GI++YGG   ++KS+ +Q V+  +  ++
Sbjct: 200 KIAAEFPQFSVSFANSGGVFLGSDYHGVLTRAGIAVYGGALTVDKSNNIQPVIRLDVAVV 259

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG--F 301
             R    G L+ YGG      +  +A  A GYADG P               LG +G  +
Sbjct: 260 QTRSVPPGTLIGYGGAHAAKVEMRLATLAAGYADGLPRC-------------LGDRGAVY 306

Query: 302 IKGYMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
            +G  +PI+G+++MD    D+T     ++ +G  +++ GP   L+D+A ++GT +Y++L 
Sbjct: 307 YEGVRLPIVGRVSMDSITIDVTALPPGTLMLGSLVEVIGPHQTLEDLAKSAGTISYEILT 366

Query: 360 RIGTRYAKFY 369
            +G RY + Y
Sbjct: 367 GLGHRYHRDY 376


>gi|92117813|ref|YP_577542.1| alanine racemase [Nitrobacter hamburgensis X14]
 gi|91800707|gb|ABE63082.1| alanine racemase [Nitrobacter hamburgensis X14]
          Length = 398

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 183/365 (50%), Gaps = 11/365 (3%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+  NW  +   +  A  A VVK +AYG G   +  AL  AG + FFV +++E 
Sbjct: 34  LTVDLDAIVANWRKLEKTAVPAECAGVVKADAYGCGARPVVRALSAAGCRTFFVATLDEA 93

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYALQ 127
              R   P A I+VL GI           N  PVI  + +L  +       G +   A+ 
Sbjct: 94  RVARAAAPSADIYVLDGIFQNCADAFAAINCRPVIGDLNELAEWDVFCRRTGWAGGAAIH 153

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLG +L EA            G ++L++SHLACA+  +  +N+ Q+  FR +  
Sbjct: 154 IDTGMNRLGFTLDEAQAILPRIDAGDHG-ITLVMSHLACAETLNHPLNARQVAAFREIAR 212

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+ ASLA+SSGI LGP Y F L RPG++LYG        +PMQ VV  +ARI+  R 
Sbjct: 213 LFSGVPASLANSSGIFLGPQYQFDLVRPGVALYGVNPTPEADNPMQPVVELKARIVQTRT 272

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V YG      R + +A+ A GYADGY       D      V       + G   
Sbjct: 273 IDKGESVGYGATWTARRTTRLAIVATGYADGYFRAGGSNDGTRGADV------VVAGTRC 326

Query: 308 PILGKITMDMTMFDITD---SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           P+ G+I+MD+   DITD   +  +  G    + G  I +D++A   GT  Y++L  +G R
Sbjct: 327 PVAGRISMDLLAIDITDLPPNAGVRRGHLATLIGDGITVDELAHHFGTIGYEVLTSLGGR 386

Query: 365 YAKFY 369
           Y + Y
Sbjct: 387 YRRIY 391


>gi|126461891|ref|YP_001043005.1| alanine racemase [Rhodobacter sphaeroides ATCC 17029]
 gi|221638874|ref|YP_002525136.1| Alanine racemase [Rhodobacter sphaeroides KD131]
 gi|226711057|sp|A3PIR7|ALR_RHOS1 RecName: Full=Alanine racemase
 gi|254802372|sp|B9KQC8|ALR_RHOSK RecName: Full=Alanine racemase
 gi|126103555|gb|ABN76233.1| alanine racemase [Rhodobacter sphaeroides ATCC 17029]
 gi|221159655|gb|ACM00635.1| Alanine racemase [Rhodobacter sphaeroides KD131]
          Length = 349

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 137/365 (37%), Positives = 199/365 (54%), Gaps = 30/365 (8%)

Query: 9   LKIDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L IDL A+  NW +++ ++  + +T AVVK ++YGLG  K+A AL  AG + FFV + EE
Sbjct: 6   LTIDLDAIAANWRALDQMTASDCQTGAVVKADSYGLGAAKVAHALARAGARRFFVATCEE 65

Query: 68  GVKLRLY---TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           G  +R      PQ  I V  G   G   +I D +L P+++S+ QLT + + +      P+
Sbjct: 66  GADVRRALGSGPQ--ICVFSGHMEGDTALIRDFDLTPMLNSIDQLTRHFEALG---GQPF 120

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
            LQ+D+G NRLGL   E        F  + G   L++SHLAC+DDP   +N+ QL  FR 
Sbjct: 121 GLQLDSGMNRLGLEPGEWEAVA--GFALEAGP-ELLMSHLACSDDPDHPMNAEQLGAFRA 177

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           + +   G+  SL+++ GILLGP +HF+LTRPGI LYGG     ++ P   VV     +I 
Sbjct: 178 M-TDGTGVPRSLSATGGILLGPAWHFELTRPGIGLYGGR-PFEEARP---VVRLSLPVIQ 232

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R+   GE V Y         S IA  A GYADG P TLS      S +    G+     
Sbjct: 233 VREVEIGEPVGYSNTWTAEHTSTIATVAAGYADGLPRTLS------SRATLYAGR----- 281

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
              P++G+++MD+   D+  S   EV + + I GP    DD+A  +GT  Y++L  +G R
Sbjct: 282 VPCPLVGRVSMDLITVDV--SHLPEVPETLDILGPHQTPDDLADTAGTIGYEILTSLGRR 339

Query: 365 YAKFY 369
           Y + Y
Sbjct: 340 YQRRY 344


>gi|77463017|ref|YP_352521.1| alanine racemase [Rhodobacter sphaeroides 2.4.1]
 gi|123592286|sp|Q3J3L4|ALR_RHOS4 RecName: Full=Alanine racemase
 gi|77387435|gb|ABA78620.1| alanine racemase [Rhodobacter sphaeroides 2.4.1]
          Length = 349

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 137/365 (37%), Positives = 198/365 (54%), Gaps = 30/365 (8%)

Query: 9   LKIDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L IDL A+  NW +++ ++  + +T AVVK ++YGLG  K+A AL  AG + FFV + EE
Sbjct: 6   LTIDLDAIAANWRALDQMTASDCQTGAVVKADSYGLGAAKVAHALARAGARRFFVATCEE 65

Query: 68  GVKLRLY---TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           G  +R      PQ  I V  G   G   +I D +L P+++S+ QLT + + +      P+
Sbjct: 66  GADVRRALGSGPQ--ICVFSGHMEGDTALIRDFDLTPMLNSIDQLTRHFEALG---GQPF 120

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
            LQ+D+G NRLGL   E        F  + G   L++SHLAC+DDP   +N+ QL  FR 
Sbjct: 121 GLQLDSGMNRLGLEPGEWEAVA--GFALEAGP-ELLMSHLACSDDPDHPMNAEQLGAFRA 177

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           + +   G+  SL+++ GILLGP +HF+LTRPGI LYGG    N     + VV     +I 
Sbjct: 178 M-TDGTGVPRSLSATGGILLGPAWHFELTRPGIGLYGGRPFENA----RPVVRLSLPVIQ 232

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R+   GE V Y         S IA  A GYADG P TLS      S +    G+     
Sbjct: 233 VREVEIGEPVGYSNTWTAEHTSTIATVAAGYADGLPRTLS------SRATLYAGR----- 281

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
              P++G+++MD+   D+  S   EV + + I GP    DD+A  +GT  Y++L  +G R
Sbjct: 282 VPCPLVGRVSMDLITVDV--SHLPEVPETLDILGPHQTPDDLADTAGTIGYEILTSLGRR 339

Query: 365 YAKFY 369
           Y + Y
Sbjct: 340 YQRRY 344


>gi|149184540|ref|ZP_01862858.1| alanine racemase [Erythrobacter sp. SD-21]
 gi|148831860|gb|EDL50293.1| alanine racemase [Erythrobacter sp. SD-21]
          Length = 345

 Score =  213 bits (541), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 136/363 (37%), Positives = 197/363 (54%), Gaps = 28/363 (7%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL +D  AL  NW +++ +SG+AR  A VK + YGLG E   P L +AG  DFFV    
Sbjct: 9   LRLDLDREALAANWRALDRMSGSARAGAAVKADCYGLGVEHCVPVLRDAGCGDFFVAHWS 68

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           E   +  +   A++ VL+G   G E     +T  +PVI SV Q    +KL +     P  
Sbjct: 69  EVAAVVEHVDAAQVAVLHGPLDGNEVAYARETGALPVIDSVRQ----AKLWAESGGGPCH 124

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           L VD+G NRLG+S QE      N   + L  + +++SHLACAD+  S +N+ QLE FR  
Sbjct: 125 LMVDSGINRLGISPQE----ISNPVVQAL-DVQVLLSHLACADE-DSPMNARQLETFRDA 178

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
           I   +  E SLA+S+GI LG +YHF LTRPG++LYGG  +   +  +  VV  +A II  
Sbjct: 179 IQRVEHCETSLANSAGIALGSDYHFDLTRPGLALYGGVPRPELADHIGQVVFPKAAIIQT 238

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+  AG+ V Y        +  + V ++GYADG   +              GG  F  G 
Sbjct: 239 RQLSAGDGVGYNATFTAPVEMRVGVLSLGYADGILRS-------------WGGAAFRSGE 285

Query: 306 -MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
             +PILGK++MDM + D++D+  +  GD++++      L D A  +  T Y+LL  +G R
Sbjct: 286 KRLPILGKVSMDMIVIDLSDAPELGEGDWVEL---PYHLPDAAQQTSLTQYELLTVLGNR 342

Query: 365 YAK 367
           +A+
Sbjct: 343 FAR 345


>gi|192291866|ref|YP_001992471.1| alanine racemase [Rhodopseudomonas palustris TIE-1]
 gi|192285615|gb|ACF01996.1| alanine racemase [Rhodopseudomonas palustris TIE-1]
          Length = 413

 Score =  212 bits (540), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 131/364 (35%), Positives = 181/364 (49%), Gaps = 10/364 (2%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  NW  +   +  +  A VVK +AYG G   +  AL  AG + FFV ++ E 
Sbjct: 36  LTIDLDALVANWRKLEKTAIPSECAGVVKGDAYGCGAGPVTKALLAAGCKTFFVATLSEA 95

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYALQ 127
             +R   P A ++VL G  P         N  PVI  + +L  +       G     AL 
Sbjct: 96  RVVREAAPNATLYVLDGFFPNSGDEFAKLNCQPVIGDLYELAEWDVFCRRTGWRGGAALH 155

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG +RLGL++ EA            G ++L+ISHLACAD  +  +N+ Q   FR +  
Sbjct: 156 IDTGMSRLGLTIVEAQGIVPRIVAGDHG-ITLVISHLACADLVNHQLNAKQAAAFREIAG 214

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+ ASL++SSGI LGP + F L RPG +LYG        +PMQ VV  +ARI+ +R 
Sbjct: 215 QFTGVSASLSASSGIFLGPQFAFDLVRPGAALYGINPTPEADNPMQPVVDLKARIVQVRS 274

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              G+ V YG      R S IAV + GYADGY       D      V       I G   
Sbjct: 275 VERGDTVGYGATWSARRPSKIAVVSAGYADGYFRAAGSSDGTRGADV------IIAGQRC 328

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           PI G+I+MD+   DITD  + +   G    + G  I +D++    GT  Y++L  +G RY
Sbjct: 329 PIAGRISMDLLAVDITDLPANAARRGMMATLIGDGITVDELGHHFGTIGYEVLTSLGRRY 388

Query: 366 AKFY 369
            + Y
Sbjct: 389 TRIY 392


>gi|254449940|ref|ZP_05063377.1| alanine racemase [Octadecabacter antarcticus 238]
 gi|198264346|gb|EDY88616.1| alanine racemase [Octadecabacter antarcticus 238]
          Length = 345

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 132/363 (36%), Positives = 192/363 (52%), Gaps = 26/363 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL AL  NW S++A++ +  T AVVK + YGLG  K+  AL  AGV+ FFV   EEG
Sbjct: 6   LSVDLDALTANWRSLDAMT-DVETCAVVKADGYGLGVAKVGRALMKAGVKRFFVAVPEEG 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             LR    P   I +  G   G   +I D  L P+I+++ QLT + + +     HP+ +Q
Sbjct: 65  AILRHAVGPNVEICIFAGHMRGDTDMIADMMLTPMINTIGQLTRHLEALP---DHPFGVQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGL + E       +  +      L++SHLACAD P   +N  QL++F  L++
Sbjct: 122 LDTGMNRLGLEIDEWASIAEIALTQNC---RLVMSHLACADTPDHPMNRKQLDQFH-LMT 177

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
               +  SLA++ GILLGP YHF +TRPGI LYGG      + P   V   +  +I +R 
Sbjct: 178 DGINVPRSLAATGGILLGPEYHFDMTRPGIGLYGGA-PFADALP---VAYLDLPVIQVRD 233

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V Y       R S IA  + GYADG    LS            G   +     V
Sbjct: 234 VEIGETVGYANAWTAQRPSKIATLSGGYADGLTRALSA-----------GANLWHGAQPV 282

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           P++G+++MD+   D+TD    E+   + + G D  +D++A  +GT  Y++L  +G RY +
Sbjct: 283 PLVGRVSMDLITADVTD--LPELPGVLSVLGLDQTVDELAARAGTIGYEILTSLGPRYER 340

Query: 368 FYT 370
            Y+
Sbjct: 341 RYS 343


>gi|149913818|ref|ZP_01902350.1| alanine racemase [Roseobacter sp. AzwK-3b]
 gi|149812102|gb|EDM71933.1| alanine racemase [Roseobacter sp. AzwK-3b]
          Length = 346

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 197/364 (54%), Gaps = 30/364 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A++ NW +++AL G ++TAAVVK +AYGL   ++AP L  AG + FFV   EEG
Sbjct: 6   LTIDLDAIRANWRALDAL-GTSQTAAVVKADAYGLDAGRVAPVLAAAGARSFFVAVAEEG 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             LR +  P   I V  G   G  ++I    LIP+++SV Q+  +++ +     H + +Q
Sbjct: 65  AALRKVLGPDVAIHVFSGHMAGDAELIGGAGLIPMLNSVDQMIRHAEALP---GHAFGVQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +D+G NRLG+   E       + ++     +L++SHLACAD+P   +N  QL+ FR +  
Sbjct: 122 LDSGMNRLGMEPSEWAAVRDVALSQS---PTLVMSHLACADEPDHPMNLQQLQAFREMT- 177

Query: 188 HYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
              G+ A   LA++ GIL+GP YHF LTRPGI LYGG      + P   VVT +  +I  
Sbjct: 178 --DGVTAPLCLANTGGILMGPEYHFDLTRPGIGLYGGR-PFEGARP---VVTLDIPVIQC 231

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R     E V Y      TR + IA    GYADG    +        P   +       G 
Sbjct: 232 RDLTPRETVGYANSFTATRPTRIATIGAGYADGIIRAM-------GPRSHV----LADGV 280

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
             PI G+I+MD+   DITD L  +  +++Q+ GP   +DD+A  +GT  Y++L  +G RY
Sbjct: 281 PCPIAGRISMDLIGVDITD-LGHDP-EHLQLLGPTQTVDDLADNAGTIGYEILTSLGARY 338

Query: 366 AKFY 369
            + Y
Sbjct: 339 VRRY 342


>gi|209546891|ref|YP_002278809.1| alanine racemase [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209538135|gb|ACI58069.1| alanine racemase [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 377

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 128/370 (34%), Positives = 190/370 (51%), Gaps = 25/370 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  N+  + ++    R  AVVK NAYGLG E++A  LY  G + FFV    E 
Sbjct: 23  LTIDLAALGRNYRKLVSMLAPVRAGAVVKANAYGLGAERVATTLYGEGCRHFFVAQFVEA 82

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK----LMSCGVSHP 123
           V+LR      A+IFVL G+ PG E    +  ++PV++S+ Q   +S     L  C    P
Sbjct: 83  VRLRPTLARDAQIFVLNGLQPGNEIACAERGIVPVLNSLTQWRQWSATARMLKRC---LP 139

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR 183
             LQ DTG +RLG   +E  +      +    ++  I+SHLA ADD  S  N  QL    
Sbjct: 140 AVLQFDTGMSRLGFPEEERSELAAALGDGSNVEILFIMSHLASADDMESDQNGEQLAEMA 199

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARII 243
            +   + G + S A+S G+ LG  YH  L RPGI+LYGG      ++PM+ VV+ +  ++
Sbjct: 200 RIADEFPGFDISFANSGGVFLGDAYHGVLARPGIALYGGAPHAGGNNPMEPVVSLDVAVV 259

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG--F 301
             R   AG  V YGG     R   +A  A GYADG P +             LG +G  +
Sbjct: 260 QTRTVPAGAKVGYGGAHVTQRKMRLATIAAGYADGLPRS-------------LGDRGAVY 306

Query: 302 IKGYMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
                +PI+G+++MD    D++     ++ +G  +++ G +  L+ +A  +GT +Y++L 
Sbjct: 307 YNDIRLPIVGRVSMDSATVDVSALPEGALTLGSLVEVLGSNQTLEHIARDAGTISYEILT 366

Query: 360 RIGTRYAKFY 369
            +G RY K Y
Sbjct: 367 GLGDRYDKQY 376


>gi|209964879|ref|YP_002297794.1| alanine racemase [Rhodospirillum centenum SW]
 gi|209958345|gb|ACI98981.1| alanine racemase [Rhodospirillum centenum SW]
          Length = 384

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 134/370 (36%), Positives = 192/370 (51%), Gaps = 20/370 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  NW  + A    A   AVVK +AYGLG   +A  L   G   FFV   E G
Sbjct: 20  LVIDLGALAANWRDLAARVAPAECGAVVKADAYGLGAGPVARRLLAEGAHTFFVADTEAG 79

Query: 69  VKLR----LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFY-SKLMSCGVSHP 123
           + LR       P+ RI VL+G+ PG    +    L+P ++++  L  + ++    G   P
Sbjct: 80  MALRTVLPAMQPEPRIVVLHGVPPGAAPDLAAARLLPALNTLGDLERWRAEGQRRGAPLP 139

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLG--QLSLIISHLACADDPSSHVNSVQLER 181
             + +DTG NRLGL+  E LD      ++ L   ++   +SHLACAD P+  +   QL R
Sbjct: 140 CFVHIDTGMNRLGLTAAE-LDTLAGDADRLLAGVRVESWMSHLACADHPADPMTKTQLGR 198

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEAR 241
           FR  ++      ASLA+S+GI  G +YHF L RPGI+LYG        +PM+ VV   AR
Sbjct: 199 FRAALARLPAARASLANSAGIFHGRDYHFDLVRPGIALYGPNPAPWTENPMRPVVRVFAR 258

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           I  +R   AG+ V Y    ++ R   IA   +GYADGYP  LSG           G   F
Sbjct: 259 IHQVRPVSAGDTVGYDATHRIGRPGRIAALGMGYADGYPWALSG----------RGAALF 308

Query: 302 IKGYMVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
              Y  P++G+++MD+   D+TD     +  G + ++ GP   +D  A  +GT  Y++L 
Sbjct: 309 GGAYRAPLVGRVSMDLLTADVTDVPEQFLAEGGWAEVIGPHRPVDTAATEAGTIGYEVLT 368

Query: 360 RIGTRYAKFY 369
           R+G+RY + +
Sbjct: 369 RLGSRYHRVH 378


>gi|316933684|ref|YP_004108666.1| alanine racemase [Rhodopseudomonas palustris DX-1]
 gi|315601398|gb|ADU43933.1| alanine racemase [Rhodopseudomonas palustris DX-1]
          Length = 415

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 129/364 (35%), Positives = 183/364 (50%), Gaps = 10/364 (2%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  NW  +   +  +  A VVK +AYG G   +  AL  AG + FFV ++ E 
Sbjct: 36  LTIDLDALVANWRKLEKTAVPSECAGVVKGDAYGCGAGPVVKALLGAGCKTFFVATLGEA 95

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYALQ 127
             +R   P+A ++VL G  P         N  PVI  + +L  +       G     AL 
Sbjct: 96  RAVREVAPEATLYVLDGFFPYSGDEFARLNCQPVIGDLYELAEWDVFCRRTGWRGGAALH 155

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG +RLGL++ EA            G ++L++SHLACAD  +  +N+ Q+  FR +  
Sbjct: 156 IDTGMSRLGLTITEAQGIVPRIVAGDHG-ITLVMSHLACADLVNHPLNARQVTAFREIAG 214

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+ ASL++SSGI LGP + F L RPG +LYG        +PMQ VV  +ARI+ +R 
Sbjct: 215 QFTGVSASLSASSGIFLGPQFAFDLVRPGAALYGINPTPEADNPMQPVVDLKARIVQVRS 274

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              G+ V YG      R S IAV + GYADGY       D      V       I G   
Sbjct: 275 VERGDTVGYGATWSARRPSKIAVLSAGYADGYFRAAGSSDGTRGAEV------IIAGERC 328

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           PI G+I+MD+   D+TD  + +   G    + G  I +D++    GT  Y++L  +G RY
Sbjct: 329 PIAGRISMDLLAVDVTDLPANAARRGMMATLIGDGITVDELGHHFGTIGYEVLTSLGPRY 388

Query: 366 AKFY 369
            + Y
Sbjct: 389 TRIY 392


>gi|241113131|ref|YP_002972966.1| alanine racemase [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240861339|gb|ACS59005.1| alanine racemase [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 377

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 127/370 (34%), Positives = 191/370 (51%), Gaps = 25/370 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  N+  + ++  + R  AVVK +AYGLG E++   LY+ G + FFV    E 
Sbjct: 23  LTIDLAALGRNYRKLVSMLASVRAGAVVKADAYGLGAERVGRTLYSEGCRHFFVAQFVEA 82

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK----LMSCGVSHP 123
           ++LR      A+IFVL G+ PG E    +  ++PV++S+ Q   +S     L  C    P
Sbjct: 83  LRLRPALAHDAQIFVLNGLQPGNEIACAEMGVVPVLNSLAQWRQWSTAARILKRC---LP 139

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR 183
             LQ DTG +RLG   +E  +           ++  I+SHLA ADD  S  N  Q+    
Sbjct: 140 AVLQFDTGMSRLGFPEEERAELAAALSGSTNVEILFIMSHLASADDMDSDQNGEQIAEMS 199

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARII 243
            +   + G + S A+S G+ LG  YH  L RPGI+LYGG     + +PM+ VV+    ++
Sbjct: 200 RIADEFPGFDISFANSGGVFLGDPYHGVLARPGIALYGGAPNAGEKNPMEPVVSLNVAVV 259

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG--F 301
             R   AG  V YGG     R++ +A  A GYADG P               LG +G  +
Sbjct: 260 QTRTVPAGAKVGYGGAHVTQRETRLATIAAGYADGLPRC-------------LGDRGAVY 306

Query: 302 IKGYMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
            KG  +PI+G+++MD    DI+     ++  G  +++ G    L+D+A  +GT +Y++L 
Sbjct: 307 FKGIRLPIVGRVSMDSATVDISALPEGALTFGSLVEVLGRHQTLEDIACDAGTISYEILT 366

Query: 360 RIGTRYAKFY 369
            +G RY + Y
Sbjct: 367 GLGDRYDRQY 376


>gi|146277115|ref|YP_001167274.1| alanine racemase [Rhodobacter sphaeroides ATCC 17025]
 gi|226711058|sp|A4WRF5|ALR_RHOS5 RecName: Full=Alanine racemase
 gi|145555356|gb|ABP69969.1| alanine racemase [Rhodobacter sphaeroides ATCC 17025]
          Length = 349

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 134/365 (36%), Positives = 196/365 (53%), Gaps = 30/365 (8%)

Query: 9   LKIDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L IDL A+  NW +++ ++  + +T AVVK +AYGLG  K+A AL  AG + FFV + EE
Sbjct: 6   LTIDLDAIAANWRALDQMTASDCQTGAVVKADAYGLGAAKVAHALARAGARRFFVAACEE 65

Query: 68  GVKLRLYT---PQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           G ++R      PQ  I V  G   G   +I D +L P+++S+ QLT + + +      P+
Sbjct: 66  GAEVRRALGSGPQ--ICVFSGHMEGDTALIRDFDLTPMLNSIEQLTRHFETLG---GQPF 120

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
            LQ+D+G NRLGL   E       +         L++SHLACAD+P   +N+ QL  FR 
Sbjct: 121 GLQLDSGMNRLGLEPGEWEAVAATALEAGP---ELLMSHLACADEPDHPMNTEQLRAFRA 177

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           + +   G+  SL+++ GILLGP +HF+LTRPGI LYGG     ++ P   VV     ++ 
Sbjct: 178 M-TDGTGVPRSLSATGGILLGPAWHFELTRPGIGLYGGR-PFEEARP---VVHLSLPVVQ 232

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R+   GE V Y         S IA  A GYADG P TLS      S +    G+     
Sbjct: 233 VREVEIGEPVGYSNSWTAEHTSTIATVAAGYADGLPRTLS------SRASLFAGR----- 281

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
              P++G+++MD+   D+  S   EV D + I       DD+A  +GT  Y++L  +G R
Sbjct: 282 VPCPLVGRVSMDLITVDV--SHLPEVPDALDILCRHQTPDDLADTAGTIGYEILTSLGRR 339

Query: 365 YAKFY 369
           Y + Y
Sbjct: 340 YQRRY 344


>gi|39936148|ref|NP_948424.1| alanine racemase [Rhodopseudomonas palustris CGA009]
 gi|39650003|emb|CAE28526.1| putative alanine racemase [Rhodopseudomonas palustris CGA009]
          Length = 413

 Score =  210 bits (534), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 130/364 (35%), Positives = 181/364 (49%), Gaps = 10/364 (2%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  NW  +   +  +  A VVK +AYG G   +  AL  AG + FFV ++ E 
Sbjct: 36  LTIDLDALVANWRKLEKTAIPSECAGVVKGDAYGCGAGPVTKALLAAGCKTFFVATLSEA 95

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYALQ 127
           + +R   P A ++VL G  P         N  PVI  + +L  +       G     AL 
Sbjct: 96  LVVREAAPNATLYVLDGFFPNSGDEFAKLNCQPVIGDLYELAEWDVFCRRTGWRGGAALH 155

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG +RLGL++ EA            G ++L+ISHLACAD  +  +N+ Q   FR +  
Sbjct: 156 IDTGMSRLGLTIVEAQGIVPRIVAGDHG-ITLVISHLACADLVNHQLNAKQAAAFREIAG 214

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+ ASL++SSGI LG  + F L RPG +LYG        +PMQ VV  +ARI+ +R 
Sbjct: 215 QFTGVSASLSASSGIFLGSQFAFDLVRPGAALYGINPTPEADNPMQPVVDLKARIVQVRS 274

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              G+ V YG      R S IAV + GYADGY       D      V       I G   
Sbjct: 275 VERGDTVGYGATWSARRPSKIAVVSAGYADGYFRAAGSSDGTRGADV------IIAGQRC 328

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           PI G+I+MD+   DITD  + +   G    + G  I +D++    GT  Y++L  +G RY
Sbjct: 329 PIAGRISMDLLAVDITDLPANAARRGMMATLIGDGITVDELGHHFGTIGYEVLTSLGRRY 388

Query: 366 AKFY 369
            + Y
Sbjct: 389 TRIY 392


>gi|90419483|ref|ZP_01227393.1| putative alanine racemase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336420|gb|EAS50161.1| putative alanine racemase [Aurantimonas manganoxydans SI85-9A1]
          Length = 384

 Score =  210 bits (534), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 144/381 (37%), Positives = 208/381 (54%), Gaps = 16/381 (4%)

Query: 2   HSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFF 61
           HS     ++ID  AL  NW  + A +  ART A VK + YGLG  + A  L+ AG +DFF
Sbjct: 6   HSERMPVVEIDRAALAANWALLAARNPGARTGAAVKADGYGLGAAETARTLHAAGCRDFF 65

Query: 62  VTSVEEGVKLRLY----------TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTF 111
           V   EEG  +R            T  ARIFVL G+ P    +  D  LIPV+S+   +  
Sbjct: 66  VAWAEEGRIVRAALDALTHPDDGTAPARIFVLQGLEPDSVSLHLDAGLIPVLSTPGDIAV 125

Query: 112 YSK-LMSCGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDP 170
           +   L + G   P A+Q++TG +RLGL   +A      + + +L  L+L++SHLA AD+P
Sbjct: 126 WCNGLKAAGRRAPAAIQLETGMHRLGLDRADAEAAADLAASGEL-DLALVMSHLASADEP 184

Query: 171 SSHVNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSH 230
           +   ++ Q  RF  L + + G+  SLA+S+ + LG  + F LTRPGI+LYGG        
Sbjct: 185 TDQ-SARQQARFLELAALFPGVPRSLANSAAVFLGSEFGFDLTRPGIALYGGEAGPASRG 243

Query: 231 PMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEH 290
            ++ V    A I+ IR A AGE   YG    LTRD+ IA   +GYADGY    SG     
Sbjct: 244 VLRPVARLTAAILQIRTANAGEAAGYGAAAPLTRDTRIATVGLGYADGYHRAASGAGVAV 303

Query: 291 SPSVFLGGKGFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVAL 348
              V  G +  + G  VP+LG+++MD+T+ D+TD    ++  GD  + FGP++ +D VA 
Sbjct: 304 R-DVRPGPQAVVAGQRVPVLGRVSMDLTLLDVTDVPDNALVPGDRAEFFGPNMSIDAVAN 362

Query: 349 ASGTTNYDLLVRIGTRYAKFY 369
           A+GT  Y+LL  +G R  + +
Sbjct: 363 AAGTIAYELLTGLGPRVERRW 383


>gi|254460815|ref|ZP_05074231.1| alanine racemase [Rhodobacterales bacterium HTCC2083]
 gi|206677404|gb|EDZ41891.1| alanine racemase [Rhodobacteraceae bacterium HTCC2083]
          Length = 344

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 138/369 (37%), Positives = 192/369 (52%), Gaps = 40/369 (10%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NW +++  S  A T AVVK +AYG G  + A  L   G + FFV   EE 
Sbjct: 6   LSIDLAAIAANWSALDRFS-TAETGAVVKADAYGTGIGRAARRLAQTGARKFFVAVAEEA 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             +R    P   I++L G   G   +I D +LIP++SS+ Q+  + + +      P+ +Q
Sbjct: 65  ADIRQAIGPDPEIYILSGHMSGDTDMIADLHLIPLLSSIDQMLRHFEALP---GTPFGIQ 121

Query: 128 VDTGFNRLGLSLQE-----ALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERF 182
           +DTG NRLG+   E     +L    N          LI+SHLACADDPS  +N+ QL  F
Sbjct: 122 LDTGMNRLGMEAGEWEAVKSLVLPQNPM--------LIMSHLACADDPSHPMNAQQLAAF 173

Query: 183 RTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEA 240
              I    GI+A  SLA++ GILLGP YHF +TRPGI LYGG    + +     VV+   
Sbjct: 174 ---IEMTDGIDAPRSLAATGGILLGPEYHFDVTRPGIGLYGGLPFADAT----PVVSLSL 226

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
            II  R  LAGE V YG      RDS I   + GYADG  L + G  +            
Sbjct: 227 PIIQTRDVLAGESVGYGNTWIAERDSRIVTVSCGYADGI-LRVMGPKTHF---------- 275

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
           F  G  VP+ G+I+MD    D+TD   +     +++ GP   ++ +A  +GT  Y++L  
Sbjct: 276 FANGTAVPVAGRISMDSICIDVTDVSDLP--SALELLGPQQSIETLAQNAGTIGYEILTS 333

Query: 361 IGTRYAKFY 369
           +G RY++ Y
Sbjct: 334 LGARYSRRY 342


>gi|84502660|ref|ZP_01000779.1| alanine racemase [Oceanicola batsensis HTCC2597]
 gi|84389055|gb|EAQ01853.1| alanine racemase [Oceanicola batsensis HTCC2597]
          Length = 343

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 130/363 (35%), Positives = 191/363 (52%), Gaps = 25/363 (6%)

Query: 9   LKIDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           + +DL AL  NW +++A S     T AV+K N YGLG + +A AL  AGV+ FFV   EE
Sbjct: 1   MTVDLDALVANWRALDAASSPETETGAVIKANGYGLGVQPVARALARAGVRRFFVAVAEE 60

Query: 68  GVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           G  +R    P   I V  G   G   +I D NLIP+++SV Q+  + + +     HP  +
Sbjct: 61  GAAVREAVGPNVEINVFSGHMRGDTDMIGDLNLIPMLNSVDQMLRHVEALP---GHPLGI 117

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG NRLG+  +E +     + +      +LI+SHLACAD+P   +N  QL +F+ + 
Sbjct: 118 QLDTGMNRLGMEPEEWMAVRETALDLSP---NLIMSHLACADEPDHPMNIRQLRQFKAMT 174

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           S   G+  SLA++ GILLGP YHF +TRPG+ L+GG    +     + VV  +  +I IR
Sbjct: 175 SGLGGVPLSLAATGGILLGPEYHFDVTRPGVGLFGGLPFADA----EPVVRLDLPVIQIR 230

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
           +  AGE V YG        ++IA  A GYAD       G+     P   L    +     
Sbjct: 231 ELEAGETVGYGNTWTAPDRTVIATVAAGYAD-------GIHRLMGPRTSL----YAGDTP 279

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
            P+ G+I+MD+   DIT       G  + + GP   +D +A  + T  Y++L  +G R +
Sbjct: 280 CPVRGRISMDLIGVDITHLTEEPQG--LTLLGPQQTVDVIAENAQTIGYEVLTSLGGRMS 337

Query: 367 KFY 369
           + Y
Sbjct: 338 RRY 340


>gi|163746601|ref|ZP_02153959.1| alanine racemase [Oceanibulbus indolifex HEL-45]
 gi|161380486|gb|EDQ04897.1| alanine racemase [Oceanibulbus indolifex HEL-45]
          Length = 347

 Score =  209 bits (531), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 138/366 (37%), Positives = 202/366 (55%), Gaps = 31/366 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+ NNW +++ L+  A T AVVK ++YGLG E++A AL  AG + FFV   EEG
Sbjct: 6   LTIDLQAIANNWRALDRLT-KAETGAVVKADSYGLGAERVANALAQAGARQFFVALAEEG 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             LR     +  I V  G   G  + I D  L P+I+S  QL    + +     HP+ +Q
Sbjct: 65  AALRQALGDRPVINVFSGHMAGDAEAIRDAALTPMINSTEQLL---RQLETLPGHPFGVQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +D+G NRLG+   E       + ++    L+LI+SHLAC+D P   +N+ QL  F  +  
Sbjct: 122 LDSGMNRLGMEPAEWAALRDIAQSQP---LTLIMSHLACSDAPDHEMNAAQLRSFHDMT- 177

Query: 188 HYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
             +GI+   SL+++ GILLG +YHF +TRPGI LYGG    + + P   VVT +  +I  
Sbjct: 178 --QGIDVARSLSATGGILLGSDYHFDVTRPGIGLYGGR-PFDDAQP---VVTLDVPVIQT 231

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVA--AIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
           R    GE V YG     T D+++ +A  A GYADG    L     E   + F        
Sbjct: 232 RTVTPGETVGYG--NSWTADTMVTLATVAAGYADGLKRALGNAVGE---ACFQH-----D 281

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  +PI+G+++MD+   DI+ +LS +V   +Q+ GP   +DD+A  +GT  Y++L  +G 
Sbjct: 282 GKTLPIVGRVSMDLITVDIS-ALS-DVPQTLQLIGPGQGVDDLADWAGTIGYEILTSLGA 339

Query: 364 RYAKFY 369
           RY + Y
Sbjct: 340 RYDRHY 345


>gi|182680013|ref|YP_001834159.1| alanine racemase [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182635896|gb|ACB96670.1| alanine racemase [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 373

 Score =  209 bits (531), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 131/371 (35%), Positives = 197/371 (53%), Gaps = 25/371 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NW ++ A+SG     AVVK +AYGLG   +  ALY AG + FFV    EG
Sbjct: 15  LTIDLAAIVANWQTLQAVSGT-ECGAVVKADAYGLGLHPVVKALYEAGCRTFFVAHAFEG 73

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--- 125
            ++R   P+A I+VL G+ P QE      NL PV++SVP++  + +   C  SH  A   
Sbjct: 74  AEVRALAPEAIIYVLNGVRPAQEYTFAAHNLRPVLNSVPEVEDWGQY--CATSHKRAPDG 131

Query: 126 ------LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQL 179
                 L++DTG N+LGL L +     H S    L  ++L++S L  ADD    +   Q+
Sbjct: 132 SLLKAGLRIDTGVNQLGLKLYDLERVDHLS---PLFDVTLLLSQLVTADD---SIADRQI 185

Query: 180 ERFRTLISHYKGIEASLASSSGILLGPNYH-FQLTRPGISLYGGTDKINKSHPMQTVVTA 238
           E F  + + Y G+ ASLA+S+ I L  N   + L RPG +LYGG     + +PM+ VV  
Sbjct: 186 EAFDKIRARYPGVPASLANSAAIFLDNNPPLYDLVRPGYALYGGNPVPGRPNPMRPVVRL 245

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           +A II +R    G  V      K      + + A G ADG P  L+  D+E      +GG
Sbjct: 246 DAHIIQVRVLEPGHSVGVERLWKARGPRRVIMVAAGLADGIPSGLT--DNEK----HVGG 299

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
           K  I+G + P +  I MD ++ D++D+  +E G+ +++ G  + +DD A  +  + Y++L
Sbjct: 300 KALIQGTLCPYVSDIAMDYSVIDVSDATYLERGEMVELLGKTVTIDDFAAMANVSGYEIL 359

Query: 359 VRIGTRYAKFY 369
             +G R  + Y
Sbjct: 360 SNLGRRCHRRY 370


>gi|329890148|ref|ZP_08268491.1| alanine racemase [Brevundimonas diminuta ATCC 11568]
 gi|328845449|gb|EGF95013.1| alanine racemase [Brevundimonas diminuta ATCC 11568]
          Length = 361

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 126/364 (34%), Positives = 190/364 (52%), Gaps = 30/364 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL AL  N+ ++ A+SG A    VVK + YGLG   +   L   G + FFV    EG
Sbjct: 23  LNVDLDALARNYRTLGAVSG-APVNPVVKADGYGLGAAAVTQRLMAEGARTFFVARAAEG 81

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM--SCGVSHPYA 125
           V+LR    P+  I++L G H     ++  +NL PVI+   QL  +      +CG      
Sbjct: 82  VRLREAIGPEPVIYILDGCHGDGAAMLKASNLRPVINHPTQLQTWQAAGGGACG------ 135

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           LQ+DTG NRLG  +++A         +    L L+++HLACAD+PS+ +N  Q + +   
Sbjct: 136 LQIDTGMNRLGFRVEDA--------PEPFEGLQLVMTHLACADEPSNPMNRAQRDAYAAA 187

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
           ++ Y  +  S A+S G  LGP++ F + RPGI LYGG  +      +  V +  A+ + +
Sbjct: 188 VTRYPSVTRSFANSGGCFLGPDFAFDVVRPGICLYGGGPEGRPHDRITPVASLIAQAVQV 247

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R   AGE V Y    +  R   +A    GYAD       G+   + P     G+ FI G 
Sbjct: 248 RDVPAGETVGYSQGYRAERPMRVATVGAGYAD-------GVLRSYGPR----GQVFIAGE 296

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           M PI+G+++MD+   D+T  L +  GD ++IFG +  +DD A A+GT +Y+LL  I  R 
Sbjct: 297 MRPIIGRVSMDVLAVDVT-GLDVTAGDPVEIFGANRLVDDAAAAAGTISYELLTSITPRV 355

Query: 366 AKFY 369
            + Y
Sbjct: 356 PRVY 359


>gi|329850902|ref|ZP_08265747.1| alanine racemase [Asticcacaulis biprosthecum C19]
 gi|328841217|gb|EGF90788.1| alanine racemase [Asticcacaulis biprosthecum C19]
          Length = 350

 Score =  208 bits (530), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 136/373 (36%), Positives = 193/373 (51%), Gaps = 26/373 (6%)

Query: 1   MHSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDF 60
           M ++   RL +DL AL  N+ S+   +G A  A VVK +AYGLG   +A  L   G + F
Sbjct: 1   MSASSTARLNVDLAALSQNYASLKRAAGAAEVAPVVKADAYGLGMAGVAAHLARQGAKTF 60

Query: 61  FVTSVEEGVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCG 119
           FV  + EG+ LR L      I+VL G+            L PVI++  Q   + +  S  
Sbjct: 61  FVARLAEGLALRTLVGNDPVIYVLDGLT--DPSAFAAQRLRPVINTPDQYQLWLQGPSEV 118

Query: 120 VSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQL 179
           V+   AL +DTG NRLG+   +  D      +     L+L++SHLAC D+P   +N  QL
Sbjct: 119 VA---ALHIDTGMNRLGVRPDQIADLPAARHHG----LALVMSHLACGDEPGHPMNYQQL 171

Query: 180 ERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAE 239
             FR    H+ G+  SL++SSG+ LGP+Y F L RPGI LYGG         +Q V    
Sbjct: 172 MAFRAATDHFPGVARSLSNSSGLYLGPDYGFDLVRPGICLYGGGPFGTAHADIQPVAHLS 231

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           ARI+ IR+   GE V YG      RD  +A   +GYADG   +L+ L             
Sbjct: 232 ARILQIRELKVGESVGYGASFVADRDMTLATIGLGYADGLMRSLAPL------------- 278

Query: 300 GF--IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
           GF  ++G   P+ G+++MD+   D+T  L +    +++I G    LD VA A+GT  Y++
Sbjct: 279 GFVTVQGERRPLTGRVSMDVFTVDVT-GLHVSDRTWVEILGSSQNLDAVATAAGTIGYEV 337

Query: 358 LVRIGTRYAKFYT 370
           L R+GTR  + YT
Sbjct: 338 LTRLGTRVPRHYT 350


>gi|126735551|ref|ZP_01751296.1| alanine racemase [Roseobacter sp. CCS2]
 gi|126714738|gb|EBA11604.1| alanine racemase [Roseobacter sp. CCS2]
          Length = 345

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 137/362 (37%), Positives = 200/362 (55%), Gaps = 30/362 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NW +++A++ + +TAAVVK N YGLG   +A AL+ AGV+ FFV   EE 
Sbjct: 6   LIIDLDAVVANWRALDAMT-DCKTAAVVKANGYGLGAANVAKALFKAGVRQFFVAVAEEA 64

Query: 69  VKLRL-YTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             +R    P+  I V  G   G   II +  L P+++SV QLT + + +     HP+ +Q
Sbjct: 65  AAIREELGPKPEISVFSGHMAGDTDIIRELGLTPMLNSVEQLTHHLETLP---GHPFGVQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLG+ +QE       +  +K     L++SHLACAD+P   +N  QL +F+ +  
Sbjct: 122 LDTGMNRLGMEMQEWAAVAELALAQKP---RLVMSHLACADEPDHPMNPYQLAQFKKMTD 178

Query: 188 HYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
              GI A  SLA++ GILLGP YHF LTRPGI LYGG      S     V+  +  +I +
Sbjct: 179 ---GITAPRSLAATGGILLGPEYHFDLTRPGIGLYGGLPFAQAS----PVIELDLPVIQV 231

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    GE+V YG   + TR S IA  + GYADG    LS        +++ G        
Sbjct: 232 RDVAEGEVVGYGNVWQATRASRIATVSAGYADGIARILS-----DKATLYHGDTP----- 281

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
             P++ +++MD+   D+TD    E    + + GP   +DD+A A+ T  Y++L ++G RY
Sbjct: 282 -CPLVSRVSMDLLTIDVTD--LTETPKKLTLIGPHQGVDDLAQAANTIGYEVLTQLGDRY 338

Query: 366 AK 367
            +
Sbjct: 339 NR 340


>gi|119386397|ref|YP_917452.1| alanine racemase [Paracoccus denitrificans PD1222]
 gi|119376992|gb|ABL71756.1| alanine racemase [Paracoccus denitrificans PD1222]
          Length = 365

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 197/362 (54%), Gaps = 27/362 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L ID+ A+  NW ++ A +  AR AAVVK +AYGLG +++AP LY AG +DFFV    EG
Sbjct: 29  LVIDIPAIVANWKALAARAPGARAAAVVKADAYGLGADRVAPPLYAAGARDFFVALASEG 88

Query: 69  VKLRLYTP-QARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             +R   P  ARIFVL G   G +       L+P+++S  Q      L   G   P+ +Q
Sbjct: 89  RAIRPLLPDDARIFVLSGHMEGADL----AGLVPLLNSPEQFFRDRALRPRG---PFGIQ 141

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +D+G NRLG+   E  ++          + +LI+SHLACAD+P    N+ QL  FR +  
Sbjct: 142 LDSGMNRLGI---EPGEWAAIRAEALAARPALIMSHLACADEPDHPANAQQLAAFRAMTE 198

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
               +  SLA++ GILLGP+YHF L RPGI LYGG +    + P   VVT    +I +R+
Sbjct: 199 GVT-VPRSLAATGGILLGPDYHFDLVRPGIGLYGG-EPFADARP---VVTLALPVIQVRE 253

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V YG      R S +A  A GYADG    L+    +   +++ G +G      V
Sbjct: 254 VKPGESVGYGYAWTAARPSRVATVAAGYADGLARALA---RDGKLTLWAGERG------V 304

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           P++G+I+MD+   D+TD   +     ++I      +DD+A  SGT  Y++L  +G RY +
Sbjct: 305 PVIGRISMDLITVDVTDLPDVPAA--LEILNARQGVDDLAALSGTIGYEILTSLGRRYER 362

Query: 368 FY 369
            +
Sbjct: 363 TW 364


>gi|114766132|ref|ZP_01445136.1| alanine racemase [Pelagibaca bermudensis HTCC2601]
 gi|114541592|gb|EAU44634.1| alanine racemase [Roseovarius sp. HTCC2601]
          Length = 345

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 129/366 (35%), Positives = 196/366 (53%), Gaps = 30/366 (8%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           +L IDL A++ NW ++  L+      AVVK +AYGLG +K+AP L +AG + FFV    E
Sbjct: 5   QLSIDLAAIRANWRALADLT-TGEAGAVVKADAYGLGVDKVAPVLADAGAKRFFVAIASE 63

Query: 68  GVKLRLYTPQA-RIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           GV LR    +   I V  G   G  + +   NL+P+I+S+ Q+  + + +     HP+ +
Sbjct: 64  GVTLRRVLGEGPEICVFSGHMKGDAEALRAANLVPMINSIDQMLRHVEALP---GHPFGI 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G NRLG+   E       +  +K     L++SHLACAD+P   +N++QL  FR + 
Sbjct: 121 QLDSGMNRLGMEPSEWAALREIALAQKP---RLVMSHLACADEPEHGMNALQLRTFREMT 177

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
                   SL+++ GIL+GP+YHF+LTRPGI +YGG    + +     VV     +I  R
Sbjct: 178 DDIDAPR-SLSATGGILMGPDYHFELTRPGIGIYGGLPFADAT----PVVELMLPVIQTR 232

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG-- 304
           +   GE V YG        + +A  A GYADG    L+              KG++    
Sbjct: 233 EVTPGESVGYGNAWVARVPTKVATIAAGYADGIHRALA-------------KKGYVWAGN 279

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
               ILG+++MD+   D+T +L  EV + +++ G    +D VA A GT  Y++L  +G R
Sbjct: 280 TRCKILGRVSMDLITIDVT-TLK-EVPEQVELLGQKQSVDTVADAIGTIGYEVLTSLGNR 337

Query: 365 YAKFYT 370
           YA+ YT
Sbjct: 338 YARTYT 343


>gi|126740432|ref|ZP_01756120.1| alanine racemase [Roseobacter sp. SK209-2-6]
 gi|126718568|gb|EBA15282.1| alanine racemase [Roseobacter sp. SK209-2-6]
          Length = 345

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 139/368 (37%), Positives = 203/368 (55%), Gaps = 35/368 (9%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           +L I+L AL  NW ++NA++ N  TAAVVK N YGL   ++A AL  AG ++FFV + EE
Sbjct: 5   KLTINLDALVANWRNLNAMT-NCETAAVVKANGYGLDAGRVAKALAQAGARNFFVAAAEE 63

Query: 68  GVKL-RLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           GV L R       I V  G   G  +++ D  L P+++S+ Q+  + + +     H + +
Sbjct: 64  GVALRRALGAGPGISVFSGHMDGDTRLLKDFQLTPMLNSLEQMLRHFESLP---GHAFGV 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLS-LIISHLACADDPSSHVNSVQLERFRTL 185
           Q+D+G NRLG+   E       +    LGQ   L++SHLACAD+P+  +N+ QL+ FR +
Sbjct: 121 QLDSGMNRLGMEPAEWAAVGEIA----LGQSPVLLMSHLACADEPAHEMNAKQLKTFREM 176

Query: 186 ISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARII 243
            S   GIE   SLA++ GILLGP YHF L RPGI LYGG   ++       V + +  +I
Sbjct: 177 TS---GIEVPRSLAATGGILLGPEYHFDLCRPGIGLYGGRPYLDA----LPVASLDLPVI 229

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTL--SGLDSEHSPSVFLGGKGF 301
            +R   AGE V YG      R S IA  A GYADG    L  +G+D+            F
Sbjct: 230 QVRDLEAGESVGYGNAWIAKRPSRIATVAAGYADGLQRALMNTGIDT------------F 277

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
                 PI+G+++MD+   D+T +LS +V  ++ +      +D +A A+GT  Y+ L  +
Sbjct: 278 AGETPCPIVGRVSMDLITVDVT-ALS-DVPSHLSLLNERQGVDILADAAGTIGYEFLTSL 335

Query: 362 GTRYAKFY 369
           G RYA+ Y
Sbjct: 336 GHRYARTY 343


>gi|90423792|ref|YP_532162.1| alanine racemase [Rhodopseudomonas palustris BisB18]
 gi|90105806|gb|ABD87843.1| alanine racemase [Rhodopseudomonas palustris BisB18]
          Length = 407

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 132/366 (36%), Positives = 190/366 (51%), Gaps = 14/366 (3%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NW  +   +  +  A VVK +AYG G   +A AL  AG + FFV +++E 
Sbjct: 33  LSIDLDAIVANWRKLEKTAVPSECAGVVKADAYGCGAGPVARALLAAGCKTFFVATLDEA 92

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH---PYA 125
            +LR   P A ++VL G  P       + +  PVI S+ +L  +     C  S      A
Sbjct: 93  RELRAAAPAAVVYVLDGFLPNCGDAYAELDCQPVIGSLDELAEWDSF--CRRSFWKGGAA 150

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           + +DTG NRLGL + EA            G ++L++SHLACA+  +  +N+ Q   FR +
Sbjct: 151 IHIDTGMNRLGLGIAEAEGIVPRITAGDHG-ITLVLSHLACAETLNHPLNAKQASHFRGI 209

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
            S + G+ ASL++SSGI LG  +HF L RPG +LYG        +PMQ VVT ++RI+ +
Sbjct: 210 ASAFSGVPASLSASSGIYLGQQFHFDLVRPGAALYGINPTPEADNPMQPVVTLQSRILQV 269

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+   G+ V YG      R + IAV A GYADGY       D      V       I G 
Sbjct: 270 REVARGDTVGYGATWTARRPTRIAVVAAGYADGYFRAAGSSDGTRGADV------IIAGQ 323

Query: 306 MVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
             P+ G+I+MD+   D+TD    +   G    + G  I +D++A   GT  Y++L  +G 
Sbjct: 324 RCPVAGRISMDLLAVDVTDLPPNAARRGHMATLIGDGITVDELAHHFGTIGYEVLTSLGK 383

Query: 364 RYAKFY 369
           RYA+ Y
Sbjct: 384 RYARQY 389


>gi|326388436|ref|ZP_08210032.1| alanine racemase [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207168|gb|EGD57989.1| alanine racemase [Novosphingobium nitrogenifigens DSM 19370]
          Length = 372

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 129/364 (35%), Positives = 190/364 (52%), Gaps = 17/364 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  N+  +      A+ A VVK + YGLG   +A  L + G + F V  + E 
Sbjct: 7   LTIDLGALAANYRLIRQQVSPAQVAGVVKADGYGLGAALVARTLIDEGCRHFCVALLGEA 66

Query: 69  VKLRLYTP-QARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYS-KLMSCGVSHPYAL 126
             L  +   +A +FVL G+ PG E        IPV++S+ Q+  +S +  + G   P  L
Sbjct: 67  AALVPHVRGEADVFVLNGLLPGDEAECATLGAIPVLNSLDQIELWSAQARARGRKLPAML 126

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +R+GLS +E               +  +ISHLACADDP++  N+ Q ERFR + 
Sbjct: 127 QFDTGMSRMGLSPEEIDRLLATPDVLDPIDVRFLISHLACADDPTAAANAEQAERFRAIT 186

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           +H+ G+  +L +S G  L    HF L R GI+LYGG  +   ++PM  VV  EARI  +R
Sbjct: 187 AHFPGVPRALDNSGGSFLD-RGHFDLVRAGIALYGGAPRAG-ANPMHAVVALEARIAQLR 244

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AG  V YG   +  R++ IA   +GYADG+P  L              G  +I G  
Sbjct: 245 TIPAGTGVGYGLTFRAERETRIATIQVGYADGWPRCLGNR-----------GAAYIGGVR 293

Query: 307 VPILGKITMDMTMFDITDSLSIEV--GDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
            PI G+++MD    D+TD  +  +  G  +++ GP   +DDVA  +GT +Y++L ++  R
Sbjct: 294 APIAGRVSMDSITLDVTDVPAEHLFPGAPVELVGPHQSIDDVANDAGTISYEILTQLSRR 353

Query: 365 YAKF 368
           Y + 
Sbjct: 354 YDRI 357


>gi|75676204|ref|YP_318625.1| alanine racemase region [Nitrobacter winogradskyi Nb-255]
 gi|74421074|gb|ABA05273.1| alanine racemase region [Nitrobacter winogradskyi Nb-255]
          Length = 395

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 127/365 (34%), Positives = 181/365 (49%), Gaps = 11/365 (3%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+  NW  +   +  A  A V+K +AYG G   +A AL  AG + FFV +++E 
Sbjct: 29  LTVDLDAIVANWRKLEKTAVPAECAGVIKADAYGCGARPVARALSAAGCRTFFVATLDEA 88

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYALQ 127
             +R     A I+VL G            N  PVI  + +L  +       G +   A+ 
Sbjct: 89  RVVRAAASTADIYVLDGFFQNCGDAFATINCRPVIGDLNELAEWDVFCRRTGWAGGAAIH 148

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGL+L EA        N     ++L++SHLACA+     +N+ Q+  FR +  
Sbjct: 149 IDTGMNRLGLTLDEAQGILPR-INAGDHGVTLVMSHLACAESLHHPLNASQVAAFREIAR 207

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+ ASLA+SSGI LG  Y F L RPG +LYG       ++PMQ V+  +ARII  R 
Sbjct: 208 QFSGVPASLANSSGIFLGAQYQFDLVRPGAALYGVNPTPEAANPMQPVIELKARIIQTRS 267

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V YG      R + +AV + GYADGY       D      V       + G   
Sbjct: 268 IDRGESVGYGATWTARRPTRLAVVSAGYADGYFRAGGSNDGTRGAEV------VVAGTRC 321

Query: 308 PILGKITMDMTMFDITD---SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           P+ G+I+MD+   DITD      +  G    + G  I +D++A   GT  Y++L  +G R
Sbjct: 322 PVAGRISMDLLAVDITDLPAHAGVRRGHLATLIGEGITVDELAHHFGTIGYEVLTSLGGR 381

Query: 365 YAKFY 369
           Y + Y
Sbjct: 382 YHRIY 386


>gi|114797948|ref|YP_759453.1| alanine racemase [Hyphomonas neptunium ATCC 15444]
 gi|114738122|gb|ABI76247.1| alanine racemase [Hyphomonas neptunium ATCC 15444]
          Length = 351

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 133/358 (37%), Positives = 189/358 (52%), Gaps = 25/358 (6%)

Query: 16  LKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLRLYT 75
           + +NW +++AL   A TAAVVK +AYGLG  ++A AL  AG Q FFV   EEG+ +R   
Sbjct: 14  IADNWRTLDALHPGATTAAVVKADAYGLGAMRVARALRIAGCQTFFVAYAEEGLIVRKAA 73

Query: 76  PQA-RIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVDTGFNR 134
            +A RIFVL G    +     D +L  V+SS      + KL         AL  DTG NR
Sbjct: 74  GKAARIFVLNGPVRSEMATYRDADLTAVLSS----EAHVKLWGTAPKGSCALHFDTGMNR 129

Query: 135 LGLSLQEALDFTHNSFN--KKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHYKGI 192
           LGL +    D +       ++L Q  LI+SHLACADDP +  N+ Q + F  +   +   
Sbjct: 130 LGLPM----DMSEKDLAALRRL-QPVLIMSHLACADDPENPANTAQRKAFNEISDAFPDT 184

Query: 193 EASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKALAGE 252
            ASLA+S+G  LG  + + LTRPG++LYGGT    K   ++  V  EA I+       G 
Sbjct: 185 PASLANSNGCYLGKGFAYDLTRPGLALYGGTTPPEKVK-LKPGVILEASILATFSGQTGT 243

Query: 253 LVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGK 312
            V YGG   L  D ++A  A+GYADG P   +   +           G+++G   P+LG+
Sbjct: 244 KVGYGGTHTLPEDRILATCALGYADGIPRAGANQIT-----------GWLEGNPCPVLGR 292

Query: 313 ITMDMTMFDITDSLS-IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFY 369
           I+MD+   D+TD +   + G  ++  G + KL+  A A GT  Y+LL  +G R  + Y
Sbjct: 293 ISMDLITLDVTDCVKHAKPGARVEFLGENAKLEVQAAACGTLGYELLTGLGPRVQRVY 350


>gi|163741439|ref|ZP_02148830.1| alanine racemase [Phaeobacter gallaeciensis 2.10]
 gi|161385173|gb|EDQ09551.1| alanine racemase [Phaeobacter gallaeciensis 2.10]
          Length = 345

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 138/371 (37%), Positives = 197/371 (53%), Gaps = 39/371 (10%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL ++L AL  NW +++AL+ N  TAAVVK N YGL   ++  AL NAG ++FFV   EE
Sbjct: 5   RLTLNLDALVTNWRNLDALT-NCETAAVVKANGYGLDAGRVGKALANAGARNFFVAMAEE 63

Query: 68  GVKL-RLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           GV L R   P   I V  G   G  K++ D  L P+++S+ Q+  + + +     HP+ +
Sbjct: 64  GVALRRAIGPGPGISVFAGHMEGDAKLLRDFQLTPMLNSLDQMLRHFESLP---GHPFGV 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG NRLG+   E       + ++      L++SHLACAD+ +  +NS QL+ F  L 
Sbjct: 121 QLDTGMNRLGMEAAEWAAVRDIALSQG---PVLLMSHLACADETTHPMNSHQLQNFLDLT 177

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
                +  SLA++ G+LLG NYHF L RPGI LYGG      + P   V   +  +I IR
Sbjct: 178 EGLD-LPRSLAATGGLLLGRNYHFDLCRPGIGLYGG-QPYGDALP---VAQLDLPVIQIR 232

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               GE V YG      R S IA  A GYADG    L              G G I+ Y 
Sbjct: 233 SLDPGETVGYGNSWAAQRPSRIATVAAGYADGLHRAL--------------GSGQIQVYA 278

Query: 307 ----VPILGKITMDMTMFDITDSLSIEVGD---YIQIFGPDIKLDDVALASGTTNYDLLV 359
                P++G+++MD+   D+TD     +GD   ++ I      +D +A A+GT  Y++L 
Sbjct: 279 GGTPCPVVGRVSMDLITVDVTD-----LGDDPSHLAILNERQTVDTLADAAGTIGYEILT 333

Query: 360 RIGTRYAKFYT 370
            +G+RYA+ YT
Sbjct: 334 SLGSRYARSYT 344


>gi|149202594|ref|ZP_01879566.1| alanine racemase [Roseovarius sp. TM1035]
 gi|149143876|gb|EDM31910.1| alanine racemase [Roseovarius sp. TM1035]
          Length = 345

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 132/365 (36%), Positives = 193/365 (52%), Gaps = 32/365 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NW +++A++  + TAAVVK +AYGLG  ++AP L  AG + FFV   EEG
Sbjct: 6   LTIDLDAIVANWRALDAMN-TSETAAVVKADAYGLGAARVAPTLARAGARHFFVAVAEEG 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             LR        I+V  G  PG  +++    LIP+I+S+ Q+  +++ +     HP+ +Q
Sbjct: 65  APLRETLGAVPAIYVFSGHMPGDAEMLRAHKLIPMINSLDQMIRHAEALP---GHPFGIQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +D+G NRLG+   E       +  +     +LI+SHLACAD+P   +N  QL  FR +  
Sbjct: 122 LDSGMNRLGMEPAEWAALRQIALAQN---PTLIMSHLACADEPDHAMNPQQLATFREMTD 178

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
               +  S A++ GILL   YHF L RPGI +YGG    + +HP   VVT E  +I  R 
Sbjct: 179 GLD-VPRSFANTGGILLDAAYHFDLARPGIGVYGGR-PFDAAHP---VVTLEIPVIQCRD 233

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTL---SGLDSEHSPSVFLGGKGFIKG 304
            L GE V Y       R + IA  A GYADG    +   + L ++ +P            
Sbjct: 234 LLPGETVGYANSFTANRPTRIATVAAGYADGILRAMGPKTSLWADDTP------------ 281

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
              PI G+I+MD+   DITD L  +    + + GP   +D +A  +GT  Y++L  +G R
Sbjct: 282 --CPIAGRISMDLICVDITD-LGHDPAS-LNLLGPHQTIDTLADNAGTIGYEILTSLGAR 337

Query: 365 YAKFY 369
           Y + Y
Sbjct: 338 YTRRY 342


>gi|99081620|ref|YP_613774.1| alanine racemase [Ruegeria sp. TM1040]
 gi|123077575|sp|Q1GFQ4|ALR_SILST RecName: Full=Alanine racemase
 gi|99037900|gb|ABF64512.1| alanine racemase [Ruegeria sp. TM1040]
          Length = 345

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 132/364 (36%), Positives = 193/364 (53%), Gaps = 25/364 (6%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RLKI+L AL  NW +++A + N  TAAVVK N YGL   ++  AL  AG ++FFV   EE
Sbjct: 5   RLKINLDALAINWRNLDAKT-NCETAAVVKANGYGLESGRVGKALAQAGARNFFVAIAEE 63

Query: 68  GVKL-RLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           G+ L R   P   I V  G   G  K++ D  L P+++S+ Q+  + + +     HP+ +
Sbjct: 64  GIALRRALGPGPGISVFAGHMEGDAKLLRDFQLTPMLNSLDQMLRHFESLP---GHPFGV 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G NRLG+   E +     + ++      L++SHLAC+D+P   +N+ QL+ F  + 
Sbjct: 121 QLDSGMNRLGMEAAEWMAVRDIALDQN---PVLLMSHLACSDEPGHGMNAYQLKNFIEMT 177

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
                I  SLA++ G+LLG +YHF L RPGI LYGG    +       VV  E  +I +R
Sbjct: 178 EGLN-IPRSLAATGGLLLGRDYHFDLCRPGIGLYGGAPYADA----LPVVELEVPVIQVR 232

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               GE V YG      RDS IA  A GYADG           H      G   +  G  
Sbjct: 233 DLAPGESVGYGNTWIAQRDSKIATIAGGYADGL----------HRAFQRQGIMAYAGGTP 282

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
            P++G+I+MD+   D+TD    EV  Y+ +      +D +A A+ T  Y++L  +G RYA
Sbjct: 283 CPVVGRISMDLITVDVTD--LAEVPPYLSLMNETQTVDVLANAADTIGYEVLTSLGNRYA 340

Query: 367 KFYT 370
           + Y+
Sbjct: 341 RTYS 344


>gi|254294303|ref|YP_003060326.1| alanine racemase [Hirschia baltica ATCC 49814]
 gi|254042834|gb|ACT59629.1| alanine racemase [Hirschia baltica ATCC 49814]
          Length = 370

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 124/362 (34%), Positives = 190/362 (52%), Gaps = 20/362 (5%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           + L  + NNW  +  LSG A T AVVK NAYGLG E++A  LY AG + FFV  ++E ++
Sbjct: 19  VHLQNVVNNWKELARLSGAADTGAVVKANAYGLGAEQVASTLYEAGCRTFFVAHIDEAIQ 78

Query: 71  LRLYTPQ-ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           +R      A +F+ +GI       +   +++PV++S  Q+  +   +  G   P AL VD
Sbjct: 79  IRKTLGNLALVFIFHGIQADNVDDVIAHDIVPVLNSTDQVELW---IRSGAPFPAALHVD 135

Query: 130 TGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHY 189
           TG NRLGL L+E  +        ++G    ++SHLACAD P   +N+ QL  F  + + +
Sbjct: 136 TGMNRLGLQLKELANVKKRLPANRIG---WVMSHLACADIPEHPMNARQLALFEKVAAIW 192

Query: 190 KGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKAL 249
              E SL++++GI LG  Y F LTRPGI LYGG  +     P   V  +   + +I    
Sbjct: 193 PHAEKSLSNTAGICLGSKYTFDLTRPGIGLYGGYSRKGVFTPSHCVTLSAPILSIIEPDA 252

Query: 250 AGE-LVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVP 308
           + E  + YG   K+T    +A  A+GYADG   +LS             G  F+ G    
Sbjct: 253 SNENTIGYGATSKVTNGQRLATIALGYADGALRSLSN-----------SGFVFVNGVPCS 301

Query: 309 ILGKITMDMTMFDITDSLS-IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           I+G+++MD+   DIT++ +   V D ++  G    ++  A A+ T +Y+LL  +G R  +
Sbjct: 302 IVGRVSMDLITIDITNAPTRTTVLDRVEFLGQHASVEIQARAASTASYELLTSMGERIPR 361

Query: 368 FY 369
            Y
Sbjct: 362 VY 363


>gi|121602454|ref|YP_989355.1| alanine racemase [Bartonella bacilliformis KC583]
 gi|120614631|gb|ABM45232.1| alanine racemase [Bartonella bacilliformis KC583]
          Length = 373

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 127/366 (34%), Positives = 191/366 (52%), Gaps = 21/366 (5%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL A+  N+  +      A  +AVVK NAYG+G EKI+ ALY AG + FFV+ ++E ++
Sbjct: 21  IDLGAIIANYKILAQHIAPAECSAVVKANAYGMGAEKISSALYQAGCRTFFVSQIQEALQ 80

Query: 71  LRLYTPQARIFVLY-GIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH---PYAL 126
           L+   P     VL  G  P  E+ +    LIPV++S   +  +   M C   H   P  +
Sbjct: 81  LKTILPSNITLVLLNGFPPTTEEFVAQAGLIPVLNSWHAIESWQ--MLCQKKHQKFPAII 138

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DT  NRLGL  +E           +   +  I+SHL+  DD +   N  QL   +T +
Sbjct: 139 QIDTHMNRLGLDQEELQQLIKQPTIFEKANIKYIMSHLSNGDDATHASNDTQLTAMKTAL 198

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           +     + SLA+S GI L  +++F L RPGI+LYG         P++ V+  E ++I  R
Sbjct: 199 AQLPTCKVSLANSGGIFLNSDFYFDLVRPGIALYGVDPHGKCPTPIKPVLKLETQVIQSR 258

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AG  V YGG    +R S +   +IGYADG+  TLS             G  +  G+ 
Sbjct: 259 HVDAGTPVGYGGSFVTSRPSTLTTISIGYADGWLRTLSN-----------KGVVYFNGHK 307

Query: 307 VPILGKITMDMTMFDITDSLSIE---VGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           +PI+G+I+MD T+ D TD L  E   +GD++++ GP   ++DVA  + T  Y++L  +G 
Sbjct: 308 LPIIGRISMDSTIVDATD-LECEKPKIGDWVELIGPHQTVEDVAADADTIPYEILTSLGP 366

Query: 364 RYAKFY 369
           R  + Y
Sbjct: 367 RCKRIY 372


>gi|163739575|ref|ZP_02146984.1| alanine racemase [Phaeobacter gallaeciensis BS107]
 gi|161387034|gb|EDQ11394.1| alanine racemase [Phaeobacter gallaeciensis BS107]
          Length = 345

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 138/371 (37%), Positives = 197/371 (53%), Gaps = 39/371 (10%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL ++L AL  NW +++AL+ N  TAAVVK N YGL   ++  AL NAG ++FFV   EE
Sbjct: 5   RLTLNLDALVTNWRNLDALT-NCETAAVVKANGYGLDAGRVGRALANAGARNFFVAMAEE 63

Query: 68  GVKL-RLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           GV L R   P   I V  G   G  K++ D  L P+++S+ Q+  + + +     HP+ +
Sbjct: 64  GVALRRAIGPGPGISVFAGHMEGDAKLLRDFQLTPMLNSLDQMLRHFESLP---GHPFGV 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG NRLG+   E       + ++      L++SHLACAD+ +  +NS QL+ F  L 
Sbjct: 121 QLDTGMNRLGMEAAEWAAVRDIALSQG---PVLLMSHLACADETTHPMNSHQLQNFLDLT 177

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
                +  SLA++ G+LLG NYHF L RPGI LYGG      + P   V   +  +I IR
Sbjct: 178 EGLD-LPRSLAATGGLLLGRNYHFDLCRPGIGLYGG-QPYGDALP---VAQLDLPVIQIR 232

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               GE V YG      R S IA  A GYADG    L              G G I+ Y 
Sbjct: 233 SLDPGETVGYGNSWAAQRPSRIATVAAGYADGLHRAL--------------GSGQIQVYA 278

Query: 307 ----VPILGKITMDMTMFDITDSLSIEVGD---YIQIFGPDIKLDDVALASGTTNYDLLV 359
                P++G+++MD+   D+TD     +GD   ++ I      +D +A A+GT  Y++L 
Sbjct: 279 GDTPCPVVGRVSMDLITVDVTD-----LGDDPSHLAILNERQTVDTLADAAGTIGYEILT 333

Query: 360 RIGTRYAKFYT 370
            +G+RYA+ YT
Sbjct: 334 SLGSRYARSYT 344


>gi|310815865|ref|YP_003963829.1| alanine racemase [Ketogulonicigenium vulgare Y25]
 gi|308754600|gb|ADO42529.1| alanine racemase [Ketogulonicigenium vulgare Y25]
          Length = 345

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 130/363 (35%), Positives = 187/363 (51%), Gaps = 28/363 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NW  + A+S  A   AV+K +AYG G  ++  AL  AGV+ FFV   EEG
Sbjct: 6   LTIDLDAIIGNWRKLAAMS-RAEAGAVLKADAYGTGAARVGAALAEAGVRKFFVAVAEEG 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           V LR    P   IFVL G       +I   NL PV++S  QL    +        P+A+Q
Sbjct: 65  VALREAVGPAPEIFVLSGHGTTDTALIRQLNLTPVLNSPQQL---RRQFDALPGRPFAIQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLG   ++    T            LI+SHLACAD+P   +N+ QL+ F+ +  
Sbjct: 122 LDTGMNRLGFEWEDWAAVTDEVLGAGP---RLIMSHLACADEPDHPMNAYQLDLFKQMTE 178

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
             + +  SLA++ GILLGP+YHF L RPGI L+G       +  +Q     +  +I  R 
Sbjct: 179 GMR-VSRSLAATGGILLGPDYHFDLVRPGIGLHGAAPYAQGAQALQL----DLPVIQTRD 233

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
            + GE+V YG   +  R + +A  A GYADG    L    + +S  +             
Sbjct: 234 LIEGEVVGYGNTWQARRPTRVATLAAGYADGVLRVLGAGTNVYSGDI-----------AC 282

Query: 308 PILGKITMDMTMFDITD-SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
           PI+G+I+MD+   DITD     EV   + + GP   +DD+A+ + T  Y++L  +  RY+
Sbjct: 283 PIIGRISMDLITVDITDLDADPEV---LTLIGPQQSVDDLAVTAKTIGYEILTSLSPRYS 339

Query: 367 KFY 369
           + Y
Sbjct: 340 RQY 342


>gi|296115772|ref|ZP_06834398.1| alanine racemase [Gluconacetobacter hansenii ATCC 23769]
 gi|295977749|gb|EFG84501.1| alanine racemase [Gluconacetobacter hansenii ATCC 23769]
          Length = 390

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 132/366 (36%), Positives = 196/366 (53%), Gaps = 16/366 (4%)

Query: 9   LKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L+IDL A+  N+  + + +S     AAVVK +AYGLG  ++APAL  AG   F+V  +EE
Sbjct: 32  LRIDLDAIAANYRLVRDRVSPTTICAAVVKADAYGLGLTQVAPALQRAGADHFYVAHLEE 91

Query: 68  GVKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYA 125
           G+ LR + TP  RIFVL+G  P  E+     +L PV++S  Q+  +  L        P  
Sbjct: 92  GIALRRHVTPATRIFVLHGPLPDTEEEFTAHDLTPVLNSAGQVAGWRALARRLDRVLPAV 151

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +Q+DTG +R GLS+ +      ++      +  L+ISHLACAD P +  N+ Q  R   +
Sbjct: 152 IQLDTGMSRFGLSMADVRAIADDAGLLAGIRPDLVISHLACADTPQNPANAQQRARLLEM 211

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
            +       +L++SSGI LGP+YHF + RPG +LYG       ++P++ VV   ARI+ +
Sbjct: 212 AAMLPAAPLALSASSGIFLGPDYHFDMVRPGAALYGIAPNEATANPLRPVVRLSARILQV 271

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R  +AG+ V YG   + +    IA    GYADG      G  + H       G  +    
Sbjct: 272 RDIVAGDGVGYGLTYRASGPRRIATIGAGYADG--CLRQG--AHH-------GAAWFGAT 320

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGD--YIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            +PILG+I+MD    DITD    ++G    + + GP   +D  A A+GT  Y++L  +G 
Sbjct: 321 RLPILGRISMDSITIDITDVPVGQLGPDMAVDLLGPHYDVDAAARAAGTIGYEILTSLGH 380

Query: 364 RYAKFY 369
           RY + Y
Sbjct: 381 RYHRAY 386


>gi|83945273|ref|ZP_00957622.1| alanine racemase [Oceanicaulis alexandrii HTCC2633]
 gi|83851443|gb|EAP89299.1| alanine racemase [Oceanicaulis alexandrii HTCC2633]
          Length = 363

 Score =  205 bits (522), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 136/369 (36%), Positives = 190/369 (51%), Gaps = 23/369 (6%)

Query: 4   NEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVT 63
           N   RL IDL A+  N+ ++ AL+  A T+AVVK NAYGLG   +A  L   G + FFV 
Sbjct: 11  NTRSRLVIDLDAIARNYAALQALTPKAETSAVVKANAYGLGAGPVARRLAKQGARTFFVA 70

Query: 64  SVEEGVKLR--LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVS 121
           +VEEG  +R  L  P   I+V  G +  +++ ++  + +  I + P  T   +    G  
Sbjct: 71  TVEEGAAVREALGDPLPDIWVFAG-YRAKDRPLYVKHRLGAILNQPGETAQFRAAPTG-- 127

Query: 122 HPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            P A+ +DTG  RLG    +     +   N     +S+I+SHLAC++D +S  N  QLER
Sbjct: 128 -PCAIHIDTGMARLGYGAGDISGLLNALQNL---DVSMIMSHLACSEDAASTQNLRQLER 183

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEAR 241
           F  L +       SLA++ G+LLG +Y F +TRPGI LYG T  ++   P + VV  EA 
Sbjct: 184 FTALTNALPETRLSLANTGGVLLGESYQFDVTRPGIGLYGATADLDADTPFEPVVKLEAP 243

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           I+ +R+  AG+ V YG         L+A    GYADG P  LSG            G   
Sbjct: 244 ILQLREIDAGDTVGYGATYVAHSPRLVATVGAGYADGLPRALSG-----------AGCAR 292

Query: 302 IKGYMVPILGKITMDMTMFDITD-SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
           I G   PILG+I+MD+T  D+T     I  G   + FGPD  L   A   GT  Y++L  
Sbjct: 293 IAGLRAPILGRISMDLTTIDVTGLEHEIAQGAVPEFFGPD--LYQAAALDGTLPYEILTG 350

Query: 361 IGTRYAKFY 369
           +G R  + Y
Sbjct: 351 LGARAERIY 359


>gi|162146534|ref|YP_001600993.1| alanine racemase, catabolic [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161785109|emb|CAP54653.1| putative alanine racemase, catabolic [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 387

 Score =  205 bits (522), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 137/372 (36%), Positives = 189/372 (50%), Gaps = 25/372 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNART--AAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           L IDL A+  N+  +    G  RT   A VK +AYGLG  +I P L  AG   FFV  + 
Sbjct: 19  LTIDLDAVAANYRILRDRVGP-RTICGAAVKADAYGLGAARIVPVLAEAGCHTFFVAHLA 77

Query: 67  EGVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCGVSHPY 124
           EG  +R L    A IFVL G  PG E  + +  L+PV++S+ Q+  +  L    G   P 
Sbjct: 78  EGAAIRPLLGTDATIFVLNGAMPGTEAALHEHGLVPVLNSLEQIARWRDLARQAGRDLPA 137

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLS-----LIISHLACADDPSSHVNSVQL 179
           ALQVD+G +R GLS     D   ++   + G L+     L++SHLACAD+P+   N  Q 
Sbjct: 138 ALQVDSGMSRFGLS-----DADVDALAARDGSLAGITPLLVMSHLACADEPAHPANHAQR 192

Query: 180 ERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAE 239
             F  L +      ASLA+SSG+ +G ++HF + RPG +LYG        +PMQ VV  +
Sbjct: 193 AAFLRLRARLPAAPASLAASSGLFMGSDWHFDMVRPGAALYGINPTPGWPNPMQPVVRLQ 252

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           ARI+  R    G  V YG      R S IA  A+GY DG+P    G      P       
Sbjct: 253 ARIVQTRWIGPGTAVGYGAAFIADRPSRIATLAVGYGDGFPRAAGGHGHAVLPER----- 307

Query: 300 GFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
                  +PI+G+I+MD    D+TD     ++ G  + + GP   +D  A A+GT  Y+L
Sbjct: 308 ---PAAKLPIIGRISMDCLAVDVTDISDAPLDAGTALDLIGPHHSIDSAAAAAGTIGYEL 364

Query: 358 LVRIGTRYAKFY 369
           L  +G RY + Y
Sbjct: 365 LTGLGARYHRLY 376


>gi|319405446|emb|CBI79065.1| Alanine racemase [Bartonella sp. AR 15-3]
          Length = 373

 Score =  205 bits (522), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 125/349 (35%), Positives = 193/349 (55%), Gaps = 27/349 (7%)

Query: 31  RTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLRLYTPQARIFVLY-GIHPG 89
             +AVVK +AYGLG EK+APALY AG + FF+  ++E ++L+   PQ    VL  G+ P 
Sbjct: 41  ECSAVVKADAYGLGAEKVAPALYQAGCRTFFIAHLKEALQLKAILPQNITLVLLNGLPPN 100

Query: 90  QEKIIFDTNLIPVISSVPQLTFYSKLMSC---GVSHPYALQVDTGFNRLGLSLQEALDFT 146
            E++I    ++PV++S  ++  +   M C   G   P  +Q+DT  NRLGL  +E     
Sbjct: 101 AEELITKAGIVPVLNSRHEIENWQ--MHCQKNGKKFPAIIQIDTNMNRLGLDQEELKWLI 158

Query: 147 HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHYKGIEASLASSSGILLGP 206
            N    +   +  IISHLA  DD +   N  Q    +T ++     +ASLA+S GI LGP
Sbjct: 159 QNPTLFERIDIKYIISHLANGDDVTHASNCAQKNAMKTALAQLPACKASLANSGGIFLGP 218

Query: 207 NYHFQLTRPGISLYGGTDKINKSHP--MQTVVTAEARIILIRKALAGELVSYGGQKKLTR 264
           +++F L RPGI+LYG     +K HP  +++V+  +A++I  R   AG  V YGG     +
Sbjct: 219 DFYFDLVRPGIALYGIDP--HKKHPTSLKSVLKLKAQVIQSRYTEAGSPVGYGGSFITQK 276

Query: 265 DSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI--KGYMVPILGKITMDMTMFDI 322
            S++   AIGYADG+   LS              KGF+  K + +PI+G+I+MD    D 
Sbjct: 277 PSILTTIAIGYADGWLRNLS-------------NKGFVYFKKHKLPIIGQISMDSITVDA 323

Query: 323 TD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFY 369
           T+      + GD++++ G    +++VA  +GT  Y++L  +G+RY + Y
Sbjct: 324 TNLKHEKPKRGDWVELIGRHQTIENVAADAGTIPYEILTSLGSRYKRIY 372


>gi|254509706|ref|ZP_05121773.1| alanine racemase [Rhodobacteraceae bacterium KLH11]
 gi|221533417|gb|EEE36405.1| alanine racemase [Rhodobacteraceae bacterium KLH11]
          Length = 405

 Score =  205 bits (522), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 129/362 (35%), Positives = 191/362 (52%), Gaps = 26/362 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L I+L AL  NW +++A + N  T AVVK +AYGLG E +A AL   GV+ FFV + EEG
Sbjct: 67  LTINLHALAQNWQALDAGT-NVETGAVVKADAYGLGAEPVAWALAEEGVRKFFVAAAEEG 125

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             +R    P   + V  G   G   ++ + +L P+I+S  Q   + + +       + +Q
Sbjct: 126 ATVREAVGPGPMVAVFSGHMEGDADLLRNHDLTPLINSPEQFKRHLQALP---DRKFGIQ 182

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGL   +  +  H++   KL  L +++SHLAC+D+P   +N  QL+ F+ +  
Sbjct: 183 LDTGMNRLGLEPSDWAELRHDAL--KLDPL-VVMSHLACSDEPEHPMNKQQLQTFKQMTD 239

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
             + +  SLA++ G LLG  YHF   RPGI LYGG          + VVT +  II +R 
Sbjct: 240 GVE-VPRSLAATGGTLLGSEYHFDFCRPGIGLYGGMPFAGA----KPVVTVDLPIIQVRD 294

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V YG   K  R S IA  A GYADG    + G           G   F      
Sbjct: 295 VAVGETVGYGNAWKARRPSKIATVAAGYADGLHRAIGG-----------GIDAFAGDQPC 343

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           P++G+I+MD+   D+TD       + ++I      +DD+A A+GT  Y++L  +G+RY++
Sbjct: 344 PVVGRISMDLITVDVTDLPYTP--ERLRILNGHQTVDDLAEAAGTIGYEILTSLGSRYSR 401

Query: 368 FY 369
            Y
Sbjct: 402 GY 403


>gi|319407017|emb|CBI80654.1| Alanine racemase [Bartonella sp. 1-1C]
          Length = 373

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 125/369 (33%), Positives = 201/369 (54%), Gaps = 27/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID+ A+  N+ ++         +AVVK +AYGLG EKIAPALY AG + FF+  ++E ++
Sbjct: 21  IDIGAIVANYKTLVQRVAPIECSAVVKADAYGLGAEKIAPALYQAGCRTFFIAHLKEALQ 80

Query: 71  LRLYTPQ-ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC---GVSHPYAL 126
           L+   P    + +L GI P  E+ +  T ++PV++S  ++  +   M C   G   P  +
Sbjct: 81  LKAILPNNVTLILLNGIPPTAEEFVTQTGIVPVLNSRNEIENWQ--MHCQKNGKKFPAII 138

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DT  NRLGL  +E      N    ++  +  IISHLA  D+ +   N  Q    +T +
Sbjct: 139 QIDTNMNRLGLDQEELQWLIQNPSLFEIADIKYIISHLANGDNATHASNCEQKNAMKTAL 198

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP--MQTVVTAEARIIL 244
           +     +ASLA+S GI LGP+++F L RPGI LYG     ++ HP  ++ V+  +A++I 
Sbjct: 199 AQLPTCKASLANSGGIFLGPDFYFDLVRPGIGLYGIDP--HQQHPTSLKPVLKLKAQVIQ 256

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI-- 302
            R   AG  V YGG     + S++   +IGYADG+   LS              KGF+  
Sbjct: 257 SRCTEAGSPVGYGGSFITQKPSILTTISIGYADGWLRNLS-------------NKGFVYF 303

Query: 303 KGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
             + +PI+G+I+MD  + D T+      + GD++++ G    +++VA  +GT  Y++L  
Sbjct: 304 NQHKLPIIGQISMDSIIVDATNLQHEKPKRGDWVELIGKHQTIENVAADAGTIPYEILTS 363

Query: 361 IGTRYAKFY 369
           +G+RY + Y
Sbjct: 364 LGSRYKRIY 372


>gi|209543468|ref|YP_002275697.1| alanine racemase [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531145|gb|ACI51082.1| alanine racemase [Gluconacetobacter diazotrophicus PAl 5]
          Length = 387

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 137/372 (36%), Positives = 190/372 (51%), Gaps = 25/372 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNART--AAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           L IDL A+  N+  +    G  RT   A VK +AYGLG  +I P L  AG + FFV  + 
Sbjct: 19  LTIDLDAVAANYRILRDRVGP-RTICGAAVKADAYGLGAARIVPVLAEAGCRTFFVAHLA 77

Query: 67  EGVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM-SCGVSHPY 124
           EG  +R L    A IFVL G  PG E  + +  L+PV++S+ Q+  +  L    G   P 
Sbjct: 78  EGAAIRPLLGTDATIFVLNGAMPGTEAALHEHGLVPVLNSLEQIARWRDLARQAGRDLPA 137

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLS-----LIISHLACADDPSSHVNSVQL 179
           ALQVD+G +R GLS     D   ++   + G L+     L++SHLACAD+P+   N  Q 
Sbjct: 138 ALQVDSGMSRFGLS-----DADVDALAARDGSLAGITPLLVMSHLACADEPAHPSNHAQR 192

Query: 180 ERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAE 239
             F  L +      ASLA+SSG+ +G ++HF + RPG +LYG        +PMQ VV  +
Sbjct: 193 AAFLRLRARLPAAPASLAASSGLFMGSDWHFDMVRPGAALYGINPTPGWPNPMQPVVRLQ 252

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           ARI+  R    G  V YG      R S IA  A+GY DG+P    G      P       
Sbjct: 253 ARIVQTRWIGPGTAVGYGAAFIADRPSRIATLAVGYGDGFPRAAGGHGHAVLPER----- 307

Query: 300 GFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
                  +PI+G+I+MD    D+TD     ++ G  + + GP   +D  A A+GT  Y+L
Sbjct: 308 ---PAAKLPIIGRISMDCLAVDVTDIGDAPLDAGTALDLIGPHHSIDSAAAAAGTIGYEL 364

Query: 358 LVRIGTRYAKFY 369
           L  +G RY + Y
Sbjct: 365 LTGLGARYHRLY 376


>gi|294084215|ref|YP_003550973.1| alanine racemase [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292663788|gb|ADE38889.1| alanine racemase [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 383

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 133/384 (34%), Positives = 201/384 (52%), Gaps = 41/384 (10%)

Query: 8   RLKIDLTALKNNWHSMNALSGNAR-TAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           R+ IDL A+ +NW  +++LS  +  TAA+VK N YGLG   +  ALY AG + FFV +++
Sbjct: 18  RIDIDLGAIAHNWLYLDSLSPKSTITAAMVKANGYGLGANHVGAALYKAGCRQFFVANLD 77

Query: 67  EGVKLRLY-----TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYS-KLMSCGV 120
           E V  R Y        A+I VL+G H GQE  +    L PV++ + Q++ +     +   
Sbjct: 78  EAVSFRTYLDNISISDAQIMVLHGCHRGQEHDMRAYRLTPVLNDLEQVSRWRLYAQNANE 137

Query: 121 SHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHL---ACADDPSSHVNSV 177
           ++P  L +DTG  RLG    +      N       +++ I+SHL     +DDP+   N+ 
Sbjct: 138 TYPAMLHLDTGMTRLGFDPDQTDWLIENKQALNGLEITYIMSHLISGEISDDPA---NTA 194

Query: 178 QLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG----GTDK-INKSHPM 232
           Q  RF    S + GI+ASLA+S G+ LG  +H+Q+TRPGI++YG    G D+ I  S+ +
Sbjct: 195 QKTRFDEYRSFFGGIKASLANSGGVFLGNEFHYQMTRPGIAIYGVHPCGKDQAITDSNGL 254

Query: 233 QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP 292
           ++ +T   RII +R A  G  V YGG  +L+R S IA   +GYADGY   LS        
Sbjct: 255 KSCITWHGRIIQVRTAPEGATVGYGGTHRLSRPSRIATVGVGYADGYQRNLS-------- 306

Query: 293 SVFLGGKGFIK--GYMVPILGKITMDMTMFDITD-----SLSIEVGDYIQIFGPDIKLDD 345
                 K F+   G+  P++G+I+MD    D+TD      L  E    +        ++D
Sbjct: 307 -----NKAFVNILGHRAPVIGRISMDSITIDVTDIPPNIMLKAETAALLSDL---YSIED 358

Query: 346 VALASGTTNYDLLVRIGTRYAKFY 369
           +A  + T  Y++L  I  R  + Y
Sbjct: 359 MANDASTIPYEILTGISRRAIRRY 382


>gi|170740813|ref|YP_001769468.1| alanine racemase [Methylobacterium sp. 4-46]
 gi|226711054|sp|B0UL34|ALR_METS4 RecName: Full=Alanine racemase
 gi|168195087|gb|ACA17034.1| alanine racemase [Methylobacterium sp. 4-46]
          Length = 364

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 186/365 (50%), Gaps = 15/365 (4%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL I+L AL  NW  +   +  A  AAV+K +AYG G ++  PAL+ AG + FFV  + E
Sbjct: 10  RLTINLRALAANWRRLAEEAAGAECAAVIKADAYGTGIDRAGPALWRAGCRTFFVAHLSE 69

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYAL 126
             + R   P+A I+VL G+ PG      D  L PV+ S  ++  ++      G   P AL
Sbjct: 70  AERARAALPEAVIYVLNGLPPGSAPAYRDRALRPVLGSREEIEEWAAFCRARGERLPAAL 129

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
            VDTG NRLGLS  EAL     +  + +   SL++SHL  A+ P   V + Q+  F  + 
Sbjct: 130 HVDTGMNRLGLSPDEALALAGGAALEDVAA-SLLVSHLVSAEVPGDAVTARQVADFARVA 188

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + + G+ ASL +S+G  LG     ++ RPG +LYGG  +    +PM+ VV  +A I+ +R
Sbjct: 189 AAFPGLTASLGNSAGTFLGARARHEMVRPGYALYGGNPRPGGPNPMRPVVRLDATILQVR 248

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G    Y  +        +A  ++GYADGYP   SG             +  + G  
Sbjct: 249 DVPPGATAGYNARWTAPGPRRLATLSLGYADGYPRAGSGR-----------AEAVVAGRR 297

Query: 307 VPILGKITMDMTMFDITDSL--SIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
            P++G I+MD+ + D+TD+   +   G    + G  + +D+V   +GT  Y++L  +G R
Sbjct: 298 CPVVGTISMDLVILDVTDAPPEAARRGARATLIGEGLDIDEVGQRAGTIGYEILTNLGRR 357

Query: 365 YAKFY 369
             + Y
Sbjct: 358 SERAY 362


>gi|319898680|ref|YP_004158773.1| Alanine racemase [Bartonella clarridgeiae 73]
 gi|319402644|emb|CBI76189.1| Alanine racemase [Bartonella clarridgeiae 73]
          Length = 374

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 127/367 (34%), Positives = 198/367 (53%), Gaps = 23/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID+ A+  N+ ++         +AVVK +AYGLG EKIAPALY AG + FF+  ++E ++
Sbjct: 22  IDIGAIVANYKTLARRVAPIECSAVVKADAYGLGAEKIAPALYQAGCRTFFIAHLKEALQ 81

Query: 71  LRLYTPQ-ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC---GVSHPYAL 126
           L+   PQ   I +L GI    E+ +    ++PV++S   +  +   M C   G   P  +
Sbjct: 82  LKAILPQNVTIVLLNGIPLTAEEFVAQAGIVPVLNSWHAIESWQ--MHCQKNGKKFPAVV 139

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DT  NRLGL  +E           +   +  IISHLA  DD +   N  Q    +T +
Sbjct: 140 QIDTNMNRLGLDQEELQWLIQTPTLFETADIKYIISHLANGDDITHTSNCAQKNAMKTAL 199

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP--MQTVVTAEARIIL 244
           +     +ASLA+S GI LGP+++F L RPGI+LY G D   K HP  +++V+  +A++I 
Sbjct: 200 AQLPACKASLANSGGIFLGPDFYFDLVRPGIALY-GIDPHGK-HPTSLKSVLKLKAQVIQ 257

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
            R   AG  V YGG     + S++   +IGYADG+   LS             G  +  G
Sbjct: 258 SRYTEAGTPVGYGGSFITQQPSILTTISIGYADGWLRNLSN-----------KGSVYFNG 306

Query: 305 YMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
           Y +PI+G+I+MD  + D T+      + GD++++ G    +++VA  +GT  Y++L  +G
Sbjct: 307 YKLPIIGQISMDSIIVDATNLKHKKPKRGDWVELIGIHQTIENVAADAGTIPYEILTSLG 366

Query: 363 TRYAKFY 369
           +RY + Y
Sbjct: 367 SRYKRIY 373


>gi|115525335|ref|YP_782246.1| alanine racemase [Rhodopseudomonas palustris BisA53]
 gi|115519282|gb|ABJ07266.1| alanine racemase [Rhodopseudomonas palustris BisA53]
          Length = 404

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 133/364 (36%), Positives = 187/364 (51%), Gaps = 10/364 (2%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  NW  +   +  A  A VVK + YG G   +  AL  AG + FFV ++EE 
Sbjct: 31  LTIDLDALIANWRRLEKTAVPAECAGVVKADGYGCGAGPVTKALAAAGCKTFFVATLEEA 90

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYALQ 127
             +R   P+A ++VL G+ P        T   PVI S+ +L  +       G     A+ 
Sbjct: 91  RAVRAAAPEAALYVLNGLFPNCGDGFAATGAQPVIGSLDELAEWDVFCRRTGWKGGAAIH 150

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGLS+ EA        N     ++L++SHLACAD  +  +N+ Q+  FR +  
Sbjct: 151 IDTGMNRLGLSIAEAQGIVPR-INAGDHGITLVMSHLACADMLNHPLNAKQVGAFREIAG 209

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+ ASLA+SSGI LG ++ F + RPG +LYG        +PMQ VVT +ARI+ +R+
Sbjct: 210 LFSGVPASLAASSGIYLGSHFGFDMVRPGAALYGINPTPEADNPMQPVVTLQARILQVRE 269

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V YG      R S +AV + GYADGY     G D      V       I G   
Sbjct: 270 VERGETVGYGATWTARRASKLAVISAGYADGYFRAAGGSDGTRGADV------IIAGQRC 323

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           PI G+I+MD+   D+TD    +   G    + G  I +D++    GT  Y++L  +G RY
Sbjct: 324 PIAGRISMDLLAVDVTDLAPNAARRGQMATLLGDGISVDELGHHFGTIGYEVLTSLGARY 383

Query: 366 AKFY 369
            + Y
Sbjct: 384 QRTY 387


>gi|319404005|emb|CBI77593.1| Alanine racemase [Bartonella rochalimae ATCC BAA-1498]
          Length = 373

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 199/367 (54%), Gaps = 23/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID+ A+  N+ ++         +AVVK +AYGLG EKIAPALY AG + FF+  ++E ++
Sbjct: 21  IDIGAIIANYKTLVQRVAPVECSAVVKADAYGLGAEKIAPALYQAGCRTFFIAHLKEALQ 80

Query: 71  LRLYTPQ-ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC---GVSHPYAL 126
           L+   P    + +L GI P  E+ +  T ++PV++S  ++  +   M C   G   P  +
Sbjct: 81  LKAILPNNVTLILLNGIPPTAEEFVTQTGIVPVLNSRNEIENWQ--MHCQKNGKKFPAII 138

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DT  NRLGL  +E      N    ++  +  IISHLA  D+ +   N  Q    +  +
Sbjct: 139 QIDTNMNRLGLDQEELQWLIQNPTLFEIADIKYIISHLANGDNATHTSNCEQKNAMKKAL 198

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP--MQTVVTAEARIIL 244
           +     +ASLA+S GI LGP+++F L RPGI LYG     ++ HP  +++V+  +A++I 
Sbjct: 199 AQLPACKASLANSGGIFLGPDFYFDLVRPGIGLYGIDP--HQKHPTSLKSVLKLKAQVIQ 256

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
            R   AG  V YGG     + S++   +IGYADG+   LS             G  +   
Sbjct: 257 SRCTEAGTPVGYGGSFITQKPSILTTISIGYADGWLRNLSN-----------KGSVYFNQ 305

Query: 305 YMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
           + +PI+G+I+MD  + D T+      + GD++++ G    +++VA  +GT  Y++L  +G
Sbjct: 306 HKLPIIGQISMDSIIVDATNLKHEKPKRGDWVELIGKHQTVENVAADAGTIPYEILTSLG 365

Query: 363 TRYAKFY 369
           +RY + Y
Sbjct: 366 SRYKRIY 372


>gi|158423689|ref|YP_001524981.1| alanine racemase [Azorhizobium caulinodans ORS 571]
 gi|158330578|dbj|BAF88063.1| alanine racemase [Azorhizobium caulinodans ORS 571]
          Length = 393

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 128/365 (35%), Positives = 197/365 (53%), Gaps = 15/365 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  N+  +   +  A  AAVVK +AYGLG   ++  LY  G + FFV    E 
Sbjct: 39  LTIDLGALARNYRKLKETAAPAAVAAVVKADAYGLGAGLVSERLYAEGCRHFFVAHFVEA 98

Query: 69  VKLRLYTP-QARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYAL 126
           V+LR   P +A + VL G+ PG+E+   D  + PVI+ + Q   ++      G     A+
Sbjct: 99  VRLRPTLPVEATLLVLNGLMPGEEEHAADLGVTPVINCLEQAAAWATEAKVRGTRLKAAI 158

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG +RLGLS  +      +S   +  +  L++SHLACAD P++  ++ QL   + + 
Sbjct: 159 QIDTGMSRLGLSEADVASLRADSLFAEAVEPILLMSHLACADTPAAPASAGQLAVMQRVA 218

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           +H+ G+  SLA+S G+ LG  +HF L RPGI++YGG    + ++PM+ VV  +  +I  R
Sbjct: 219 AHFPGLPVSLANSGGVFLGGAFHFALARPGIAVYGGAPVSDVANPMEPVVRIDIPVIQAR 278

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AG  V YGG    T ++ +A  + GYADG P  LS             G  + +G  
Sbjct: 279 TVPAGTAVGYGGTFVTTGETRLATLSGGYADGIPRHLSS-----------SGALYYQGVR 327

Query: 307 VPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           +PI G+++MD    D +      + +G  ++  GP   L+ VA  +GT +Y++L R+G R
Sbjct: 328 LPIAGRVSMDSLTVDASALPEGGLRLGTMVEFVGPSQSLEQVAADAGTISYEILTRLGRR 387

Query: 365 YAKFY 369
           Y + Y
Sbjct: 388 YRRVY 392


>gi|197103527|ref|YP_002128904.1| alanine racemase [Phenylobacterium zucineum HLK1]
 gi|196476947|gb|ACG76475.1| alanine racemase [Phenylobacterium zucineum HLK1]
          Length = 382

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 128/370 (34%), Positives = 198/370 (53%), Gaps = 25/370 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL+A++ N+ ++   +  AR AAVVK +AYGLG   ++ AL   G +DFFV  + E 
Sbjct: 14  LWIDLSAVRENFRALARHAAPARLAAVVKADAYGLGAGPVSEALAAEGCRDFFVAHLSEA 73

Query: 69  VKLRLYTPQ-ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           ++L+   P+ AR++VL G+  G+E       ++PV++S+ Q   +S+L    G + P  L
Sbjct: 74  LELKPVLPEDARLYVLNGLAAGREPACAAAGVLPVLNSLDQAERWSRLAPDGGAAPPAVL 133

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQL--SLIISHLACADDPSSHVNSVQLERFRT 184
           Q+D+G +RLGL   E      ++    LG+L   L++SHLACAD+P    N+ Q E F  
Sbjct: 134 QIDSGMSRLGLPEAEVRRLAGDA--DLLGRLRIDLLMSHLACADEPDHPANAAQAEAFDR 191

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT-DKINKSHPMQTVVTAEARII 243
           L +       SLA+S G LLGP +  QL R G+ L+GG   ++    P   VV   A ++
Sbjct: 192 LAAALPDWPRSLANSHGALLGPRFRHQLVRSGVFLFGGVRSQVLSPRP---VVRLTAPVV 248

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R   AG  V YG        + IA  A+GYADG+   L    +E  P++F        
Sbjct: 249 QVRDVPAGAGVGYGFAHVTRAPARIATVALGYADGWSWNL----AEGWPALF-------D 297

Query: 304 GYMVPILGKITMDMTMFDIT----DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
           G  +P+ G+++MD    D+T        ++ GD ++  G    + D A A+GT  Y++L 
Sbjct: 298 GQTLPVAGRVSMDSITLDVTAFEAAGGRLQPGDEVEFLGAGRDIVDAAEAAGTIPYEILT 357

Query: 360 RIGTRYAKFY 369
           R+G R  + Y
Sbjct: 358 RMGRRLQRRY 367


>gi|114799438|ref|YP_761112.1| alanine racemase [Hyphomonas neptunium ATCC 15444]
 gi|114739612|gb|ABI77737.1| alanine racemase [Hyphomonas neptunium ATCC 15444]
          Length = 396

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 132/372 (35%), Positives = 201/372 (54%), Gaps = 17/372 (4%)

Query: 3   SNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFV 62
           ++E  RL ID+ A+  N+  + A+   AR AAVVK +AYGL   +IAP L   G +DFFV
Sbjct: 24  TDEAGRLTIDMGAIAANYRRLRAMHPAARVAAVVKADAYGLDATQIAPMLAGQGARDFFV 83

Query: 63  TSVEEGVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQL-TFYSKLMSCGV 120
             + E + L+ L  P A +FVL G+ PG E +  +  ++PV+++  Q   +Y+  ++   
Sbjct: 84  AHLAEALVLKPLLPPDAVLFVLNGLAPGSEPLCAEAGILPVLNTPEQARAWYTLAVNKAH 143

Query: 121 SHPYALQVDTGFNRLGLSLQEALD-FTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQL 179
             P ALQVDTG +RLGLS  E  D     SF  ++  + L+++H+ACAD P +  N+ Q+
Sbjct: 144 PVPAALQVDTGMSRLGLSEGELNDVLGWPSFAGQV-NICLLMTHMACADTPGAPANADQM 202

Query: 180 ERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAE 239
            RF    +    +  SLA+S+  +  P     + RPG+ LYG          MQ  +  E
Sbjct: 203 RRFADFAARLPSVPRSLANSAAAMFLPEAAGDVLRPGLVLYGVDPGAGGVPKMQPAIALE 262

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           ARII +R   AG  V YG      R   +A  + GYADG+P  LS            GG 
Sbjct: 263 ARIIQLRHIPAGAGVGYGFDYIADRPLRVATLSAGYADGWPRALSN-----------GGA 311

Query: 300 GFIKGYMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
            +  G+ +PILG+++MD  M D+T+    SI  GD +++ GP   ++D+A    TT +++
Sbjct: 312 TWFAGHRLPILGRVSMDSCMVDVTNLPEGSIRPGDCVELIGPHQSVNDLARQLATTPHEI 371

Query: 358 LVRIGTRYAKFY 369
           L  +G R+ + Y
Sbjct: 372 LTSLGRRFTRSY 383


>gi|255264281|ref|ZP_05343623.1| alanine racemase [Thalassiobium sp. R2A62]
 gi|255106616|gb|EET49290.1| alanine racemase [Thalassiobium sp. R2A62]
          Length = 345

 Score =  202 bits (515), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 202/364 (55%), Gaps = 30/364 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL+A+  NW +++ +S  + TAAVVK N YGLG  ++A AL  AG + FFV + EE 
Sbjct: 6   LTIDLSAVIANWKALDQIS-TSETAAVVKANGYGLGSRRVARALARAGARKFFVATAEEA 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             +R +   +  I++  G   G   +I D  LIP+++S+ Q+  + + +    +HP+ +Q
Sbjct: 65  ANVRNVLGDEHEIYIFAGHMSGDTDMISDLGLIPLLNSLDQMVMHLEALP---NHPFGVQ 121

Query: 128 VDTGFNRLGLSLQE--ALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +DTG NRLG+   E  A+     S N KL     I+SHLACAD+P    N++QL  FR++
Sbjct: 122 LDTGMNRLGMEPAEWGAVRDMALSQNPKL-----IMSHLACADEPDHTQNAMQLTSFRSM 176

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
                 +  SLA++ GILLG +YHF LTRPG+ LYGG    N     + VV  +  +I +
Sbjct: 177 TDGVS-VPRSLAATGGILLGSDYHFDLTRPGVGLYGGAPFANA----KPVVQLDIPVIQV 231

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    GE V YG      R S IA  + GYADG    +SG  +            + +G 
Sbjct: 232 RDVAVGEAVGYGASWVAERPSKIATISAGYADGLIRAMSGQATL-----------WHEGI 280

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
             P+ G+++MD+   D+TD L I    Y+ I  P+  +DD+A  +GT  Y++L  +G RY
Sbjct: 281 PCPLAGRVSMDLLTVDVTD-LPIPP-RYLSILCPEQSVDDLAAVAGTIGYEILTSLGGRY 338

Query: 366 AKFY 369
           ++ +
Sbjct: 339 SRRF 342


>gi|254785046|ref|YP_003072474.1| alanine racemase [Teredinibacter turnerae T7901]
 gi|237683511|gb|ACR10775.1| alanine racemase [Teredinibacter turnerae T7901]
          Length = 382

 Score =  202 bits (515), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 130/380 (34%), Positives = 199/380 (52%), Gaps = 27/380 (7%)

Query: 9   LKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L I+L+ +  NW ++N  +S      AVVK +AY LG  ++ PALY AG + F+V ++ E
Sbjct: 5   LTINLSKIAANWQALNRFVSAPVDCGAVVKADAYSLGMAEVLPALYLAGCRTFYVANLGE 64

Query: 68  GVKLR--------LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCG 119
            +  R         Y+  A I VL G  PG+E+   D  L+PV+ S   L  +  +   G
Sbjct: 65  ALDARGILSDVCGSYSDVA-IVVLGGCAPGEERRFIDYRLVPVLVSTAMLERWCTVN--G 121

Query: 120 VSHPY---ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNS 176
             H      L+++TG  RLGL   E      +        + +++SHLACAD+P   +N+
Sbjct: 122 GEHNVLGSILKLNTGMGRLGLEPAEFERVVQDPAYLARADVRMLMSHLACADEPEHSLNA 181

Query: 177 VQLERFRTLI----SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSH-P 231
            QL+RFR  +      Y+ + ASLA+S+G+ LG +YHF   RPG+ LY    + +     
Sbjct: 182 EQLQRFRRALDVSSERYRPLTASLANSAGVCLGGDYHFNAVRPGLGLYTSFAQADACGLG 241

Query: 232 MQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHS 291
           ++T V     ++ +R   AGE V YG   +  RD+ +AV A GYADG    LS  +  H 
Sbjct: 242 LETAVELHLPVVQVRNLPAGESVGYGATYRAERDARLAVVAGGYADGLFRALS--NRAHC 299

Query: 292 PSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALA 349
                 G G   G+ VP++G+I+MD T+ DI+      +  G  I+  G  + LDD+A +
Sbjct: 300 WVCAPSGAG---GWRVPVVGRISMDTTIVDISAVPEGVVAEGSRIEFIGEHVPLDDLAAS 356

Query: 350 SGTTNYDLLVRIGTRYAKFY 369
           + T NY++L  +G RY + Y
Sbjct: 357 AQTINYEILTSLGVRYKRHY 376


>gi|261318416|ref|ZP_05957613.1| alanine racemase [Brucella pinnipedialis B2/94]
 gi|261297639|gb|EEY01136.1| alanine racemase [Brucella pinnipedialis B2/94]
          Length = 353

 Score =  202 bits (513), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 125/352 (35%), Positives = 186/352 (52%), Gaps = 28/352 (7%)

Query: 35  VVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLRLY-TPQARIFVLYGIHPGQEKI 93
           +VK +AYGLG  ++APA Y AG +DFFV  + E V L+ +  P A ++VL G+ PG E  
Sbjct: 1   MVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTEAA 60

Query: 94  IFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNK 152
                ++PV++S+ Q+  ++ L +  G   P  LQ DTG +RLGLS +E      N    
Sbjct: 61  CAREGILPVLNSLEQVENWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLL 120

Query: 153 KLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQL 212
               +   ISHLA  D+P +  N+ QL +   L++    + A+LA+S G  LG  Y+F L
Sbjct: 121 SRIDIKFAISHLANGDEPGNAANARQLAKMTALLARLPKLPAALANSGGTFLGKTYYFDL 180

Query: 213 TRPGISLYG--------GTDKI---NK--SHPMQTVVTAEARIILIRKALAGELVSYGGQ 259
            RPGI+LYG         +DK+   NK   H +  V+T  AR+I +R    G  V YGG 
Sbjct: 181 ARPGIALYGIDPERQHDFSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGATVGYGGT 240

Query: 260 KKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTM 319
                   IA  A+GYADG   +LS             G  F     +PI+G+++MD   
Sbjct: 241 YVANGPMRIATIAVGYADGLFRSLSN-----------KGAAFFGDTRLPIIGRVSMDSIT 289

Query: 320 FDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFY 369
            D+T     ++++G  +++ GP  +L+DVA    T  Y++L  +G RYA+ Y
Sbjct: 290 LDVTSLPEGTLKLGSLVELIGPHQRLEDVARDCDTIPYEILTALGNRYARVY 341


>gi|262277398|ref|ZP_06055191.1| alanine racemase [alpha proteobacterium HIMB114]
 gi|262224501|gb|EEY74960.1| alanine racemase [alpha proteobacterium HIMB114]
          Length = 359

 Score =  202 bits (513), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 124/370 (33%), Positives = 194/370 (52%), Gaps = 29/370 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGC-EKIAPALYNAGVQDFFVTSVEE 67
           L I+L A+K N+ ++      +     VK ++YGLG   KI   L NAG + FFV ++ E
Sbjct: 8   LDINLNAVKQNYLTIKKFCSKSEICGTVKASSYGLGGHNKIVTTLKNAGCKRFFVANINE 67

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           G+ +R       I +L G++ G+EKI++  NL PVI+++ QL  +             + 
Sbjct: 68  GIFIRKKFKSIIINILNGLNRGEEKILYKHNLNPVINTISQLKKWLIFTKNKRKDKLVIH 127

Query: 128 VDTGFNRLGLS---LQEALDFTH--NSFNKKLGQLSLIISHLACADDPSSHVNSVQLERF 182
            DTG  RLG+    + E L      N F +      +I+SHLACA D  ++ N  Q ++F
Sbjct: 128 FDTGMCRLGIQEDQITEVLKLKDQINKFKE-----VIIMSHLACAGDKKNNYNEKQRKKF 182

Query: 183 RTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARI 242
             +   + G + SLA+S GI LG  YH+ L RPGI+LYGG+  +N    ++ VV+ +A I
Sbjct: 183 EKIRRTFPGYKYSLAASGGIFLGKKYHYDLVRPGINLYGGSKSLN--SKIKHVVSLKAPI 240

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I I     GE   Y    K  RDS+ A   +GYADG  + LS              KG++
Sbjct: 241 IQINNLKKGETAGYSRTFKAKRDSITATIPMGYADGIGIRLS-------------NKGYV 287

Query: 303 --KGYMVPILGKITMDMTMFDITD-SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
             K   +P++G+++MD+ + DIT     I+VGD+++++     +D+ A  +GT  Y ++ 
Sbjct: 288 HFKNKKIPMIGRVSMDLIILDITKFKNKIKVGDFVEVYNDKFTIDNFANLTGTIPYRIIT 347

Query: 360 RIGTRYAKFY 369
            I  RY + Y
Sbjct: 348 CISKRYLRNY 357


>gi|49475978|ref|YP_034019.1| alanine racemase [Bartonella henselae str. Houston-1]
 gi|49238786|emb|CAF28055.1| Alanine racemase [Bartonella henselae str. Houston-1]
          Length = 372

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 121/362 (33%), Positives = 189/362 (52%), Gaps = 14/362 (3%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID+ A+  N+ ++         +AVVK NAYGLG  KIAPALY AG + FFV  +EE ++
Sbjct: 21  IDVRAIVANYRTLAQHVAPTECSAVVKANAYGLGAHKIAPALYQAGCRTFFVAQIEEALQ 80

Query: 71  LRLYTPQ-ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL-MSCGVSHPYALQV 128
           L+   P+   I +L G     E+ +  + +IP+++S   +  +  L        P  +QV
Sbjct: 81  LKAVLPENVMIALLNGFPHKAEEFVAQSGIIPLLNSWSTIEDWQTLCQKKNKKFPAIIQV 140

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           DT  +RLGL  +E      N    +  ++  I+SHLA  +D S   N+ QL  F+ +++ 
Sbjct: 141 DTNMSRLGLDKKELQKLIKNPTIFEKAEIKYILSHLANGEDASHSSNNKQLAAFKRVLAQ 200

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKA 248
               + S A+S GI LG +++F L RPGI+LYG         P++ VV  EA+++  R  
Sbjct: 201 LPTCKVSFANSGGIFLGSDFYFDLVRPGIALYGVDPHGKHPTPLKAVVKVEAQVLQSRFI 260

Query: 249 LAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVP 308
            AG  V Y       R S +A  +IGYADG+P  LS             G  +  G+ +P
Sbjct: 261 DAGIPVGYRESFMTRRPSTLATISIGYADGWPRILSN-----------KGTVYFNGHKLP 309

Query: 309 ILGKITMDMTMFDITD-SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           I+G I+MD  + D TD     + GD++++ GP   L+ V+  + T  +++L  +G RY +
Sbjct: 310 IVGHISMDSIIVDATDLDKKPQRGDWVELIGPHQPLEKVSTDTNTIPHEILTSLGKRYKR 369

Query: 368 FY 369
            Y
Sbjct: 370 IY 371


>gi|254465901|ref|ZP_05079312.1| alanine racemase [Rhodobacterales bacterium Y4I]
 gi|206686809|gb|EDZ47291.1| alanine racemase [Rhodobacterales bacterium Y4I]
          Length = 345

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 134/367 (36%), Positives = 191/367 (52%), Gaps = 33/367 (8%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL I+L AL  NW +++AL+ N  TAAVVK N YGL   ++  AL  AG ++FFV + EE
Sbjct: 5   RLTINLDALVTNWRNLDALT-NCETAAVVKANGYGLDAGRVGKALARAGARNFFVAAAEE 63

Query: 68  GVKL-RLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           G  L R   P   I V  G   G  K++ D  L P+++S+ Q+  + + +     HP+ +
Sbjct: 64  GGALRRALGPGPGISVFSGHMEGDAKLLKDFQLTPMLNSLDQMLRHFETLP---GHPFGV 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G NRLG+   E       +  +      L++SHLACAD+P   +N+ QL  FR L 
Sbjct: 121 QLDSGMNRLGMEPGEWAAVAEIALGQN---PVLLMSHLACADEPGHGMNARQLHTFRELT 177

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
                I  SLA++ G+LLG +YHF L RPGI LYGG      + P   VV  +  +I +R
Sbjct: 178 DGLD-IPRSLAATGGMLLGSDYHFDLCRPGIGLYGGL-PFKDALP---VVQLDLPVIQVR 232

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               GE   YG      R S IA  A GYADG    +              G+G I+ Y 
Sbjct: 233 DMEPGESAGYGNAWVAKRPSRIATVAAGYADGLHRAM--------------GQGGIQVYA 278

Query: 307 ----VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
                P++G+++MD+   D+TD    EV D + I      +D +A A+GT  Y++L   G
Sbjct: 279 GDTPCPVVGRVSMDLITVDVTD--LAEVPDMLAILNERQTVDMLADAAGTIGYEILTSSG 336

Query: 363 TRYAKFY 369
            R A+ Y
Sbjct: 337 HRSARTY 343


>gi|319408978|emb|CBI82637.1| Alanine racemase [Bartonella schoenbuchensis R1]
          Length = 373

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 194/365 (53%), Gaps = 15/365 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           + ID+ A+  N+ ++         +AVVK NAYG+G EK+APALY AG + FFV  ++E 
Sbjct: 19  VTIDIGAIVANYTALAQHVAPTECSAVVKANAYGIGVEKVAPALYQAGCRTFFVAQIKEA 78

Query: 69  VKLRLYTP-QARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL-MSCGVSHPYAL 126
           ++L+   P    + +L G+ P  E+ +    ++PV++S  ++  +  L        P  +
Sbjct: 79  LQLKNILPSDVTLALLNGLPPAAEEFVAQAGIVPVLNSWHEIESWQILCQEKSKKFPAIV 138

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DT  NRLGL  +E           ++  +  IISHL+  DD +   N  QL   +T++
Sbjct: 139 QIDTNMNRLGLDQKELQQLIKCPTLFEVADIKYIISHLSNGDDFTHSSNDTQLTTIKTML 198

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           +     + SLA+S GI LGP+++F L RPGI+LYG       + P++ V+  EA++I  R
Sbjct: 199 AQLPACKVSLANSGGIFLGPDFYFDLVRPGIALYGINLHKKHTVPIKPVLKLEAQVIQSR 258

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G  + YGG     R S++   +IGYADG+   LS             G  + KGY 
Sbjct: 259 FVEEGVPIGYGGSFITRRPSVLTTISIGYADGWMRNLSN-----------KGSVYFKGYK 307

Query: 307 VPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           +PI+G+I+MD  + D TD      + GD++++ G    ++DV++ + T  +++L  +  R
Sbjct: 308 LPIVGRISMDSIIVDATDLEHGKPKRGDWVELIGEHQTIEDVSIDANTVPHEILSSLSAR 367

Query: 365 YAKFY 369
             + Y
Sbjct: 368 CKRIY 372


>gi|148553730|ref|YP_001261312.1| alanine racemase [Sphingomonas wittichii RW1]
 gi|148498920|gb|ABQ67174.1| alanine racemase [Sphingomonas wittichii RW1]
          Length = 378

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 128/366 (34%), Positives = 199/366 (54%), Gaps = 18/366 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L+IDL A+ +N+  +   +  A  AAVVK +AYGLG  ++A AL +AG + FFV  + E 
Sbjct: 12  LRIDLDAIIDNYRLIQQRAAPAEVAAVVKADAYGLGAARVAAALRDAGCRRFFVAHLVEA 71

Query: 69  VKLRLYTPQA-RIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYAL 126
            +LR        I VL G+ PG E    +   +PV++++ Q+  ++ L     +  P  +
Sbjct: 72  ARLREAIGDGVEIGVLNGLQPGAETACAELGAVPVLNALDQIERWAALARASSARLPCMI 131

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGL+  E               + LI+SHLACAD+P    N  Q + F    
Sbjct: 132 QFDTGMSRLGLAPGEVRALIDRPERLDGLDIRLIMSHLACADEPERASNQHQAQAFDAFC 191

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + + GI  SL +S G LL   +H+ + R GI+LYGG  +    +PM+ VVT +AR+I +R
Sbjct: 192 ARFPGIPRSLDNSGGALLPRAHHYDVVRAGIALYGGAPQTGP-NPMRPVVTLDARVIQLR 250

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G  V YG   +  R + +A  ++GYADG+P +L              G  ++ G+ 
Sbjct: 251 TVEPGTAVGYGLTHRFDRPARLATLSVGYADGWPRSLGNR-----------GAAYVAGHR 299

Query: 307 VPILGKITMDMTMFDITDSLSIEV---GDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            PI+G+I+MD    D++D +  E+   G  I++ GP   +DDVA  +GT +Y++L ++G 
Sbjct: 300 APIVGRISMDSLTIDVSD-IPEELLLPGSLIELIGPHQSIDDVARDAGTISYEILTQLGH 358

Query: 364 RYAKFY 369
           RYA+ Y
Sbjct: 359 RYARSY 364


>gi|13473409|ref|NP_104976.1| alanine racemase [Mesorhizobium loti MAFF303099]
 gi|20137427|sp|Q98F05|ALR2_RHILO RecName: Full=Alanine racemase, catabolic
 gi|14024158|dbj|BAB50762.1| alanine racemase [Mesorhizobium loti MAFF303099]
          Length = 381

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 127/366 (34%), Positives = 183/366 (50%), Gaps = 17/366 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A++ N+  + AL G    A VVK N YGLG  K+A AL   G   FFV  + EG
Sbjct: 27  LTIDLGAIRENYRRLKALLGGVHCAGVVKANGYGLGAAKVAAALTREGCDIFFVALLAEG 86

Query: 69  VKLRLYTPQAR-IFVLYGIHPGQEKIIFDTNLIPVISSVPQL-TFYSKLMSCGVSHPYAL 126
           + LR        I+VL G+ PG E       L  VI+S  QL  + + +   G   P A+
Sbjct: 87  IALRKAVGTGPDIYVLNGLPPGSEPEAVAAGLCAVINSGAQLKAWRAAVHDAGRRLPAAI 146

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           QVD+G +RLG++  E      +S       +  ++SHLACAD+P    N  Q   F  L 
Sbjct: 147 QVDSGMSRLGMAPAEVEALAGDSSAFDGIDIKYVMSHLACADEPRHPANEQQRLAFERLR 206

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           +      ASLA+SSGI LGP+YH  L RPG +LYG      + +PM  VV  +A++   R
Sbjct: 207 AMLPRAPASLANSSGIFLGPSYHHDLARPGAALYGINPTPGEPNPMLPVVWLQAKVAQTR 266

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
           +   G  + YG          +A  + GYADG+      L    S + F       +G  
Sbjct: 267 RIEKGAGIGYGHSYHADGPLSLATISFGYADGW------LRRSASAAWF-------EGVR 313

Query: 307 VPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           +P LG+++MD  + DI+      +  GD +++ GP   +DD A  +GT  Y++L  +G R
Sbjct: 314 LPFLGRVSMDSIILDISALPPGRLREGDLVELLGPSQSVDDAAGHAGTIGYEILASLGPR 373

Query: 365 YAKFYT 370
           + + Y 
Sbjct: 374 FHRHYV 379


>gi|254475313|ref|ZP_05088699.1| alanine racemase [Ruegeria sp. R11]
 gi|214029556|gb|EEB70391.1| alanine racemase [Ruegeria sp. R11]
          Length = 345

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 137/365 (37%), Positives = 192/365 (52%), Gaps = 27/365 (7%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           +L I+L AL  NW +++AL+ N  TAAVVK N YGL   ++  AL  AG ++FFV   EE
Sbjct: 5   KLTINLDALVTNWRNLDALT-NCETAAVVKANGYGLDAGRVGQALAKAGARNFFVAIAEE 63

Query: 68  GVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           GV LR    P   I V  G   G  K++ D  L P+++S+ Q+  + + +     H + +
Sbjct: 64  GVALRRALGPGPGISVFAGHMEGDAKLLRDFQLTPMLNSLDQMLRHFESLP---GHAFGV 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLS-LIISHLACADDPSSHVNSVQLERFRTL 185
           Q+D+G NRLG+   E         +  LGQ   L++SHLACAD+PS  +N+ QL+ F  L
Sbjct: 121 QLDSGMNRLGMEAAEWAAVR----DIALGQGPVLVMSHLACADEPSHPMNAQQLQTFSEL 176

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
                 +  SL+++ G+LLG NYHF L RPGI LYGG      + P   V   +  +I I
Sbjct: 177 TDGLD-VPRSLSATGGLLLGRNYHFDLCRPGIGLYGG-QPFGDALP---VAQLDLPVIQI 231

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    GE V YG      R S IA  A GYADG    L         SVF G        
Sbjct: 232 RDLDVGETVGYGNAWSAQRPSRIATVAAGYADGLHRAL----GNGGISVFAGDT------ 281

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
             P+ G+++MD+   DITD    +   ++ I      +D +A A GT  Y++L  +G+RY
Sbjct: 282 PCPVAGRVSMDLITVDITD--LPDSPSHLTILNEQQTVDMLADAGGTIGYEILTSLGSRY 339

Query: 366 AKFYT 370
           A+ YT
Sbjct: 340 ARSYT 344


>gi|146340278|ref|YP_001205326.1| putative alanine racemase (alr) [Bradyrhizobium sp. ORS278]
 gi|146193084|emb|CAL77095.1| putative alanine racemase (alr) [Bradyrhizobium sp. ORS278]
          Length = 393

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/367 (34%), Positives = 188/367 (51%), Gaps = 15/367 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  NW  +   +  A  A V+K +AYG G  ++A  L  AG + FFV ++ E 
Sbjct: 27  LTIDLDALAANWRKLEKTAVPAECAGVIKADAYGCGIPQVARTLAAAGCKTFFVATLGEA 86

Query: 69  VKLRLYTPQ-ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC---GVSHPY 124
              R   P+ A ++VL G            N  PVI  + +L  +   M C   G     
Sbjct: 87  KIARSALPEPAALYVLDGFFQNTGDDYAAINCRPVIGDLNELAEWD--MFCRRTGWKGGA 144

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           A+ VDTG NRLGL+  +A        +   G ++L++SHLA A+  +S  N+ QL  FR 
Sbjct: 145 AIHVDTGMNRLGLTPIDAQGMIPRIQSGDHG-ITLVMSHLASAEQVNSPANARQLATFRE 203

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           + S + G+ A+LA+SSGI LG ++HF + RPG +LYG        +PMQ V   +ARI+ 
Sbjct: 204 VASVFTGVPAALAASSGIFLGASFHFDMVRPGAALYGVNPTPEADNPMQPVAEIKARIVQ 263

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R    G+ V YGG     R + IA+ + GYADGY    S  D      V + G+     
Sbjct: 264 LRDLARGDAVGYGGTWTARRPTKIAILSAGYADGYFRAASSNDGTRGADVIVAGQ----- 318

Query: 305 YMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
              P+ G+++MD+   D+TD    +   G +  + G  I +D++A   GT  Y++L  +G
Sbjct: 319 -RCPVAGRVSMDLIAVDVTDLPPKAARRGHFATLLGEGISVDELAHHFGTIGYEVLTNLG 377

Query: 363 TRYAKFY 369
            RY + Y
Sbjct: 378 RRYHRIY 384


>gi|84684702|ref|ZP_01012602.1| alanine racemase [Maritimibacter alkaliphilus HTCC2654]
 gi|84667037|gb|EAQ13507.1| alanine racemase [Rhodobacterales bacterium HTCC2654]
          Length = 349

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 132/365 (36%), Positives = 197/365 (53%), Gaps = 26/365 (7%)

Query: 8   RLKIDLTALKNNWHSMNALSGNA-RTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           RL+IDL A+  NW +++A + ++ +T AVVK + YGLG +++A  L  AG + FFV + E
Sbjct: 5   RLQIDLDAIAANWRALDAKTASSVQTGAVVKADGYGLGVDRVAKTLAAAGARRFFVAAAE 64

Query: 67  EGVKLRL-YTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           E   +R    P   IF+L G   G   +I D NLIP++SSV QLT + + +       + 
Sbjct: 65  EAADVRTALGPGPAIFLLNGHMAGDADMIRDLNLIPLLSSVEQLTRHVETLP---GQSFG 121

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +Q+D G NRLG+   E       +        +LI+SHLACAD+P   +N++QL  F T 
Sbjct: 122 IQLDAGMNRLGMEPAEWAAVRDIALTAGP---TLIMSHLACADEPEHEMNAMQLRMF-TE 177

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
           ++    +  SLA++ GILLGP+YHF LTRPGI LYG      ++ P   VV  +  +I  
Sbjct: 178 MTEGCDVPRSLAATGGILLGPDYHFDLTRPGIGLYGAR-PFEEATP---VVHLDLPVIQT 233

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+   GE V YG        + +A  + GYADG    LS             G  F    
Sbjct: 234 REIGRGETVGYGNSWTADAPTRVATVSGGYADGITRHLSN-----------KGVLFDSAT 282

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
             PILG+++MD    DI    ++   +++ + GP   +DD+A  +GT  Y++L ++G RY
Sbjct: 283 PCPILGRVSMDSIGIDIGHLDTVP--EWLTLIGPHQSVDDIADTTGTIGYEILTQLGHRY 340

Query: 366 AKFYT 370
            + YT
Sbjct: 341 TRDYT 345


>gi|85716398|ref|ZP_01047370.1| alanine racemase region protein [Nitrobacter sp. Nb-311A]
 gi|85696755|gb|EAQ34641.1| alanine racemase region protein [Nitrobacter sp. Nb-311A]
          Length = 397

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/365 (34%), Positives = 183/365 (50%), Gaps = 11/365 (3%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+  NW  +   +  A  A VVK +AYG G   +  AL  AG + FFV +++E 
Sbjct: 31  LTVDLDAIVANWRKLEKAAVPAECAGVVKADAYGCGSRPVVRALSAAGCKTFFVATLDEA 90

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYALQ 127
             +R     A I+VL G            N  PVI  + +L  +       G +   A+ 
Sbjct: 91  RVVRAAASAADIYVLDGFFQNCGDAFATINCRPVIGDINELAEWDVFCRRTGWAGGAAIH 150

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGL+  EA            G ++L++SHLACA+  +  +N+ Q+  FR +  
Sbjct: 151 IDTGMNRLGLTPDEAQGILPRIEAGDHG-ITLVMSHLACAESLNHPLNARQVAAFREIAR 209

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+ ASLA+SSGI LGP Y F L RPG +LYG       ++PMQ VV  +ARI+  R 
Sbjct: 210 LFSGVPASLANSSGIFLGPQYQFDLVRPGAALYGVNPTPEAANPMQPVVELKARIVQTRS 269

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V YG      R + +AV + GYADGY       D     ++       + G   
Sbjct: 270 IDKGESVGYGATWTARRPTRLAVVSAGYADGYFRAGGSNDGTRGANI------VVAGTRC 323

Query: 308 PILGKITMDMTMFDITDSLS---IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           P+ G+I+MD+   DITD  S   +  G    + G  I +D++A   GT  Y++L  +G R
Sbjct: 324 PVAGRISMDLLAVDITDLPSPGGVRRGHLATLIGEGITVDELAHHFGTIGYEVLTSLGRR 383

Query: 365 YAKFY 369
           Y + Y
Sbjct: 384 YYRIY 388


>gi|254419455|ref|ZP_05033179.1| alanine racemase [Brevundimonas sp. BAL3]
 gi|196185632|gb|EDX80608.1| alanine racemase [Brevundimonas sp. BAL3]
          Length = 346

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 124/364 (34%), Positives = 185/364 (50%), Gaps = 30/364 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL AL  N+H++ A++G      VVK +AYGLG E  A  L   G + FFV    EG
Sbjct: 7   LSVDLNALARNFHTLEAVTG-VPVHPVVKADAYGLGAEACAKRLMAEGARTFFVARAGEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM--SCGVSHPYA 125
             LR    P+  ++VL G H     ++   +L PV++   Q+  +++    +CG      
Sbjct: 66  AALRTALGPEPVLYVLDGCHGEAAGLLKAADLRPVLNQPAQMKAWAEAGGGACG------ 119

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           LQ+DTG NRLG   ++A +            LSL++SHLAC D+P   +N  Q +RF  +
Sbjct: 120 LQIDTGLNRLGFRPEDAPEVFDG--------LSLVMSHLACGDEPDQPMNRRQRDRFAGM 171

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
           +  Y G+  S A+S G  LGP++ F   RPG+ LYGG  +      +  V    A ++L+
Sbjct: 172 VERYPGVTRSFANSGGCFLGPDFAFDAVRPGVCLYGGGPEGRPDERIAPVAALTAEVLLV 231

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    GE V Y       R    AV A GYAD       G+   + P     G  ++ G 
Sbjct: 232 RDVRTGESVGYSRGFVAERPMRAAVVAAGYAD-------GVLRAYGPR----GAVWVAGE 280

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
             P+LG+I+MD+   D+T  L + VGD +++FG    +D  A A+GT +Y+LL  +  R 
Sbjct: 281 TRPLLGRISMDVCTVDVT-GLEVAVGDRVELFGAHRPIDAAAAAAGTISYELLTAVTVRV 339

Query: 366 AKFY 369
            + Y
Sbjct: 340 PRAY 343


>gi|241762419|ref|ZP_04760497.1| alanine racemase [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241373013|gb|EER62671.1| alanine racemase [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 349

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 121/369 (32%), Positives = 190/369 (51%), Gaps = 23/369 (6%)

Query: 1   MHSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDF 60
           M  +  LRL++D +AL  NW S+N ++      A +K N YGLG E++   L  AG +DF
Sbjct: 1   MQISSPLRLELDKSALMANWQSLNRITAG-HCGAAIKANGYGLGAERVRHYLAQAGCRDF 59

Query: 61  FVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGV 120
           FV+S +E   L        + VL+G+         ++++ PV+ S   +   ++  +   
Sbjct: 60  FVSSWDEARLLDSSEKDFSLSVLHGLREDDLGYALNSSVKPVLCSPAMI---ARWKAHAP 116

Query: 121 SHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLE 180
           + P  + VDTG NRLGLS++EA     +  +     +  I+SHLACAD+    +N  QLE
Sbjct: 117 NRPCDVMVDTGMNRLGLSMEEAGSGLLDGLS-----IDNILSHLACADEADHPLNQKQLE 171

Query: 181 RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEA 240
           RFR L +  +    SLA+S+GI L  +YHF L RPG++LYGG         ++ VV   A
Sbjct: 172 RFRILAARKQAKRYSLANSAGIFLSKDYHFDLARPGLALYGGLPVPQSKDILKPVVAIAA 231

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
           + I +R+  AGE + YG      +   +A+  +GYADGY             + F  G  
Sbjct: 232 QAIQVREVSAGEAIGYGACFVTPKKMRVAILHVGYADGY-----------WRAFFEKGHA 280

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
              G + P+ G+++MDM    + D+L+ + GD+   F  D  L   +  +G + Y+LL  
Sbjct: 281 RKDGVICPLAGRVSMDMITVALPDALTAQEGDW---FSVDFDLPSASQQTGLSQYELLTG 337

Query: 361 IGTRYAKFY 369
           +G RY   +
Sbjct: 338 LGHRYQSVW 346


>gi|294677111|ref|YP_003577726.1| alanine racemase [Rhodobacter capsulatus SB 1003]
 gi|294475931|gb|ADE85319.1| alanine racemase [Rhodobacter capsulatus SB 1003]
          Length = 349

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 132/369 (35%), Positives = 198/369 (53%), Gaps = 38/369 (10%)

Query: 9   LKIDLTALKNNWHSMNALSGNA-RTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L+IDL A+  NW +++A++  A  T AVVK ++YGLG  ++A  L  AG + FFV + EE
Sbjct: 6   LRIDLDAVLANWRALDAMTSAATETGAVVKADSYGLGAARVARVLARAGARKFFVAAAEE 65

Query: 68  GVKLRLYTPQA-RIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           G  +R    +   IFV  G   G  ++I D  L P+++SV Q+  +   +       + +
Sbjct: 66  GAAVRQALGEGPEIFVFSGHMAGDTEMIGDLGLTPMLNSVEQVKRHVDALPGAA---FGV 122

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG NRLGL   E  D+   S         L++SHLAC+D+P   +N++QL+ FR + 
Sbjct: 123 QLDTGMNRLGL---EPADWAAVSAELIAAGPKLVMSHLACSDEPEHPMNAMQLKNFRAMT 179

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQT---VVTAEARII 243
               G++ +L+++ GILLGP+YHF +TRPGI LYGG        P +T   VV     ++
Sbjct: 180 DGL-GLKRALSATGGILLGPDYHFDVTRPGIGLYGGL-------PFETARAVVRLSLPVV 231

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSG---LDSEHSPSVFLGGKG 300
            IR    GE V Y       R+S IA  A GYADG     SG   L +  +P        
Sbjct: 232 QIRTVAPGETVGYANSWTAARESRIATVAAGYADGLSRRFSGKATLWAGDTP-------- 283

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
                  P++G+++MD+   D+TD    EV   ++I GP   +D +A  +GT  Y++L  
Sbjct: 284 ------CPLVGRVSMDLITVDVTD--LPEVPQSLEILGPHQGVDALAEVAGTIGYEILTA 335

Query: 361 IGTRYAKFY 369
           +G RY + Y
Sbjct: 336 LGQRYQRSY 344


>gi|260466737|ref|ZP_05812923.1| alanine racemase [Mesorhizobium opportunistum WSM2075]
 gi|259029467|gb|EEW30757.1| alanine racemase [Mesorhizobium opportunistum WSM2075]
          Length = 379

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 127/366 (34%), Positives = 186/366 (50%), Gaps = 19/366 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A++ N+  + A  G  R A VVK + YGLG  ++A AL   G   FFV  + EG
Sbjct: 25  LTIDLGAIRENYRRLKAQLGGVRCAGVVKADGYGLGATQVASALMKDGCDTFFVALLAEG 84

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQL-TFYSKLMSCGVSHPYAL 126
           + LR        I+VL G+ PG E       L  VI+S  QL  + +     G   P A+
Sbjct: 85  ISLRKAIGAGPDIYVLNGLPPGSEPEAVAAGLCAVINSGAQLKAWRAAAHGAGRQLPAAI 144

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           QVD+G +RLG++  E      ++   +   +  + SHLACAD+P    N  Q   F  L 
Sbjct: 145 QVDSGMSRLGMAPAEVEAVVEDTGAFEGIDVRYVTSHLACADEPRHPANEQQRLAFERLR 204

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           +      ASLA+SSGI LGP YH+ L RPG +LYG     + ++PM  VV  +A++   R
Sbjct: 205 ALLPAAPASLANSSGIFLGPRYHYDLARPGAALYGINPTPDATNPMLPVVGLQAKVAQTR 264

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G  V YG          +A  + GYADG+      L    S + F       +G  
Sbjct: 265 GIEKGTGVGYGHTYHAEGPRSLATISFGYADGW------LRRSASAAWF-------EGVR 311

Query: 307 VPILGKITMDMTMFDITDSLS---IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           +P LG+++MD  + D++ +LS   +  GD +++ GP   +DD A  +GT  Y++L  +GT
Sbjct: 312 LPFLGRVSMDSIILDVS-ALSPGKLREGDLVELLGPAQSVDDAAGHAGTIGYEILASLGT 370

Query: 364 RYAKFY 369
           R+ + Y
Sbjct: 371 RFHRRY 376


>gi|294011685|ref|YP_003545145.1| alanine racemase [Sphingobium japonicum UT26S]
 gi|292675015|dbj|BAI96533.1| alanine racemase [Sphingobium japonicum UT26S]
          Length = 348

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 192/365 (52%), Gaps = 27/365 (7%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL++D  AL +NW  +    G+A   A +K + YGLG  ++   L  AG +DFFV++  
Sbjct: 8   LRLRMDEGALLSNWRWLKRQGGDAACGAAIKADGYGLGAVEVMRRLLGAGCRDFFVSNWA 67

Query: 67  EGVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           E   L  L T    + VL+G+      +   +   PV+ +  Q+  +          P  
Sbjct: 68  EAAVLEPLVTEGVSLSVLHGVREEDLAVALASRARPVLCTEWQIARWRH----AGGGPCD 123

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLG-QLSLIISHLACADDPSSHVNSVQLERFRT 184
           + VDTG NRLGL      D+  +   +  G +++ ++SHLACAD+    ++  QLERF  
Sbjct: 124 VMVDTGMNRLGL------DWRGDVPARLAGLEIATLMSHLACADE-DGPLSPAQLERFSA 176

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           L    K    SLA+S+GI +G +Y F +TRPGI+LYGG  +   +  ++ VV  EA+++ 
Sbjct: 177 LRGQVKAARYSLANSAGICMGADYAFDMTRPGIALYGGVPRREAAGHIRQVVVPEAQVLQ 236

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
            R+  AG+ + Y    +  +D  IAV  +GYADGY    SG  S  +            G
Sbjct: 237 RRRVRAGDTIGYNATYRAPKDMQIAVLNLGYADGYLRCFSGRGSMSA-----------GG 285

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
             +P++G+I+MD+T  D++    I   D++++   D KL D A ASG + Y+LL  +G R
Sbjct: 286 RHLPVVGRISMDLTAVDVSGLPDISEEDWLEV---DYKLVDAAAASGLSQYELLTGLGAR 342

Query: 365 YAKFY 369
           + + +
Sbjct: 343 FDRVW 347


>gi|49474549|ref|YP_032591.1| alanine racemase [Bartonella quintana str. Toulouse]
 gi|49240053|emb|CAF26478.1| Alanine racemase [Bartonella quintana str. Toulouse]
          Length = 372

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 125/364 (34%), Positives = 190/364 (52%), Gaps = 18/364 (4%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID++A+  N+ ++      A  +AVVK NAYGLG +KIAPALY AG + FFV  +EE ++
Sbjct: 21  IDVSAIVANYKTLAQRVAPAECSAVVKANAYGLGADKIAPALYRAGCRIFFVAQIEEALQ 80

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYSKL-MSCGVSHPYALQV 128
           L+   P      L    P   E+ I    ++PV++S   +  + KL        P  +Q+
Sbjct: 81  LKDILPSNVTLALLNGPPHATEEFIAQAGIVPVLNSWNAIENWQKLCQKKDKKFPAIIQI 140

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           DT  NRLGL  +E           +  ++  I+SHLA  DD +   N  QL  F+T+++ 
Sbjct: 141 DTNMNRLGLDKKELQQLIKKPTIFEKAEIKYILSHLANGDDATHSSNYTQLAAFKTVLTQ 200

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP--MQTVVTAEARIILIR 246
                AS A+S GI LGP+++F L RPGI+LY G D   K HP   + V+  EA++I  R
Sbjct: 201 LPTCRASFANSGGIFLGPDFYFDLVRPGIALY-GIDPQGK-HPTLFKPVLKLEAQVIQSR 258

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AG  V Y       R S +   +IGYADG+   LS             G  +  G+ 
Sbjct: 259 SIEAGIPVGYEESFITRRPSTLITISIGYADGWLRILSN-----------KGTVYFNGHK 307

Query: 307 VPILGKITMDMTMFDITD-SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           +PI+G+I+MD    D T+     + GD++++ GP   L  V++ + T  +++L  +G+RY
Sbjct: 308 LPIVGRISMDSMTVDATNLDKKPQSGDWVELIGPHQTLKKVSIDANTIPHEILTSLGSRY 367

Query: 366 AKFY 369
            + Y
Sbjct: 368 QRIY 371


>gi|259416801|ref|ZP_05740721.1| alanine racemase [Silicibacter sp. TrichCH4B]
 gi|259348240|gb|EEW60017.1| alanine racemase [Silicibacter sp. TrichCH4B]
          Length = 345

 Score =  199 bits (506), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 131/364 (35%), Positives = 192/364 (52%), Gaps = 25/364 (6%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RLKI+L AL  NW +++A + +  TAAVVK N YGL   ++  AL  AG ++FFV   EE
Sbjct: 5   RLKINLDALAINWRNLDAKT-SCETAAVVKANGYGLESGRVGKALAQAGARNFFVAIAEE 63

Query: 68  GVKL-RLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           G+ L R   P   I V  G   G  K++ D  L P+++S+ Q+  + + M     HP+ +
Sbjct: 64  GIALRRALGPGPGISVFSGHMEGDAKLLRDFQLTPMLNSLDQMLRHFESMP---GHPFGV 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G NRLG+   E +     + ++      L++SHLACAD+P   +N  QL+ F  + 
Sbjct: 121 QLDSGMNRLGMEAAEWMAVRDIALDQN---PVLLMSHLACADEPGHGMNPYQLKNFIEMT 177

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
                +  SLA++ G+LLG +YHF L RPGI LYGG    + + P   VV  E  +I  R
Sbjct: 178 EGLN-LPRSLAATGGLLLGRDYHFDLCRPGIGLYGGA-PYSDALP---VVELEVPVIQTR 232

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               GE V YG      RD+ IA  A GYADG           H      G   +     
Sbjct: 233 DLAPGESVGYGNTWIAQRDTRIATIAAGYADGL----------HRAFQRQGIMAYAGSTP 282

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
            P++G+I+MD+   DITD    +V  Y+ +      +D +A A+ T  Y++L  +G RYA
Sbjct: 283 CPVVGRISMDLITVDITD--LDDVPPYLSLINEAQTVDVLANAADTIGYEVLTSLGNRYA 340

Query: 367 KFYT 370
           + Y+
Sbjct: 341 RTYS 344


>gi|281500991|pdb|3KW3|A Chain A, Crystal Structure Of Alanine Racemase From Bartonella
           Henselae With Covalently Bound Pyridoxal Phosphate
 gi|281500992|pdb|3KW3|B Chain B, Crystal Structure Of Alanine Racemase From Bartonella
           Henselae With Covalently Bound Pyridoxal Phosphate
          Length = 376

 Score =  199 bits (506), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 120/362 (33%), Positives = 188/362 (51%), Gaps = 14/362 (3%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID+ A+  N+ ++         +AVV  NAYGLG  KIAPALY AG + FFV  +EE ++
Sbjct: 25  IDVRAIVANYRTLAQHVAPTECSAVVXANAYGLGAHKIAPALYQAGCRTFFVAQIEEALQ 84

Query: 71  LRLYTPQ-ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL-MSCGVSHPYALQV 128
           L+   P+   I +L G     E+ +  + +IP+++S   +  +  L        P  +QV
Sbjct: 85  LKAVLPENVMIALLNGFPHKAEEFVAQSGIIPLLNSWSTIEDWQTLCQKKNKKFPAIIQV 144

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           DT  +RLGL  +E      N    +  ++  I+SHLA  +D S   N+ QL  F+ +++ 
Sbjct: 145 DTNMSRLGLDKKELQKLIKNPTIFEKAEIKYILSHLANGEDASHSSNNKQLAAFKRVLAQ 204

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKA 248
               + S A+S GI LG +++F L RPGI+LYG         P++ VV  EA+++  R  
Sbjct: 205 LPTCKVSFANSGGIFLGSDFYFDLVRPGIALYGVDPHGKHPTPLKAVVKVEAQVLQSRFI 264

Query: 249 LAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVP 308
            AG  V Y       R S +A  +IGYADG+P  LS             G  +  G+ +P
Sbjct: 265 DAGIPVGYRESFMTRRPSTLATISIGYADGWPRILSN-----------KGTVYFNGHKLP 313

Query: 309 ILGKITMDMTMFDITD-SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           I+G I+MD  + D TD     + GD++++ GP   L+ V+  + T  +++L  +G RY +
Sbjct: 314 IVGHISMDSIIVDATDLDKKPQRGDWVELIGPHQPLEKVSTDTNTIPHEILTSLGKRYKR 373

Query: 368 FY 369
            Y
Sbjct: 374 IY 375


>gi|260426149|ref|ZP_05780128.1| alanine racemase [Citreicella sp. SE45]
 gi|260420641|gb|EEX13892.1| alanine racemase [Citreicella sp. SE45]
          Length = 351

 Score =  199 bits (505), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 128/365 (35%), Positives = 196/365 (53%), Gaps = 28/365 (7%)

Query: 8   RLKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           +L IDL A++ NW ++ NA +G A   AVVK + YGLG  ++APAL   G + FFV +  
Sbjct: 11  QLTIDLAAIRANWRALANATTGEA--GAVVKADGYGLGVARVAPALAAEGARRFFVATAH 68

Query: 67  EGVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           EG+ +R        I V  G   G  +II D  L P+++S+ Q+  + + +     H + 
Sbjct: 69  EGIAVRRALGAGPEICVFSGHMNGDAEIIRDHRLTPMLNSIDQMLRHVEALP---GHSFG 125

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +Q+D+G NRLG+   E       +  +K     LI+SHLACAD+PS  +N+ QL  FR +
Sbjct: 126 IQLDSGMNRLGMEPAEWSALREIALAQKP---VLIMSHLACADEPSHGMNAFQLRTFREM 182

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
                 +  SL+++ GILLGP+YHF+LTRPG+ +YGG    +     + VV     +I +
Sbjct: 183 TDGLD-VPRSLSATGGILLGPDYHFELTRPGVGIYGGQPFADA----RAVVELMLPVIQV 237

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    GE V YG        + +A  A GYADG    L+      +      G    K  
Sbjct: 238 RDVAPGESVGYGNAHVARVPTRVATVAAGYADGIHRALA------AKGAVWAGDTRCK-- 289

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
              I+G+++MD+   D+T +L+ +V + +++ G    +D VA A GT  Y++L  +G RY
Sbjct: 290 ---IIGRVSMDLITVDVT-ALN-KVPEQLELLGRHQTVDMVADAVGTIGYEILTGLGARY 344

Query: 366 AKFYT 370
           A+ YT
Sbjct: 345 ARAYT 349


>gi|163732015|ref|ZP_02139461.1| alanine racemase [Roseobacter litoralis Och 149]
 gi|161394313|gb|EDQ18636.1| alanine racemase [Roseobacter litoralis Och 149]
          Length = 344

 Score =  199 bits (505), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 131/363 (36%), Positives = 192/363 (52%), Gaps = 26/363 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL+AL  NW ++NA S ++ TAAVVK NAYGLG    A  L  AG + FFV   EEG
Sbjct: 6   LTIDLSALAANWRNLNARS-DSETAAVVKANAYGLGLRTAASVLAQAGARHFFVAVAEEG 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             LR +     +I V  G   G   +I D  L P+I+S+ QL  + + +     H + +Q
Sbjct: 65  AALREVLGTGPQISVFSGHMEGDTPLIRDAGLTPMINSIDQLIRHVEALP---DHDFGIQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLG+   E       +  +     SL++SHLACAD+PS  +N  QL+ F  + +
Sbjct: 122 LDTGMNRLGMEDAEWRSVREVATQRPP---SLVMSHLACADEPSHQMNRQQLDCFIEM-T 177

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
           H      SLA++ G+L+G +YHF LTRPGI LYGG   ++       VV  +  +I +R 
Sbjct: 178 HDISAPRSLAATGGLLMGSDYHFDLTRPGIGLYGGLPFVDA----LPVVQLDVPVIQVRD 233

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V Y         + IA  + GYADG    +    + H+  V            V
Sbjct: 234 VHPGETVGYANTWTAAAPARIATISAGYADGLIRAMGAKANLHAGDV-----------AV 282

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           P++G+++MD+   D+T +LS +  + +Q+ G    +D VA  + T  Y++L  +G RY +
Sbjct: 283 PVVGRVSMDLIGVDVT-ALSADP-ESLQLIGRHQSVDTVADFADTIGYEILTSLGERYKR 340

Query: 368 FYT 370
            YT
Sbjct: 341 VYT 343


>gi|240851017|ref|YP_002972417.1| alanine racemase [Bartonella grahamii as4aup]
 gi|240268140|gb|ACS51728.1| alanine racemase [Bartonella grahamii as4aup]
          Length = 371

 Score =  198 bits (504), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 118/363 (32%), Positives = 193/363 (53%), Gaps = 14/363 (3%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID++A+  N+ ++       + +AVVK NAYGLG  KIAPALY AG + FFV  + E ++
Sbjct: 20  IDVSAIVANYITLAKRVAPTQCSAVVKANAYGLGAHKIAPALYQAGCRTFFVAQIIEALQ 79

Query: 71  LRLYTP-QARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL-MSCGVSHPYALQV 128
           L+   P    I VL G+    E+ +  + ++PV++S   +  + K+        P  +Q+
Sbjct: 80  LKSILPSHVTIAVLNGLPHLAEEFVAQSGIVPVLNSWSAIENWQKICQKKDKKFPAIVQI 139

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           DT  NRLGL  +E      +    +  ++  I+SHL+  +D +   N  QL  F+T+++ 
Sbjct: 140 DTHMNRLGLDQKELQKLIKHPTIFEKAEIKYILSHLSNGEDDTHPSNYAQLATFKTVLAQ 199

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKA 248
               + S A+S GI LG +++F L RPGI+LYG   +     P++ V+  EA++I  R  
Sbjct: 200 LPACKVSFANSGGIFLGSDFYFDLVRPGIALYGVDPRGKHPSPLKPVLKLEAQVIQNRVV 259

Query: 249 LAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVP 308
             G  V YG      R S +A  +IGYADG+   LS             G  +  GY +P
Sbjct: 260 DIGTPVGYGESFITNRPSTLATISIGYADGWLRALSN-----------KGTVYFNGYKLP 308

Query: 309 ILGKITMDMTMFDITD-SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           ++G+++MD  + D TD     + GD++++ GP   L+ V++ + T   ++L  +G+RY  
Sbjct: 309 MVGRVSMDSIIVDTTDLDQKPQTGDWVELIGPHQTLERVSIDADTLPNEILTSLGSRYKY 368

Query: 368 FYT 370
            YT
Sbjct: 369 IYT 371


>gi|114769303|ref|ZP_01446929.1| alanine racemase [alpha proteobacterium HTCC2255]
 gi|114550220|gb|EAU53101.1| alanine racemase [alpha proteobacterium HTCC2255]
          Length = 351

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 136/370 (36%), Positives = 192/370 (51%), Gaps = 41/370 (11%)

Query: 9   LKIDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           LKID  A+ NNW S++  S  N  TAAV+K +AYGL  + IA  L    V+ FFV   EE
Sbjct: 11  LKIDTNAIYNNWQSLDKKSAKNVETAAVIKADAYGLSTKNIASYLAFKNVKTFFVAIAEE 70

Query: 68  GVKLRLYT-PQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           G+  R      A IFV  G       II + NLIP+++S  Q   Y +      +  + +
Sbjct: 71  GIGARKAVGNDADIFVFSGQMENDAAIIKEYNLIPLLNSADQ---YHQFQINSPNQKFGI 127

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+DTG NRLG+   E ++F+  S ++ +    LI+SHLACAD+P+   N  QL  F  L 
Sbjct: 128 QLDTGMNRLGM---EGIEFS--SLDENMSNACLIMSHLACADEPNHSQNLKQLRTFHHLT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQT---VVTAEARII 243
              K I  SL+++ GILLGP YHF L RPGI LYGG        P  T   V+     +I
Sbjct: 183 DDLK-IRKSLSATGGILLGPEYHFDLCRPGIGLYGGL-------PYDTALPVIKLSIPVI 234

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
             R   AGE V YGGQ +   D+ +A  + GYADG    +          ++ G  G   
Sbjct: 235 QSRTVFAGETVGYGGQWRAKTDTRVATISAGYADGLIRAI----GNGQLLLYHGDVG--- 287

Query: 304 GYMVPILGKITMDMTMFDITD----SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
               P++G+++MD+   DIT       S+++ + IQ       +D +A A+ T  Y++L 
Sbjct: 288 ---CPLIGRVSMDLITVDITQLEDTPRSLDLINKIQ------TVDIIANAANTIGYEILT 338

Query: 360 RIGTRYAKFY 369
            +G RYA+ Y
Sbjct: 339 SLGARYAREY 348


>gi|258543551|ref|YP_003188984.1| alanine racemase [Acetobacter pasteurianus IFO 3283-01]
 gi|256634629|dbj|BAI00605.1| alanine racemase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637685|dbj|BAI03654.1| alanine racemase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640739|dbj|BAI06701.1| alanine racemase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643794|dbj|BAI09749.1| alanine racemase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646849|dbj|BAI12797.1| alanine racemase [Acetobacter pasteurianus IFO 3283-26]
 gi|256649902|dbj|BAI15843.1| alanine racemase [Acetobacter pasteurianus IFO 3283-32]
 gi|256652892|dbj|BAI18826.1| alanine racemase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655946|dbj|BAI21873.1| alanine racemase [Acetobacter pasteurianus IFO 3283-12]
          Length = 381

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 125/367 (34%), Positives = 191/367 (52%), Gaps = 17/367 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L ++L+A+  N+  + +  G    AAVVK +AYGLG  ++AP L  AG + FFV  V+EG
Sbjct: 24  LTVNLSAIAENYRYLKSRLGKTACAAVVKADAYGLGVAQVAPVLEKAGAEHFFVAHVDEG 83

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YA 125
           + LR + +P   + VL+G  P   ++    NL PV++S+ Q+     L +  +  P   A
Sbjct: 84  LALRPFLSPHTSVTVLHGPRPDAAEVCVRNNLRPVLNSLEQVAVLRDL-AAKMDKPLDVA 142

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +Q+DTG +R GLS  +      +    K   +SL++SHLACAD P +  N++Q ERF   
Sbjct: 143 IQLDTGMSRFGLSEADIHKLVASPELLKGLFVSLVMSHLACADTPQNPANTMQRERFEAY 202

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
                    SL++SSGI LGP +HF L RPG +LYG   +    +P++ VV  +A I+ I
Sbjct: 203 ARILPQAALSLSASSGIFLGPQFHFDLVRPGAALYGVAPQNEGDNPLKPVVGLQAHILQI 262

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    G+ V YG   +      +A  A GYA              + +    G  + KGY
Sbjct: 263 RHLSKGDRVGYGLTWQAHGPCRVATIATGYA-----------DGFARAGAAAGCAWYKGY 311

Query: 306 MVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            +PILG+I+MD    D++      +E    +++      +D VA A GT  Y++L  +G 
Sbjct: 312 RLPILGRISMDSMTVDLSAVPEGLLEEDSMVELLNESYGVDAVAKAEGTIGYEVLTSLGR 371

Query: 364 RYAKFYT 370
           RY + Y 
Sbjct: 372 RYHRVYA 378


>gi|56552488|ref|YP_163327.1| alanine racemase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|260753846|ref|YP_003226739.1| alanine racemase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|56544062|gb|AAV90216.1| alanine racemase [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258553209|gb|ACV76155.1| alanine racemase [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 349

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 121/369 (32%), Positives = 188/369 (50%), Gaps = 23/369 (6%)

Query: 1   MHSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDF 60
           M  +  LRL++D +AL  NW S+N ++      A +K N YGLG E++   L  AG +DF
Sbjct: 1   MQISSPLRLELDKSALMANWQSLNRITAG-HCGAAIKANGYGLGAERVRHYLAQAGCRDF 59

Query: 61  FVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGV 120
           FV+S +E   L        + VL+G+         ++++ PV+ S   +   ++  +   
Sbjct: 60  FVSSWDEARLLDSSEKDFSLSVLHGLREDDLGYALNSSVKPVLCSPAMI---ARWKAHAP 116

Query: 121 SHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLE 180
           + P  + VDTG NRLGLS++EA     +  +     +  I+SHLACAD+    +N  QLE
Sbjct: 117 NRPCDVMVDTGMNRLGLSMEEAGSGLLDGLS-----IDNILSHLACADEADHPLNQKQLE 171

Query: 181 RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEA 240
           RFR L +  +    SLA+S+GI L  +YHF L RPG++LYGG         ++ VV   A
Sbjct: 172 RFRILAARKQAKRYSLANSAGIFLSKDYHFDLARPGLALYGGLPVPQSKDILKPVVAIAA 231

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
           + I +R+  AGE + YG      +   +A+  +GYADGY             + F  G  
Sbjct: 232 QAIQVREVSAGEAIGYGACFVTPKKMRVAILHVGYADGY-----------WRAFFEKGHA 280

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
              G + P+ G+++MDM    + D L+   GD+   F  D  L   +  +G + Y+LL  
Sbjct: 281 RKDGVICPLAGRVSMDMITVALPDVLTAHEGDW---FSVDFDLPSASQQTGLSQYELLTG 337

Query: 361 IGTRYAKFY 369
           +G RY   +
Sbjct: 338 LGHRYQSVW 346


>gi|157803277|ref|YP_001491826.1| alanine racemase [Rickettsia canadensis str. McKiel]
 gi|166969427|sp|A8EXF8|ALR_RICCK RecName: Full=Alanine racemase
 gi|157784540|gb|ABV73041.1| alanine racemase [Rickettsia canadensis str. McKiel]
          Length = 355

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 130/367 (35%), Positives = 191/367 (52%), Gaps = 23/367 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L I+L+A+KNN+  +  +   +   AVVK + YGLG  +I+ AL     + FFV S EEG
Sbjct: 6   LAINLSAIKNNYFLLQDICKTSLVGAVVKADGYGLGAVQISKALIEENCRHFFVASSEEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYAL 126
           V +R        I VL G+       + + NLIP+++++ Q+  + +  +   +  P  L
Sbjct: 66  VNVRKALGIDVNILVLNGVFEHDALELIEYNLIPILNNLKQIEIWQQFGNLKNLLLPCYL 125

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
             +TG NRLGLS  E     +N    K   L  IISHLA +++  +  N  QL +F+  +
Sbjct: 126 HFNTGINRLGLSSNEIEQLINNRDLLKGLNLQYIISHLAISEEIDNPYNLEQLNKFKAYL 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP-MQTVVTAEARIILI 245
            ++  I+ASLA+S GI LG +YHF L RPG +LYG        +P MQ  VT +A II +
Sbjct: 186 RYFPSIKASLANSGGIFLGQDYHFDLVRPGAALYG-------LNPLMQNPVTLKAPIIHL 238

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           +       + Y       RDS+IA   +GYADGY    S             GK FI G 
Sbjct: 239 QNLTLDSHIGYNMTFTTKRDSVIATLPLGYADGYSRNFSN-----------QGKVFINGR 287

Query: 306 MVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            VPI+G+++MD+   D+TD     I +G  ++I G     D +A   GT  Y++L  +G 
Sbjct: 288 SVPIVGRVSMDLINIDVTDLPPSDIFLGQEVEIIGNHCTPDKIASIIGTIGYEVLTSLGN 347

Query: 364 RYAKFYT 370
           RY + YT
Sbjct: 348 RYRRKYT 354


>gi|83952042|ref|ZP_00960774.1| alanine racemase [Roseovarius nubinhibens ISM]
 gi|83837048|gb|EAP76345.1| alanine racemase [Roseovarius nubinhibens ISM]
          Length = 345

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 190/362 (52%), Gaps = 26/362 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A   NW +++A + +  TAAVVK +AYGLG +K+A AL  AG + FFV   EEG
Sbjct: 6   LTIDLNAAVANWRALDAKT-DCETAAVVKADAYGLGADKLARALARAGARSFFVAVAEEG 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             LR    P   I V  G  PG   +I D  L P+I+S+ Q+  + + +     H + LQ
Sbjct: 65  AALRQALGPGPNICVFSGHMPGDADMIGDLELTPMINSLDQMIRHVEALP---GHAFGLQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLG+   E       +  +      LI+SHLACAD+P   +N+ QL  FR +  
Sbjct: 122 LDTGMNRLGMEPSEWAAVRDVALAQN---PVLIMSHLACADEPDHPMNAQQLRTFREMTD 178

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
               +  SLA++ G+LLG +YHF L RPGI  YGG       H    V T +  +I  R 
Sbjct: 179 GLD-VPRSLANTGGVLLGRDYHFDLCRPGIGTYGGAPFAEARH----VATLDIPVIQCRD 233

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V YG     +R + IA  + GYADG    +        P   L    +  G  +
Sbjct: 234 VAPGETVGYGNSYVASRPTRIATISAGYADGILRAM-------GPKTGL----WCDGKRL 282

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           PI G+I+MD+   D+T +L  +    +Q+ GP+  +D +A A+GT  Y++L  +G RY +
Sbjct: 283 PIAGRISMDLIGVDVT-ALGQDP-KSLQLLGPNQGVDTLADAAGTIGYEILTSLGARYTR 340

Query: 368 FY 369
            Y
Sbjct: 341 RY 342


>gi|148255205|ref|YP_001239790.1| putative alanine racemase (alr) [Bradyrhizobium sp. BTAi1]
 gi|146407378|gb|ABQ35884.1| putative alanine racemase (alr) [Bradyrhizobium sp. BTAi1]
          Length = 394

 Score =  196 bits (499), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 125/367 (34%), Positives = 185/367 (50%), Gaps = 15/367 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  NW  +   +  A  A V+K +AYG G  ++A  L  AG + FFV ++ E 
Sbjct: 28  LTIDLDALAANWRKLEKTAVPAECAGVIKADAYGCGIPQVARTLAAAGCKTFFVATLSEA 87

Query: 69  VKLRLYTPQ-ARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC---GVSHPY 124
              R   P  A ++VL G      +     N  PVI  + +L  +   M C   G     
Sbjct: 88  KVARTALPDSAALYVLDGFFQNTGEDYAAINCRPVIGDLNELAEWD--MFCRRTGWKGGA 145

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           A+ VDTG NRLG +  +A        +   G ++LI+SHLA A+  +S  N+ QL  FR 
Sbjct: 146 AIHVDTGMNRLGFTPTDAQGMIPRIQSGDHG-ITLIMSHLASAEQLNSPSNARQLSLFRE 204

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           + S + G+ A+LA+SSGI LG  + F + RPG +LYG        +PMQ V   +ARI+ 
Sbjct: 205 VASVFTGVPAALAASSGIFLGAAFQFDMVRPGAALYGINPTPEADNPMQPVAEIKARIVQ 264

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R    G+ V YGG     R + IA+ + GYADGY    S  D      V + G+     
Sbjct: 265 LRDLARGDTVGYGGTWTARRPTKIAILSAGYADGYFRAASSNDGTRGADVVIAGQ----- 319

Query: 305 YMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
              P+ G+++MD+   D+TD    +   G +  + G  I +D++A   GT  Y+++  +G
Sbjct: 320 -RCPVAGRVSMDLIAVDVTDLPPKAARRGHFATLLGEGITVDELAHHFGTIGYEVMTNLG 378

Query: 363 TRYAKFY 369
            RY + Y
Sbjct: 379 RRYHRIY 385


>gi|86137544|ref|ZP_01056121.1| alanine racemase [Roseobacter sp. MED193]
 gi|85825879|gb|EAQ46077.1| alanine racemase [Roseobacter sp. MED193]
          Length = 345

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 132/366 (36%), Positives = 193/366 (52%), Gaps = 31/366 (8%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL I+L AL  NW ++NA++ N  TAAVVK N YGL   ++A AL   G ++FFV + EE
Sbjct: 5   RLTINLDALVTNWQNLNAMT-NCETAAVVKANGYGLDAARVATALAKGGARNFFVAAAEE 63

Query: 68  GVKL-RLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           GV L R   P   I V  G   G  +++ +  L P+++S+ Q+  + + +     H + +
Sbjct: 64  GVALRRALGPGPGISVFSGHMEGDTRLLKEFQLAPMLNSLDQMLRHFETLP---GHTFGV 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLS-LIISHLACADDPSSHVNSVQLERFRTL 185
           Q+D+G NRLG+   E         +  LGQ   L++SHLAC+D+P   +N+ QL+ FR +
Sbjct: 121 QLDSGMNRLGMEPAEWAAVR----DIALGQAPVLLMSHLACSDEPGHPMNAQQLQAFREM 176

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
               + +  SLA++ GILLG +YHF L RPG+ LYGG      + P   VV  +  +I  
Sbjct: 177 TDGLE-VPRSLAATGGILLGRDYHFDLCRPGVGLYGGA-PYGDAMP---VVQLDLPVIQT 231

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGY--PLTLSGLDSEHSPSVFLGGKGFIK 303
           R    GE V YG        S IA  A GYADG    L   G+D             F  
Sbjct: 232 RDVAPGESVGYGNSWVAQVPSRIATVAAGYADGLHRALMTGGIDL------------FAG 279

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
               P++G+I+MD+   D+T +L  E    + I      +D +A A+GT  Y++L  +G 
Sbjct: 280 EARCPVVGRISMDLVTVDVT-ALP-ETPASLSILNEVQTVDTLANAAGTIGYEMLTSMGH 337

Query: 364 RYAKFY 369
           RYA+ Y
Sbjct: 338 RYARTY 343


>gi|126727196|ref|ZP_01743033.1| alanine racemase [Rhodobacterales bacterium HTCC2150]
 gi|126703624|gb|EBA02720.1| alanine racemase [Rhodobacterales bacterium HTCC2150]
          Length = 348

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 191/363 (52%), Gaps = 26/363 (7%)

Query: 9   LKIDLTALKNNWHSMNALS-GNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           LKIDL A+  NW +++A+S G+  TAAVVK +AYGLG   +A  L  AG   FFV + EE
Sbjct: 6   LKIDLNAIARNWRALDAMSAGDVETAAVVKADAYGLGIGPVAKILAKAGAHTFFVATAEE 65

Query: 68  GVKLRL-YTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           G   R+     A I V  G   G    I D +L+P+++S+ QLT + + +    S  + +
Sbjct: 66  GAAARVALGNDAIINVFSGHMAGDTTTIRDFHLMPMVNSIEQLTRHLENLP---SFQFGI 122

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G NRLG+   E       + +      +LI+SHLACADDP+   N+ QL +FR + 
Sbjct: 123 QLDSGMNRLGMEPHEWSAVASLALSSD---PTLIMSHLACADDPAHPQNADQLSQFRAIT 179

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           +    +  SLA++ G LLGP +HF +TRPG+ LYGG    +     Q VV     +I  R
Sbjct: 180 AGLD-VPLSLAATGGTLLGPAFHFSMTRPGVGLYGGFPYSDA----QAVVRLSLPVIQTR 234

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
           +   GE V Y    +  R S IA  + GYADG    LS      + ++   G        
Sbjct: 235 EVAVGETVGYSASWRAERPSKIATLSAGYADGITRALS------NAAILYAGD-----TP 283

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
            P+ G+++MD+   D+  S   ++  ++ +  P   +D VA   GT  Y++L  +G RY 
Sbjct: 284 CPLAGRVSMDLLTVDV--SHLDQMPSHLDLLCPAQTVDQVAELGGTIGYEILTSLGHRYE 341

Query: 367 KFY 369
           + Y
Sbjct: 342 RQY 344


>gi|329890838|ref|ZP_08269181.1| alanine racemase [Brevundimonas diminuta ATCC 11568]
 gi|328846139|gb|EGF95703.1| alanine racemase [Brevundimonas diminuta ATCC 11568]
          Length = 378

 Score =  196 bits (498), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 129/368 (35%), Positives = 200/368 (54%), Gaps = 17/368 (4%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           R+ + L A+  N+ +M      A  AAVVK +AYGLG  +IAPALY+AG + FFV  + E
Sbjct: 22  RIHVSLRAVAANYRAMCDQVAPAACAAVVKADAYGLGAARIAPALYDAGCRAFFVAHLFE 81

Query: 68  GVKLRLYTP-QARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL-MSCGVSHPYA 125
            V LR   P  A +FVL G+ PG E        IPV++S  Q+  +++L  + G     A
Sbjct: 82  AVDLRRVLPADAELFVLNGLAPGAEYAALAAGAIPVLNSREQVEGWARLGRAVGRPLAAA 141

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +Q DTG +RLGL  ++A          +  +  LI+SHLA AD P    N+ Q + F  +
Sbjct: 142 IQFDTGMSRLGLPPEDAAWAFAPEGPIRWIEPRLILSHLAVADTPGHAGNARQRQAFERI 201

Query: 186 ISHY-KGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           ++H  +G+  SLA+S+G  LG +YH+ L R G +L+ G D  + +  MQ VV    R+I 
Sbjct: 202 LAHAPQGVARSLANSAGCWLGQDYHYDLCRVGAALF-GLDASSSAKAMQPVVEVTGRVIQ 260

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
            R   AG  V YG          +A   +GYADG+P  LS           +GG  F +G
Sbjct: 261 TRAVPAGAGVGYGWAVTAAEGMRLATIGVGYADGWPRQLSA----------VGGAAF-EG 309

Query: 305 YMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            ++P +G+I+MD  + D++     +++ GD++++ GP+   + +AL   T +Y+++ R+G
Sbjct: 310 RLLPFVGRISMDSLVVDVSALPPDALKPGDHVELLGPNRPPEQLALEGATIDYEVIARLG 369

Query: 363 TRYAKFYT 370
            R  + Y 
Sbjct: 370 RRLCREYV 377


>gi|300313242|ref|YP_003777334.1| alanine racemase [Herbaspirillum seropedicae SmR1]
 gi|300076027|gb|ADJ65426.1| alanine racemase protein [Herbaspirillum seropedicae SmR1]
          Length = 368

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 124/379 (32%), Positives = 196/379 (51%), Gaps = 23/379 (6%)

Query: 1   MHSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDF 60
           M +     L IDL A+  NW +++A    AR  AVVK +AYGLG   +  AL +AG ++F
Sbjct: 1   MSTQPTASLTIDLPAIVANWKTLSARVAPARCGAVVKADAYGLGATMVVRALLDAGCREF 60

Query: 61  FVTSVEEGVKLR-----LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTF---Y 112
           FV  V EGV L+      +   AR+ +L G  PG E +     L PV++S+ Q+     Y
Sbjct: 61  FVALVSEGVSLKQTLADRWPKGARLHILNGTLPGDELLCLHYGLTPVLNSLEQVRSWQGY 120

Query: 113 SKLMSCGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSS 172
           ++ +   ++   ALQVDTG  RLGL+  E    T +         + ++SHL  A++ ++
Sbjct: 121 ARQLDFPLA--AALQVDTGMARLGLAPAEVAQLTESRAGLAGIAPTFLMSHLVSAEETAN 178

Query: 173 HVNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM 232
            +N  QLERF  +  H+  I   LA+SSGI LG ++HF   RPG +LYG        +PM
Sbjct: 179 PLNQHQLERFVAIRRHWPEIAGCLANSSGIFLGADFHFGCVRPGAALYGVHPGGAGPNPM 238

Query: 233 QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP 292
           + V+  +A +I  R+  AGE V Y    + +R + +   A+GYADGY      L S  + 
Sbjct: 239 RPVLRLQAPLIQWRELQAGESVGYNHTWQASRPTRVGTIALGYADGY------LRSASNR 292

Query: 293 SVFLGGKGFIKGYMVPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALAS 350
            V       ++G   P++G+++MD    D++  D   +  G    +      ++ +A+ +
Sbjct: 293 GVL-----RLEGVEAPLIGRVSMDSITVDLSAIDPARLRPGLLFDVLDAQQDINALAVQA 347

Query: 351 GTTNYDLLVRIGTRYAKFY 369
           GT  Y++L  +  RY + Y
Sbjct: 348 GTNAYEILTSLRHRYRRHY 366


>gi|329113263|ref|ZP_08242046.1| Alanine racemase, catabolic [Acetobacter pomorum DM001]
 gi|326697404|gb|EGE49062.1| Alanine racemase, catabolic [Acetobacter pomorum DM001]
          Length = 381

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 127/370 (34%), Positives = 196/370 (52%), Gaps = 23/370 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L ++L+A+  N+  + +  G    AAVVK +AYGLG  ++AP L  AG + FFV  V+EG
Sbjct: 24  LTVNLSAIAENYRYLKSRLGKTVCAAVVKADAYGLGVAQVAPVLEKAGAEHFFVAHVDEG 83

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YA 125
           + LR Y +    + VL+G  P   ++    NL PV++S+ Q+    +L +  +  P   A
Sbjct: 84  LALRPYLSSTTSVTVLHGPRPDAAEVCVRNNLRPVLNSLEQIAVLREL-AAKIDKPLDVA 142

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQ---LSLIISHLACADDPSSHVNSVQLERF 182
           +Q+DTG +R GLS  EA D    + + +L +   +SL++SHLACAD P +  N++Q ERF
Sbjct: 143 IQLDTGMSRFGLS--EA-DIHKLAVSPELLEGLSVSLVMSHLACADTPKNPANTMQRERF 199

Query: 183 RTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARI 242
                       SL++SSGI LG  + F L RPG +LYG   +    +P++ VV  +A I
Sbjct: 200 EAYARMLPKATLSLSASSGIFLGSQFQFDLVRPGAALYGVAPQNEGENPLKPVVGLQAHI 259

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           + IR    G+ V YG   +      +A  A GYA              + +    G  + 
Sbjct: 260 LQIRHLSKGDRVGYGLTWQAHGPCRVATIATGYA-----------DGFARAGAAAGCAWY 308

Query: 303 KGYMVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
           KGY +PILG+I+MD    D+++     +E    +++      +D VA A GT  Y++L  
Sbjct: 309 KGYRLPILGRISMDSMTVDLSEVPEGLLEEDSMVELLNASYGVDAVAKAEGTIGYEVLTS 368

Query: 361 IGTRYAKFYT 370
           +G RY + YT
Sbjct: 369 LGRRYHRVYT 378


>gi|163868814|ref|YP_001610040.1| hypothetical protein Btr_1758 [Bartonella tribocorum CIP 105476]
 gi|161018487|emb|CAK02045.1| Alanine racemase [Bartonella tribocorum CIP 105476]
          Length = 371

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 119/363 (32%), Positives = 188/363 (51%), Gaps = 14/363 (3%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID++A+  N+ ++         +AVVK NAYGLG  KIAPALY AG + FFV  + E + 
Sbjct: 20  IDVSAIVANYITLAKRVAPTECSAVVKANAYGLGAHKIAPALYQAGCRTFFVAQIREALH 79

Query: 71  LRLYTP-QARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL-MSCGVSHPYALQV 128
           L+   P    I +L G+    E+ +  + ++PV++S   +  + K+        P  +Q+
Sbjct: 80  LKSILPSNVMIALLNGLPHLAEEFVAQSGIVPVLNSWNAIENWQKICQKKDKKFPAIVQI 139

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           DT  NRLGL  +E           +   +  I+SHLA  +D +   N  QL  F+T+++ 
Sbjct: 140 DTHMNRLGLDQKELQKLIKRPTIFENANIKYILSHLANGEDNTHPSNDAQLTSFKTILAQ 199

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKA 248
                AS A+S GI LG +++F L RPGI+LYG       +  ++ V+  EA+++  R  
Sbjct: 200 LPPCRASFANSGGIFLGSDFYFDLVRPGIALYGSDPSGKHASLLKPVLRLEAQVLQNRVV 259

Query: 249 LAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVP 308
             G  V YG     +R S +A  +IGYADG+   LS             G  +  GY +P
Sbjct: 260 DIGTPVGYGETFITSRPSTLATISIGYADGWLRALSN-----------KGTVYFNGYKLP 308

Query: 309 ILGKITMDMTMFDITD-SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           ++G+++MD  + D TD     + GD+I++ GP   L+ VA  + T   ++L  +G+RY  
Sbjct: 309 MVGRVSMDSIIVDTTDLDQKPQTGDWIELIGPHQTLEKVATDANTLPNEILTSLGSRYRY 368

Query: 368 FYT 370
            YT
Sbjct: 369 IYT 371


>gi|110680421|ref|YP_683428.1| alanine racemase [Roseobacter denitrificans OCh 114]
 gi|123361723|sp|Q163V1|ALR_ROSDO RecName: Full=Alanine racemase
 gi|109456537|gb|ABG32742.1| alanine racemase [Roseobacter denitrificans OCh 114]
          Length = 344

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 189/365 (51%), Gaps = 30/365 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL+AL  NW S+NALS +  TAAVVK NAYGLG    A AL  AG + FFV   EEG
Sbjct: 6   LTIDLSALAANWRSLNALS-DVETAAVVKANAYGLGVGTAASALAEAGARHFFVAVAEEG 64

Query: 69  VKLRLYT---PQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           V LR      PQ  +F   G   G   +I D  L P+I+S+ Q+  + + +     H + 
Sbjct: 65  VALRQALGAGPQISVF--SGHMAGDTALIRDAGLTPMINSIDQMIRHVEALP---EHDFG 119

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +Q+DTG NRLG+   E       +  +     SL++SHLACAD+PS  +N  QL+ F  +
Sbjct: 120 IQLDTGMNRLGMEDGEWRAVREVATQRPP---SLVMSHLACADEPSHQMNRQQLDCFVEM 176

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
                    SLA++ GIL+GP+YHF LTRPGI LYGG   ++       VV  +  +I +
Sbjct: 177 TQDITAPR-SLAATGGILMGPDYHFDLTRPGIGLYGGLPFVDA----LPVVQLDVPVIQV 231

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    GE V Y      T  + IA  + GYADG    +      H+    L         
Sbjct: 232 RDVHPGETVGYANTWTATAPARIATISAGYADGLIRAMGAKARLHAGDTAL--------- 282

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
             P++G+++MD+   D+T   S    D +Q+ G    +D VA  + T  Y++L  +G RY
Sbjct: 283 --PVVGRVSMDLIGVDVTALGSDP--DSLQLIGRHQSVDTVAGFADTIGYEILTSLGDRY 338

Query: 366 AKFYT 370
            + YT
Sbjct: 339 KRVYT 343


>gi|85703131|ref|ZP_01034235.1| alanine racemase [Roseovarius sp. 217]
 gi|85672059|gb|EAQ26916.1| alanine racemase [Roseovarius sp. 217]
          Length = 345

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 130/362 (35%), Positives = 185/362 (51%), Gaps = 26/362 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NW +++A++    TAAVVK +AYGLG  K+A +L  AG + FFV   EEG
Sbjct: 6   LTIDLDAITANWRALDAMTAG-ETAAVVKADAYGLGAAKVARSLARAGARHFFVAVAEEG 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             LR        I+V  G  PG   +I D +L P+I+S+ Q+  + + +     HP+ +Q
Sbjct: 65  AALRDTLGSGPAIYVFSGHMPGDADMIGDMHLTPMINSLEQMIRHVESLP---GHPFGIQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +D+G NRLG+   E       +  +      LI+SHLACAD+    +N  QL  FR +  
Sbjct: 122 LDSGMNRLGMEPGEWAALRDIALAQ---DPRLIMSHLACADESDHAMNPQQLATFREMTD 178

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
               +  SLA++ GILL   YHF L RPGI LYGG          + VVT +  +I  R 
Sbjct: 179 GLD-VPRSLANTGGILLDAAYHFDLARPGIGLYGGRPFAEA----RAVVTLDIPVIQCRD 233

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE V Y       R++ IA  A GYADG    +        P   L    + +    
Sbjct: 234 LAPGETVGYANGFTAPRETRIATVAAGYADGILRAM-------GPKTSL----WAEDIPC 282

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
           PI G+I+MD+   DITD L  +    +Q+ GP   +D +A  + T  Y++L  +G RY +
Sbjct: 283 PIAGRISMDLICVDITD-LGHDP-KSLQLLGPYQSIDTLADHADTIGYEILTSLGARYTR 340

Query: 368 FY 369
            Y
Sbjct: 341 RY 342


>gi|159044921|ref|YP_001533715.1| alanine racemase [Dinoroseobacter shibae DFL 12]
 gi|226711041|sp|A8LRT3|ALR_DINSH RecName: Full=Alanine racemase
 gi|157912681|gb|ABV94114.1| alanine racemase [Dinoroseobacter shibae DFL 12]
          Length = 349

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 131/366 (35%), Positives = 183/366 (50%), Gaps = 30/366 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNAR--TAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           L IDL A+  NW +++  S N R  T AVVK + YGL   ++A  L  AG + FFV   E
Sbjct: 6   LSIDLDAIAANWRALDRAS-NRRVATGAVVKADGYGLDAGRVARTLAQAGARQFFVAVAE 64

Query: 67  EGVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           EGV LR    P   I V  G   G  + I    L P+I+S  QL  + + +     HP+ 
Sbjct: 65  EGVTLRKALGPGPAINVFSGHMEGDTQAIAGARLTPMINSAEQLARHFEALP---RHPFG 121

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQ-LSLIISHLACADDPSSHVNSVQLERFRT 184
           +Q+DTG NRLG+   E       +    LGQ   L++SHLACAD+P    N+ QL  F  
Sbjct: 122 IQLDTGMNRLGMEADEWAAVAEFA----LGQGPKLVMSHLACADEPGHAANAAQLAEFHR 177

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           L      +  SL+++ GILLG  YHF +TRPGI LYGG      + P   VV     ++ 
Sbjct: 178 LTDGIT-VPRSLSATGGILLGEAYHFDMTRPGIGLYGGA-PFGAAEP---VVRLSIPVVQ 232

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R   AGE V YG       D  IA  + GYADG    +S     ++  V          
Sbjct: 233 VRAVTAGESVGYGCSWVAQSDGAIATLSAGYADGLIRAMSNRAMLYAGDV---------- 282

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
              P+ G+++MD+   D+  S   EV + + +  P   +D +A A+GT  Y++L  +G R
Sbjct: 283 -ACPLAGRVSMDLLTVDV--SHLDEVPEALDLLCPAQGVDRLAEAAGTIGYEILTSLGPR 339

Query: 365 YAKFYT 370
           YA+ Y 
Sbjct: 340 YARHYA 345


>gi|91977460|ref|YP_570119.1| alanine racemase [Rhodopseudomonas palustris BisB5]
 gi|91683916|gb|ABE40218.1| alanine racemase [Rhodopseudomonas palustris BisB5]
          Length = 409

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 126/365 (34%), Positives = 186/365 (50%), Gaps = 10/365 (2%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+  NW  +   +  A  AAVVK +AYG G   ++ AL  AG + FFV ++ E 
Sbjct: 36  LTVDLDAIVANWRKIEKTAVPAEAAAVVKGDAYGCGIGPVSKALAAAGCKTFFVATLGEA 95

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK-LMSCGVSHPYALQ 127
             +R   P A I+VL G            N  PVI  + +L  +         S   A+ 
Sbjct: 96  GAVRAIAPDAVIYVLDGFFQTTGDEFARLNCRPVIGDLYELAEWDVYCRRTRWSGGAAIH 155

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGL++ EA            G ++L+ISHLA A+  +  +N+ Q+  FR + S
Sbjct: 156 IDTGMNRLGLTVAEAQGIVPRIAAGDHG-ITLVISHLAAAEALNHPMNARQVTAFREIAS 214

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+ ASL++SSG+ LGP + F + RPG +LYG        +PM+ VV  +ARI+ +R 
Sbjct: 215 LFTGVAASLSASSGVFLGPQFAFDMVRPGAALYGINPTPEADNPMKPVVDLKARIVQVRS 274

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              G+ V YGG     R + IAV + GYADGY       D      V       I G   
Sbjct: 275 VERGDSVGYGGTWTARRPTRIAVLSAGYADGYFRAAGSNDGTRGADV------VIAGQRC 328

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           PI G+++MD+   D+TD  + +   G    + G  I +D++    GT  Y++L  +G RY
Sbjct: 329 PIAGRVSMDLLAVDVTDLPANAARRGLMATLIGDGITVDELGHHFGTIGYEVLTSLGARY 388

Query: 366 AKFYT 370
           A+ Y+
Sbjct: 389 ARIYS 393


>gi|85542701|gb|ABC71322.1| alanine racemase [Acetobacter aceti]
          Length = 368

 Score =  192 bits (489), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 124/367 (33%), Positives = 189/367 (51%), Gaps = 17/367 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L I+L+A+  N+  +    G    AAVVK +AYGLG  ++AP L   G + FFV  V+EG
Sbjct: 11  LTINLSAIAENYRYLVNKLGKTVCAAVVKADAYGLGVAQVAPILEQVGAKHFFVAHVDEG 70

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YA 125
           + LR Y +P   + VL+G  P   ++    NL PV++S+ Q+     L +  +  P   A
Sbjct: 71  LALRPYLSPHTSVTVLHGPRPDAAEVCVRNNLRPVLNSLKQVAVLRDL-AAKMDKPLDVA 129

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +Q+DTG +R GLS  +           +   +SL++SHLACAD P +  N++Q ERF   
Sbjct: 130 IQLDTGMSRFGLSEADIHKLMATPELLEGLSVSLVMSHLACADTPENAANAMQRERFENY 189

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
                    SL++SSGI LG  +HF L RPG +LYG   + +  +P++ VV  +  I+ I
Sbjct: 190 ARMLPKAALSLSASSGIFLGQPFHFDLVRPGAALYGVAPQNDGVNPLKPVVGLQTHILQI 249

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    G+ V YG   + T    +A  A+GYA              + +    G  + KGY
Sbjct: 250 RTLSKGDRVGYGLTWQATGPCRVATIAVGYA-----------DGFARAGAAAGCAWYKGY 298

Query: 306 MVPILGKITMDMTMFDITDSLS--IEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            +PILG+I+MD    D++      +E    +++      +D VA A GT  Y++L  +G 
Sbjct: 299 RLPILGRISMDSMTVDLSAVPEGLLEEDSMVELLNESYGVDAVAKAEGTIGYEVLTSLGR 358

Query: 364 RYAKFYT 370
           RY + Y 
Sbjct: 359 RYHRVYA 365


>gi|331005749|ref|ZP_08329109.1| Alanine racemase [gamma proteobacterium IMCC1989]
 gi|330420438|gb|EGG94744.1| Alanine racemase [gamma proteobacterium IMCC1989]
          Length = 375

 Score =  192 bits (489), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 128/377 (33%), Positives = 203/377 (53%), Gaps = 32/377 (8%)

Query: 9   LKIDLTALKNNWHSMN-ALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L IDL+AL +NW  +   ++ + R AAVVK NAYGLG   +A  L+  G + FFV +++E
Sbjct: 7   LTIDLSALVDNWKLLQQKVAPSTRCAAVVKANAYGLGIAPVAKVLFANGCRVFFVATLDE 66

Query: 68  GVKLR--LYTPQARIFVLYGIHPGQEKIIFDT-----NLIPVISSVPQLTFYSKLMSCGV 120
           G++LR  L      I V  G+    EK +        +LIPV+ SV  ++ +  L S  V
Sbjct: 67  GIELRTLLAKSDCEIIVFGGLFYDTEKSLCSAAWLHYSLIPVLYSVEHISRW-LLFSSNV 125

Query: 121 SH--PYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQL--SLIISHLACADDPSSHVNS 176
               P  ++VDTG +R+GLS+ E   F     +  +G+L  S I+SH ACAD     +N 
Sbjct: 126 QKVLPSVVKVDTGMHRMGLSVGE---FNEQLLSDVMGRLQPSYIMSHFACADKSEHPLNR 182

Query: 177 VQLERFRTLI----SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM 232
            Q+  F   +    S    I+ S+ +S+GI L  +  + L RPGI+LYGG    +K +PM
Sbjct: 183 DQIMAFDDCLIKIKSRLPDIQVSMCNSAGIFLDGDIFYDLVRPGIALYGGNPSPSKPNPM 242

Query: 233 QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP 292
           + VV     ++ ++   +G+ V YG      +++ +A+ + GYADG    LS        
Sbjct: 243 RPVVKLTLGVMQLKVVASGDSVGYGASYIAQKETRLAIVSGGYADGLHRALSN------- 295

Query: 293 SVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGT 352
                G  + KG  VPI+G+++MD  +FD+T+ +  E    I++ G    +DD+A A+GT
Sbjct: 296 ----AGFAYCKGQKVPIVGRVSMDTMVFDVTN-VPGEDPAMIEVLGECQTVDDLAQAAGT 350

Query: 353 TNYDLLVRIGTRYAKFY 369
             Y++L  +G+R+ + Y
Sbjct: 351 IAYEILTSLGSRFQRNY 367


>gi|239947144|ref|ZP_04698897.1| alanine racemase [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921420|gb|EER21444.1| alanine racemase [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 354

 Score =  192 bits (488), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 128/365 (35%), Positives = 184/365 (50%), Gaps = 21/365 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L+I+L+A+KNN+  +  +   +   A VK N YGLG  +I+ AL     + FFV S EEG
Sbjct: 6   LEINLSAIKNNYLLLQDICKTSLVGAAVKANGYGLGAVQISKALIEENCRHFFVASSEEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYAL 126
           V LR        I VL G+       + + NL PV++++ Q+  + K  +      P  L
Sbjct: 66  VNLRKALGVDVNILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSNLKNRLLPCYL 125

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
             +TG NRLGL+  E     +N    K   L  IISHLA ++   +  N  QL RF+  +
Sbjct: 126 HFNTGINRLGLTHDEIEQLINNRDLLKGLDLQYIISHLAISEKIDNSYNLEQLNRFKAYL 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
            ++  ++ASLA+S GI LG +YHF L RPG +LYG       +  M+  V  +A II ++
Sbjct: 186 RYFPNVKASLANSGGIFLGQDYHFDLARPGAALYG------LNPVMKNPVNLKAPIIHLQ 239

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
                  + Y       RDS+IA   +GYADGY    S             G+ FI G  
Sbjct: 240 NLTLDSHIGYNMTFTTKRDSVIATLPLGYADGYSCNFSN-----------QGEVFINGCS 288

Query: 307 VPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           VPI+G+I+MD+   D+TD     I +G   +I G     D VA   GT  Y++L  +G R
Sbjct: 289 VPIVGRISMDLINIDVTDLPPSDIFLGQEAEIIGNHCTPDKVASIIGTIGYEVLTSLGNR 348

Query: 365 YAKFY 369
           Y + Y
Sbjct: 349 YKRIY 353


>gi|89054230|ref|YP_509681.1| alanine racemase [Jannaschia sp. CCS1]
 gi|122498888|sp|Q28RK6|ALR_JANSC RecName: Full=Alanine racemase
 gi|88863779|gb|ABD54656.1| alanine racemase [Jannaschia sp. CCS1]
          Length = 342

 Score =  192 bits (488), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 189/365 (51%), Gaps = 32/365 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL AL  N+ +++ L G   TAAVVK + YGLG   ++  L  AG   FFV + EEG
Sbjct: 6   LTVDLGALVANYRTLDRL-GPGATAAVVKADGYGLGAGLVSTGLAKAGACQFFVATAEEG 64

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           V LR +  P   I V  G   G   +I D +L P+++S  Q+  +  ++     HPY +Q
Sbjct: 65  VGLRQVLGPAPEINVFAGHMAGDTPLIRDAHLTPMLNSPKQVQRHRHVLP---GHPYGIQ 121

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG +RLG+   +  D+   +   +L   +L++SHLACAD P    N+ QL +FR L  
Sbjct: 122 LDTGMHRLGV---QPADWP--ALRDQLHDATLLMSHLACADAPDHPQNAAQLAQFRALTD 176

Query: 188 HYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
              GI+   SLA++ G L+GP+YHF L RPG+ LYGG          + VV     +I I
Sbjct: 177 ---GIQTPRSLAATGGTLMGPDYHFDLIRPGVGLYGGLPFAGA----RPVVRLSLPVIQI 229

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    G  + YG     T    IA  + GYADG    LS      S +    G       
Sbjct: 230 RCVNPGATIGYGATYTATTPRQIATLSAGYADGLIRALS------SKATLWDGD-----T 278

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
             P++G+++MD+   D+TD  +    + + I GP   +D +A A+GT  Y++L  +G RY
Sbjct: 279 PCPLVGRVSMDLLTVDVTDCDTPP--EALDILGPHQTIDQLAEAAGTIGYEILTSLGPRY 336

Query: 366 AKFYT 370
            +  T
Sbjct: 337 RRALT 341


>gi|94496351|ref|ZP_01302928.1| alanine racemase [Sphingomonas sp. SKA58]
 gi|94424097|gb|EAT09121.1| alanine racemase [Sphingomonas sp. SKA58]
          Length = 348

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 121/368 (32%), Positives = 190/368 (51%), Gaps = 31/368 (8%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL++D  AL +NW  +  +SG A   A +K N YGLG E++   L  AG +DFFV++  
Sbjct: 8   LRLRLDGDALVSNWRWLARMSGPAACGAAIKANGYGLGAEEVMRRLTRAGCRDFFVSNWG 67

Query: 67  EGVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFY--SKLMSCGVSHP 123
           E + L  L     R+ VL+G+      I   +   PV+ +  Q+  +  +   SC V   
Sbjct: 68  EALALEPLMADGVRLSVLHGVRDEDMAIAVASRAKPVLCAPAQVARWRDAGQKSCDV--- 124

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLG-QLSLIISHLACADDPSSHVNSVQLERF 182
               +DTG NRLGL      D+  ++     G  +  ++SHLA AD+  + +N+VQ +RF
Sbjct: 125 ---MMDTGMNRLGL------DWRGDAAGMLAGLTIETVMSHLASADEEVA-LNAVQRDRF 174

Query: 183 RTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARI 242
             +         SLA+S+GI L  +Y F LTRPGI+LYGG      +  ++ VV  +A+I
Sbjct: 175 VQIALGVPAERYSLANSAGICLNADYRFDLTRPGIALYGGVPHAKAAGHIRQVVQPQAQI 234

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           +  R+ +AG+ + Y       RD  +A+  +GYADGY    SG            G   +
Sbjct: 235 LQRRRLIAGDSIGYNATFTAERDHEVAILNLGYADGYLRGFSGT-----------GAASV 283

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  +P+LG+++MD+   D++    +  GD++ I   D  L   + ASG + Y+LL  +G
Sbjct: 284 AGVRLPVLGRVSMDLAAIDVSAVPGLSEGDWVDI---DYDLPRASAASGLSQYELLTGLG 340

Query: 363 TRYAKFYT 370
            RY + + 
Sbjct: 341 ARYDRLWA 348


>gi|90020561|ref|YP_526388.1| alanine racemase [Saccharophagus degradans 2-40]
 gi|89950161|gb|ABD80176.1| alanine racemase [Saccharophagus degradans 2-40]
          Length = 409

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 123/376 (32%), Positives = 197/376 (52%), Gaps = 32/376 (8%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVV-KDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           +L I+L A+  NW  + +       A  V K +AYGLG +++APALY AG +DFFV ++ 
Sbjct: 46  KLTINLDAIAANWRLIQSRLAAGARAGAVVKADAYGLGVQEVAPALYRAGCRDFFVANLA 105

Query: 67  EGVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLM---SCGVSH 122
           E + +R L    A++ VL G  P +E       ++PVI+S      +  +     CG   
Sbjct: 106 EALLVRSLLAGDAQVIVLSGCAPREESEFVRNGIVPVITSATMAERWLGVKGASKCGA-- 163

Query: 123 PYALQVDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+V++G  RLGL   E      H +F        +++SHLACAD     +N+ QL+R
Sbjct: 164 --VLKVNSGMGRLGLEPNEFESLLMHPNFAN--AGFFMLMSHLACADQFDHPLNAAQLQR 219

Query: 182 F----RTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVT 237
           F    +  +       ASLA+SSGI + P++H+ + RPG++LYGG     + +PM+ VV 
Sbjct: 220 FERMRQAFLKKVPAATASLANSSGIFISPSFHYDVARPGVALYGGNPLQRRQNPMRKVVD 279

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
               ++ +R   +GE V YG      R S++   A GYADG              S   G
Sbjct: 280 LRLPVLQVRHLASGEAVGYGASFITQRPSVLLTLAGGYADGL-----------FRSAAAG 328

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITD----SLSIEVGDYIQIFGPDIKLDDVALASGTT 353
           G  ++    +PI+G+++MD  + D TD    ++  E G+ +++ G ++ +DD+A A+GT 
Sbjct: 329 GVVYLGEKPLPIVGRVSMDSIVVDATDVPQAAMPAE-GNMLELLGDNVGVDDLAAAAGTI 387

Query: 354 NYDLLVRIGTRYAKFY 369
            Y++L  +G RY + Y
Sbjct: 388 GYEILTSLGGRYRREY 403


>gi|307292839|ref|ZP_07572685.1| alanine racemase [Sphingobium chlorophenolicum L-1]
 gi|306880905|gb|EFN12121.1| alanine racemase [Sphingobium chlorophenolicum L-1]
          Length = 348

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 188/365 (51%), Gaps = 27/365 (7%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL+++  AL +NW  +    G     A +K + YGLG  ++   L +AG +DFFV++  
Sbjct: 8   LRLRMEEGALLSNWRWLKRQGGGVACGAAIKADGYGLGAAEVMRRLLDAGCRDFFVSNWA 67

Query: 67  EGVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           E   L  L T +  + VL+G       +   +   PV+ +  Q+  + +        P  
Sbjct: 68  EAAVLESLVTEEVSLSVLHGAREEDMALALTSRARPVLCTEWQIARWKQ----AGGGPCD 123

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLG-QLSLIISHLACADDPSSHVNSVQLERFRT 184
           + VDTG NRLGL      D+  +   +  G +++ ++SHLA AD+    +   QLERF  
Sbjct: 124 VMVDTGMNRLGL------DWRGDVPARVAGLEVATLLSHLASADE-DGPLTPTQLERFSA 176

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
           L    K    SLA+S+GI +G +Y F +TRPGI+LYGG  +   +  ++ VV  E +++ 
Sbjct: 177 LQGQVKAARYSLANSAGICMGSDYAFDMTRPGIALYGGVPRREAAGNIRQVVFPETQVLQ 236

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
            R+  AG+ + Y    +  +D  IAV  +GYADGY    SG  S  +            G
Sbjct: 237 RRRVRAGDTIGYNATYRAAKDMEIAVLNLGYADGYLRGFSGRGSMSA-----------GG 285

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
             +P++G+I+MD+T  D+     I  GD++++   D KL D A  SG + Y+LL  +G R
Sbjct: 286 RHLPVVGRISMDLTAIDVGGLPDISEGDWLEV---DYKLADAAAVSGLSQYELLTGLGGR 342

Query: 365 YAKFY 369
           + + +
Sbjct: 343 FDRVW 347


>gi|91206154|ref|YP_538509.1| alanine racemase [Rickettsia bellii RML369-C]
 gi|157826544|ref|YP_001495608.1| alanine racemase [Rickettsia bellii OSU 85-389]
 gi|122425170|sp|Q1RGU4|ALR_RICBR RecName: Full=Alanine racemase
 gi|91069698|gb|ABE05420.1| Alanine racemase [Rickettsia bellii RML369-C]
 gi|157801848|gb|ABV78571.1| alanine racemase [Rickettsia bellii OSU 85-389]
          Length = 410

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 122/347 (35%), Positives = 176/347 (50%), Gaps = 16/347 (4%)

Query: 29  NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLR-LYTPQARIFVLYGIH 87
           N    A VK N+YGLG  +I+  L     + FFV S  EG+ LR     +  I +L G+ 
Sbjct: 75  NLLVGAAVKANSYGLGAIEISKTLLEENCRYFFVASSNEGISLRKAIGDEVNILILNGVF 134

Query: 88  PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYALQVDTGFNRLGLSLQEALDFT 146
                 + + NLIPV++++ Q+  + K  +      P  L  +TG NRLGL+  E     
Sbjct: 135 EHDALELIEYNLIPVLNNLNQIKIWQKFSNLKNQLLPCYLHFNTGINRLGLNHNEIEQLI 194

Query: 147 HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHYKGIEASLASSSGILLGP 206
           +N    K   +  IISHL+ ++D  +  N  QL +F+  + ++   +ASLA+S GI LG 
Sbjct: 195 NNRDLLKGLNVEYIISHLSASEDSDNPYNLEQLNKFKAYLEYFPNAKASLANSGGIFLGK 254

Query: 207 NYHFQLTRPGISLYG-GTDKINKSHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRD 265
           +YHF L RPG +LYG      NK +PMQ  VT +A II ++    G  + Y       RD
Sbjct: 255 DYHFNLVRPGAALYGLNPLGSNKPNPMQNPVTLKAPIIHLQNLTYGSRIGYNMTFTTKRD 314

Query: 266 SLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITD- 324
           SLIA    GYADG+    S             G  FI    VPI+G+I+MD+   D+TD 
Sbjct: 315 SLIATLPFGYADGFSRNFSN-----------QGTVFINSRNVPIIGRISMDLVNIDVTDL 363

Query: 325 -SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFYT 370
               I +G  ++I G +   D +A   GT  Y++L  +G RY + YT
Sbjct: 364 PPSDIFLGQEVEIIGNNCTPDKIADIIGTIGYEILTSLGNRYKRIYT 410


>gi|332185497|ref|ZP_08387245.1| alanine racemase [Sphingomonas sp. S17]
 gi|332014475|gb|EGI56532.1| alanine racemase [Sphingomonas sp. S17]
          Length = 342

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 124/364 (34%), Positives = 188/364 (51%), Gaps = 32/364 (8%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL+ID  AL++NW +++ LSG A   A VK N YGLG   +A AL  AG +DFFV +  
Sbjct: 7   LRLRIDRDALQSNWQALDRLSGTAACGAAVKANGYGLGATLVAKALAEAGCRDFFVANWA 66

Query: 67  EGVKLRLYTPQA-RIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS--CGVSHP 123
           E + L    P    + VL+G+     ++       PV+S+  Q+  +       C V   
Sbjct: 67  EALAL---APLGLTVSVLHGLRADDVEVARAGFARPVLSTPEQIARWRDSGGGLCDV--- 120

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR 183
               VDTG NRLG+S++       +       Q+  ++SHLACAD+    +N+ Q   F 
Sbjct: 121 ---MVDTGMNRLGVSVEAVTGGLLDGL-----QIETLLSHLACADE-DVPMNARQQAAFA 171

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARII 243
            L         SLA+S+GI LG +Y F LTRPG++LYGG  + + +  ++ V   EA+I+
Sbjct: 172 GLKGQTGARRMSLANSAGIGLGADYRFDLTRPGLALYGGVPRPDMAQHLRQVAWPEAQIL 231

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
             R   AGE V Y        D+ +A+  +GYADGY   LSGL           G   + 
Sbjct: 232 QRRHVPAGETVGYNATWTAPADTEVAILNLGYADGYRRALSGL-----------GAAVVD 280

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  +P+LG+++MD+   ++T    +  GD++ +   D  L   + ASG + Y+LL  +  
Sbjct: 281 GVKLPVLGRVSMDLLAINVTARADLAEGDWLSM---DYDLAAASAASGVSQYELLTGLAQ 337

Query: 364 RYAK 367
           R+A+
Sbjct: 338 RFAR 341


>gi|319780958|ref|YP_004140434.1| alanine racemase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166846|gb|ADV10384.1| alanine racemase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 379

 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 120/366 (32%), Positives = 179/366 (48%), Gaps = 17/366 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A++ N+  + A  G+   A V+K + YGLG  ++  AL   G   FFV  + EG
Sbjct: 25  LTIDLGAIRENYRRLKARLGDVACAGVLKADGYGLGAGQVGAALLREGCDIFFVALLGEG 84

Query: 69  VKLRL-YTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYAL 126
           V LR        IFVL GI PG E      NL  VI+S  QL  +           P A+
Sbjct: 85  VALRRSLGAGPAIFVLNGIPPGAETDAVAANLCAVINSPEQLAAWRSAARRAGRKLPAAV 144

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           QVD+G +RLG++ ++      +        +  ++SHLACAD+P    N  Q   F  L 
Sbjct: 145 QVDSGMSRLGMAPRDVDRIAADPQAFDGIDIRYVMSHLACADEPEHPANEKQRSVFERLR 204

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           +      ASL +SSGI LGP++H+ L RPG +LYG      KS+PM  VV  +A++   R
Sbjct: 205 AMLPKAPASLTNSSGIFLGPSFHYDLARPGAALYGINPTPPKSNPMLPVVRLQAKVAQTR 264

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G  V YG          +A  + GYADG+    +                + +G  
Sbjct: 265 SVEKGAGVGYGHSYHAQGPLRLATISFGYADGWQRRAA-------------SAAWFEGVR 311

Query: 307 VPILGKITMDMTMFDIT--DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
           +P +G+++MD  + DI+   +  +  GD +++ GP   +DD A  +GT  Y++L  +G R
Sbjct: 312 LPFVGRVSMDSIILDISALPAGRLREGDLVELLGPSQSVDDAAGHAGTIGYEILTSLGPR 371

Query: 365 YAKFYT 370
           + + Y 
Sbjct: 372 FHRRYV 377


>gi|103486714|ref|YP_616275.1| alanine racemase [Sphingopyxis alaskensis RB2256]
 gi|98976791|gb|ABF52942.1| alanine racemase [Sphingopyxis alaskensis RB2256]
          Length = 348

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 123/365 (33%), Positives = 189/365 (51%), Gaps = 25/365 (6%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL++D  AL  NW  +    G A   A +K + YGLG   +   L  AG +DFFV +  
Sbjct: 8   LRLRLDSDALIANWRWLAGQGGAAACGAAIKADGYGLGARWVMERLAAAGCRDFFVATWA 67

Query: 67  EGVKLRLYTPQA-RIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           E   L +  PQ   + VL+G+              PV++SV Q+    +    G   P  
Sbjct: 68  EAAAL-MPLPQGISVSVLHGVGAADMVAARLLPARPVLNSVEQV---QRWRDSGEGRPCD 123

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           + VDTG NRLGL ++E +    +        + +++SHLA AD+     N+ QL  FR+L
Sbjct: 124 VMVDTGMNRLGLRVEEVMGGALDGL-----AIDILLSHLASADEDCGQ-NAAQLASFRSL 177

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
               +    SLA+S+GI LG +Y F LTRPGI+LYGGT +      ++ VV  E R++ +
Sbjct: 178 RETIRARRYSLANSAGICLGADYAFDLTRPGIALYGGTPRREAQGHIRQVVYPETRVLQL 237

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+  AGE V YG     + D+ +AV  +GYADGY    +G            G    +G 
Sbjct: 238 REVRAGESVGYGATWTASTDTRVAVTNMGYADGYLRCHAG-----------SGGATWRGQ 286

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
            +P++G+++MD+T FD + +  +   D++ I   +  L   A ASG + Y+LL  +G+R+
Sbjct: 287 SLPLIGRVSMDLTAFDASSTEGLREDDWLAI---EYDLPTRAAASGLSQYELLTGLGSRF 343

Query: 366 AKFYT 370
            + +T
Sbjct: 344 GRGWT 348


>gi|157825267|ref|YP_001492987.1| alanine racemase [Rickettsia akari str. Hartford]
 gi|166969426|sp|A8GM54|ALR_RICAH RecName: Full=Alanine racemase
 gi|157799225|gb|ABV74479.1| alanine racemase [Rickettsia akari str. Hartford]
          Length = 355

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 126/367 (34%), Positives = 189/367 (51%), Gaps = 25/367 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L+I+++A+KNN+  +  +   +   A VK N YGLG  +I+ AL     + FFV + EEG
Sbjct: 6   LEINISAIKNNYLLLQGICKTSLVGAAVKANGYGLGAVQISKALIKENCRYFFVATSEEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH---PY 124
           V LR        I VL G+       + + NL PV++++ Q+  + K  +  + H   P 
Sbjct: 66  VNLRKALGLDVDILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSN--LKHRLLPC 123

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
            L  +TG NRLGLS  E     ++    K   L  IISHLA +++  +  N  QL  F+ 
Sbjct: 124 YLHFNTGINRLGLSSDEIEQLINDRDLLKGLDLQYIISHLAISEEIDNPYNLEQLNIFKA 183

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIIL 244
            + ++  ++ASLA+S GI LG +YHF L RPG +LYG       +  M+  VT +A II 
Sbjct: 184 YLQYFPNVKASLANSGGIFLGQDYHFDLARPGAALYG------LNPVMKNPVTLKAPIIH 237

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           ++       + Y       RDS+IA   +GYADG+    S             G+ FI G
Sbjct: 238 LQNLTLDSHIGYNMTFTTKRDSVIATLPLGYADGFSRNFSN-----------QGEVFING 286

Query: 305 YMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
             VPI+G+I+MD+   D+TD   L I +G   +I G     D +A   GT  Y++L  +G
Sbjct: 287 RSVPIVGRISMDLINIDVTDLPPLDIFLGQEAEIIGNYCTPDKIASIIGTIGYEVLTSLG 346

Query: 363 TRYAKFY 369
           +RY + Y
Sbjct: 347 SRYKRIY 353


>gi|296284109|ref|ZP_06862107.1| alanine racemase [Citromicrobium bathyomarinum JL354]
          Length = 365

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 194/366 (53%), Gaps = 33/366 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL ID  AL +NW +++ LSG AR  A VK + YGLG +   PAL  AG +DFFV    
Sbjct: 13  LRLAIDTAALAHNWRALDRLSGTARAGAAVKADCYGLGTQNCVPALVEAGARDFFVAHWS 72

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFY--SKLMSCGVSHP 123
           E   +  +    ++ VL+G+  G+E +    T + PVI+S+ Q   +  +   +C     
Sbjct: 73  EVAPVLDHVAPQQVAVLHGVMTGEEARYAIATGVRPVINSLHQAKVWLDAGGGTCN---- 128

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR 183
             L VDTG NRLGL+  E  D      +     + +++SHL+ A++ S+  N  QL  FR
Sbjct: 129 --LMVDTGINRLGLAPTELSDPLLARLD-----VQVLMSHLSSAEEHSA-ANGHQLAAFR 180

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARII 243
              +     E S+A+S+GI LG +Y   LTRPG++LYGG    + +  ++ V   +A II
Sbjct: 181 AAQALLPHRETSIANSAGIALGRDYSCDLTRPGLALYGGVPTPDLAGHIRQVAFPQAAII 240

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+  AG+ V Y  +   +    +   ++GYADG+  +              G KGF++
Sbjct: 241 HVRRIEAGDAVGYNREFTASGPMRVGTVSLGYADGFLRS-------------WGAKGFLR 287

Query: 304 --GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
             G  + +LGK++MDM + D+  +  ++VGD++ +      L D A  SG + Y+LL  +
Sbjct: 288 HQGRTLRLLGKVSMDMVVVDLAQAPDLDVGDWLDV---PYHLPDAAQHSGLSQYELLTTL 344

Query: 362 GTRYAK 367
           G R+ +
Sbjct: 345 GHRFER 350


>gi|86749577|ref|YP_486073.1| alanine racemase [Rhodopseudomonas palustris HaA2]
 gi|86572605|gb|ABD07162.1| alanine racemase [Rhodopseudomonas palustris HaA2]
          Length = 423

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 126/364 (34%), Positives = 184/364 (50%), Gaps = 10/364 (2%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL A+  NW  +   +  A  AAVVK +AYG G   +  AL  AG + FFV ++ E 
Sbjct: 46  LTIDLDAIVANWRKLEKTAVPAEAAAVVKGDAYGCGIAPVTKALVAAGCKTFFVATLAEA 105

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK-LMSCGVSHPYALQ 127
             +R   P A I+VL G            N  PVI  + +L  +         S   A+ 
Sbjct: 106 AAVRATAPDAAIYVLDGFFQSTGDEFARLNCRPVIGDLYELAEWDVYCRRTQWSGGAAIH 165

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGL++ EA            G ++L+ISHLA A+  +  +N+ Q+  FR + S
Sbjct: 166 IDTGMNRLGLTISEAQGIVPRIATGDHG-ITLVISHLAAAEALNHPMNARQVTAFREIAS 224

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
            + G+ ASL++SSGI L P + F + RPG +LYG        +PMQ VV  +ARI+ +R 
Sbjct: 225 LFTGVPASLSASSGIFLDPQFAFDMVRPGAALYGINPTPEADNPMQPVVDLKARILQVRS 284

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              G+ V YGG     R + IAV + GYADGY       D      V + G+        
Sbjct: 285 VERGDSVGYGGTWTARRPTKIAVLSAGYADGYFRAAGSNDGTRGADVIIAGQ------RC 338

Query: 308 PILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           P+ G+I+MD+   D+TD  + +   G    + G  I +D++    G+  Y++L  +G RY
Sbjct: 339 PVAGRISMDLLAVDVTDLPANAARRGQMATLIGDGITVDELGHHFGSIGYEVLTSLGRRY 398

Query: 366 AKFY 369
           A+ Y
Sbjct: 399 ARVY 402


>gi|87199969|ref|YP_497226.1| alanine racemase [Novosphingobium aromaticivorans DSM 12444]
 gi|87135650|gb|ABD26392.1| alanine racemase [Novosphingobium aromaticivorans DSM 12444]
          Length = 356

 Score =  186 bits (471), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 126/362 (34%), Positives = 186/362 (51%), Gaps = 25/362 (6%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL+ID  AL +NW +++A+SG A   A VK +AYGLG  +++  L  AG +DFFV    
Sbjct: 17  LRLRIDADALASNWRALDAMSGTATAGAAVKADAYGLGAARVSRILVGAGCRDFFVAHWA 76

Query: 67  EGVKLRLYTPQARIFVLYG-IHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           E   L  + P A I VL+G ++  +      T   PV++S+ Q   + +    G  H   
Sbjct: 77  EVPNLLPHVPAASIAVLHGPMNAAEAAFARATGARPVLNSLSQARLWQE-TGGGRCH--- 132

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           + VDTG +RLGL++ E  D      +     + L +SHLA AD+     N  Q  RF T+
Sbjct: 133 VMVDTGMSRLGLAMSEIADPALADLD-----VDLCLSHLASADEDVPQ-NEQQRLRFETV 186

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
            +       SLA+S+GI LG  +H  +TRPGI+LYGG  +   +  ++ V   EA +I +
Sbjct: 187 RAAIPARRYSLANSAGIALGAGFHADVTRPGIALYGGIARPEFAGTIRQVARPEAAVIQV 246

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    G+ V Y       R   + V AIGYADGY    +G  S      FL       G 
Sbjct: 247 RHLQPGDKVGYNAIFTADRPMRVGVLAIGYADGYLRCWTGRGS------FL-----FDGV 295

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
            VP+LG+++MD+T+ D+    S   GD++        L   A  SG + Y+LL  +G R+
Sbjct: 296 EVPVLGRVSMDLTIVDLGGVPSCNEGDWLVA---SYDLPRAARESGLSQYELLTVLGRRF 352

Query: 366 AK 367
           ++
Sbjct: 353 SR 354


>gi|148552942|ref|YP_001260524.1| alanine racemase [Sphingomonas wittichii RW1]
 gi|148498132|gb|ABQ66386.1| alanine racemase [Sphingomonas wittichii RW1]
          Length = 348

 Score =  186 bits (471), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 189/369 (51%), Gaps = 26/369 (7%)

Query: 3   SNEFLRLKIDL--TALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDF 60
           + EFL L++DL   AL  NW  +   +     AA+  D AYGLG  +++  L +AG +DF
Sbjct: 2   TQEFLPLRLDLDPQALVANWRWLGERAAAPAGAAIKAD-AYGLGAVEVSRRLADAGCRDF 60

Query: 61  FVTSVEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGV 120
           FV +  E   L      A + VL+G+          +   PV++S P +    K  + G 
Sbjct: 61  FVATWAETEALGSLPFGAGLSVLHGLREEDLAAALASRARPVLNS-PAMVARWKAAAPG- 118

Query: 121 SHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLE 180
             P  + +DTG NRLGL+++EA     +       ++ L++SHLACAD+P S +N  Q  
Sbjct: 119 -RPCDVMIDTGMNRLGLTVEEACSGLLDGL-----EIDLLLSHLACADEPDSPMNERQRA 172

Query: 181 RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEA 240
           RF  L         SLA+S+G  LGP Y F L RPGI+LYGG  +      +  VV  EA
Sbjct: 173 RFVDLRGRVAAKRHSLANSAGACLGPAYGFDLIRPGIALYGGIPRPEARGHIVRVVRIEA 232

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
           +++ +R   AG+ + YG      R   +A+  +GYADGY    +G            G  
Sbjct: 233 QVLQVRDVPAGDTIGYGATFTAERPMRVAILNLGYADGYLRAFAG-----------NGAA 281

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
            + G   P+ G+++MD+   D+T + + E GD+++I   D  L+  A  +G + Y+LL  
Sbjct: 282 LVNGRRCPLAGRVSMDLIAVDLTGADAAE-GDWLEI---DYALESAADRTGLSQYELLTG 337

Query: 361 IGTRYAKFY 369
           +G+RY + +
Sbjct: 338 LGSRYQRRW 346


>gi|296532301|ref|ZP_06895040.1| alanine racemase [Roseomonas cervicalis ATCC 49957]
 gi|296267377|gb|EFH13263.1| alanine racemase [Roseomonas cervicalis ATCC 49957]
          Length = 370

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 126/364 (34%), Positives = 180/364 (49%), Gaps = 27/364 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+  NW  + A   +   A VVK + YGLG   +A AL  AG + FFV    EG
Sbjct: 28  LLVDLGAIVANWRDLAARHASGPVAGVVKADGYGLGAAPVARALAAAGCRHFFVAQFAEG 87

Query: 69  VKLRL---YTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           + LR    + P   + VL G  PG +      +L PV+++   L         G      
Sbjct: 88  LALRQALGHGPM--VAVLGGFPPGADD---GADLTPVLNAPADLAEARAAGRRGA----I 138

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           L  DTG  RLGL+   A +         LG L  +++HLACAD+P   +N+ Q  RF  +
Sbjct: 139 LHADTGMERLGLN---AAELAAAGDLSDLG-LRYVMTHLACADEPGHPLNAQQAARFAAV 194

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
            +   G+ AS A+SSG+ LG  +   L RPG +LYG      + +PM+ V+     I+ +
Sbjct: 195 RAGLPGLPASFANSSGLFLGEGFASDLARPGCALYGINPTPGQPNPMRPVLRLTVPILQL 254

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+  AG  V YG      RDS IA  A GYADGY   LS             G   + G 
Sbjct: 255 REVPAGTSVGYGASWVAKRDSRIATIAAGYADGYLRVLSNQ-----------GVATLHGQ 303

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
            VP++G+++MD+   D+TD+     GD +++ GP    D VA  +GT  Y++L  +G RY
Sbjct: 304 DVPLVGRVSMDLITLDVTDAPEARPGDRVELIGPRQTPDAVAALAGTIGYEILTSLGARY 363

Query: 366 AKFY 369
            + Y
Sbjct: 364 RRRY 367


>gi|34580918|ref|ZP_00142398.1| alanine racemase [Rickettsia sibirica 246]
 gi|28262303|gb|EAA25807.1| alanine racemase [Rickettsia sibirica 246]
          Length = 355

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/366 (33%), Positives = 187/366 (51%), Gaps = 23/366 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           ++I+L+ +KNN+  +  +   +   A VK N YGLG  +I+ AL  A  + FFV S EEG
Sbjct: 6   VEINLSTIKNNYLLLQDICKTSLVGAAVKANGYGLGAVQISKALIEANCRHFFVASSEEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYAL 126
           V LR        I VL G+       + + NL PV++++ Q+  + K  +      P  L
Sbjct: 66  VNLRNALGLDVNILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSNLKNRLLPCYL 125

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
             +TG NRLGLS  E     ++    K   L  IISHLA +++  +  N  QL RF+  +
Sbjct: 126 HFNTGINRLGLSSDEIEQLINDRDLLKGLDLQYIISHLAISEEIDNPYNLEQLNRFKAYL 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM-QTVVTAEARIILI 245
            ++  ++ASLA+S GI LG +YHF L RPG +LYG        +P+ +  VT +A II +
Sbjct: 186 QYFPNVKASLANSGGIFLGQDYHFDLARPGAALYG-------LNPLTKNPVTLKAPIIHL 238

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           +       + Y       RDS+IA   +GYADG+    S             G+ FI   
Sbjct: 239 QNLTLDSHIGYNMTFTTKRDSVIATLPLGYADGFSRNFSN-----------QGEVFINSR 287

Query: 306 MVPILGKITMDMTMFDITDSLSIEV--GDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            VPI+G+++MD+   D+TD    E+  G   +I G     D +A   GT  Y++L  +G+
Sbjct: 288 SVPIVGRVSMDLINIDVTDLPPSEIFLGQEAEIIGNYCTPDKIASIIGTIGYEVLTNLGS 347

Query: 364 RYAKFY 369
           RY + Y
Sbjct: 348 RYKRKY 353


>gi|302382920|ref|YP_003818743.1| alanine racemase [Brevundimonas subvibrioides ATCC 15264]
 gi|302193548|gb|ADL01120.1| alanine racemase [Brevundimonas subvibrioides ATCC 15264]
          Length = 345

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 129/364 (35%), Positives = 191/364 (52%), Gaps = 30/364 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL AL +N H++ A+SG A    VVK ++YGLG   +A  L   G + FFV  + EG
Sbjct: 7   LTVDLDALAHNVHALAAISG-APVHPVVKADSYGLGAIPVAQRLLREGSRTFFVARLAEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKL--MSCGVSHPYA 125
           + LR    P+  ++VL G        +   +L P+++   QL  +      +CG      
Sbjct: 66  IALRSALGPEPTLYVLDGCVGDAAPALKAADLRPILNHGDQLMAWRAADGGACG------ 119

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           LQ+DTG NRLG  +++A              LSL++SHLACAD+P+  +N  Q + F   
Sbjct: 120 LQIDTGMNRLGFRIEDA--------PAPFEGLSLVMSHLACADEPAQPMNRRQRDAFAAA 171

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
            + Y G   S A+S G  LGP+Y F   RPGI LYGG  +      ++ V T  AR++ +
Sbjct: 172 AARYPGALRSFANSGGCFLGPDYAFDAVRPGICLYGGGPEGRPHDRIKPVATLSARVLQV 231

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R   AGE + Y           IA    GYADG       L S+  P+    G+ ++ G 
Sbjct: 232 RDVPAGESIGYSRGFVAPEARRIATCGAGYADGV------LRSQ-CPN----GQVWVAGS 280

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           + PILG+++MD+   D+T  L + VGD +++FGP+  LDD A A+GT +Y+LL  +  R 
Sbjct: 281 LRPILGRVSMDVIAVDVT-GLDVAVGDPVELFGPNHLLDDAAAAAGTISYELLTSVTARV 339

Query: 366 AKFY 369
            + Y
Sbjct: 340 PRRY 343


>gi|229586333|ref|YP_002844834.1| alanine racemase [Rickettsia africae ESF-5]
 gi|259710072|sp|C3PMD1|ALR_RICAE RecName: Full=Alanine racemase
 gi|228021383|gb|ACP53091.1| Alanine racemase [Rickettsia africae ESF-5]
          Length = 355

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 125/372 (33%), Positives = 188/372 (50%), Gaps = 35/372 (9%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           ++I+L+ +KNN+  +  +   +   A VK N YGLG  +I+ AL     + FFV S EEG
Sbjct: 6   VEINLSTIKNNYLLLQDICKTSLVGAAVKANGYGLGAVQISKALIEENCRHFFVASSEEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK-------LMSCGV 120
           V LR        I VL G+       + + NL PV++++ Q+  + K       L+SC  
Sbjct: 66  VNLRNALGLDVNILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSNLKNRLLSC-- 123

Query: 121 SHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLE 180
                L  +TG NRLGLS  E     ++    K   L  IISHLA +++  +  N  QL 
Sbjct: 124 ----YLHFNTGINRLGLSSDEIEQLINDRDLLKGLDLQYIISHLAISEEIDNPYNLEQLN 179

Query: 181 RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM-QTVVTAE 239
           RF+  + ++  ++ASLA+S GI LG +YHF L RPG +LYG        +P+ +  VT +
Sbjct: 180 RFKAYLQYFPNVKASLANSGGIFLGQDYHFDLARPGAALYG-------LNPLTKNPVTLK 232

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           A II ++       + Y       RDS+IA   +GYADG+    S             G+
Sbjct: 233 APIIHLQNLTLDSHIGYNMTFTTKRDSVIATLPLGYADGFSRNFSN-----------QGE 281

Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLSIEV--GDYIQIFGPDIKLDDVALASGTTNYDL 357
            FI    VPI+G+++MD+   D+TD    E+  G   +I G     D +A   GT  Y++
Sbjct: 282 VFINSRSVPIVGRVSMDLINIDVTDLPPSEIFLGQEAEIIGNYCTPDKIASIIGTIGYEV 341

Query: 358 LVRIGTRYAKFY 369
           L  +G+RY + Y
Sbjct: 342 LTNLGSRYKRKY 353


>gi|292571687|gb|ADE29602.1| Alanine racemase [Rickettsia prowazekii Rp22]
          Length = 404

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 132/408 (32%), Positives = 192/408 (47%), Gaps = 58/408 (14%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L+I+L+A+KNN+  +  +   A   AVVK N YGLG  +IA AL     Q FFV + EEG
Sbjct: 6   LEINLSAIKNNYRLLQDICKTALVGAVVKANGYGLGAMQIAKALIKENCQYFFVATSEEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYAL 126
           + LR +      I VL G+       +   NL PV++++ Q+  + K  +  G   P  L
Sbjct: 66  INLRKVLNNDITILVLNGVFTHDALELIQYNLTPVLNNLSQIEIWQKFSNLKGKILPCYL 125

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
             +TG NR GL+  E     ++    K   L  IISHLA +++  +  N +QL RF+  +
Sbjct: 126 HFNTGLNRFGLNSDEIEQLINDRDLLKGLDLQYIISHLAASEETGNPYNLIQLNRFKVYL 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG------------------------- 221
            ++  ++AS A+S GI LG +YHF L RPG +LYG                         
Sbjct: 186 EYFPNVKASFANSGGIFLGQDYHFDLARPGAALYGLNSLIEVSSNLSYTEEFESNTAALT 245

Query: 222 GTDKINK----------------SHP--MQTVVTAEARIILIRKALAGELVSYGGQKKLT 263
            T  INK                SH   +Q  VT +A II ++       + Y       
Sbjct: 246 TTACINKCPDVSVRLTPKLPLKGSHTVRLQNPVTLKAPIIDLQNLTLDSHIGYNMTFTTK 305

Query: 264 RDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDIT 323
           RDS+IA   +GYADG+    S             G+ FI    VPI+G+++MD+   D+T
Sbjct: 306 RDSVIATLPLGYADGFSRNFSS-----------QGEVFINSCSVPIVGRVSMDLINIDVT 354

Query: 324 DSLSIEV--GDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFY 369
           D    EV  G   +I G     D +A   GT  Y++L  +G+RY + Y
Sbjct: 355 DLPPSEVFLGQEAEIIGNYCTPDKIASIIGTIGYEVLTSLGSRYKRKY 402


>gi|15892051|ref|NP_359765.1| alanine racemase [Rickettsia conorii str. Malish 7]
 gi|20137218|sp|Q92JD9|ALR_RICCN RecName: Full=Alanine racemase
 gi|15619170|gb|AAL02666.1| alanine racemase [Rickettsia conorii str. Malish 7]
          Length = 355

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 123/366 (33%), Positives = 186/366 (50%), Gaps = 23/366 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           ++I+L+ +KNN+  +  +   +   A VK N YGLG  +I+ AL     + FFV S EEG
Sbjct: 6   VEINLSTIKNNYLLLQDICKTSLVGAAVKANGYGLGAVQISKALIEENCRHFFVASSEEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYAL 126
           V LR        I VL G+       + + NL PV++++ Q+  + K  +      P  L
Sbjct: 66  VNLRNALGLDVNILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSNLKNRLLPCYL 125

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
             +TG NRLGLS  E     ++    K   L  IISHLA +++  +  N  QL RF+  +
Sbjct: 126 HFNTGINRLGLSSDEIEQLINDRDLLKGLDLQYIISHLAISEEIDNPYNLEQLNRFKAYL 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM-QTVVTAEARIILI 245
            ++  ++ASLA+S GI LG +YHF L RPG +LYG        +P+ +  VT +A II +
Sbjct: 186 QYFPNVKASLANSGGIFLGQDYHFDLARPGAALYG-------LNPLTKNPVTLKAPIIHL 238

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           +       + Y       RDS+IA   +GYADG+    S             G+ FI   
Sbjct: 239 QNLTLDSHIGYNMTFTTKRDSVIATLPLGYADGFSRNFSN-----------QGEVFINSR 287

Query: 306 MVPILGKITMDMTMFDITDSLSIEV--GDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            VPI+G+++MD+   D+TD    E+  G   +I G     D +A   GT  Y++L  +G+
Sbjct: 288 SVPIVGRVSMDLINIDVTDLPPSEIFLGQEAEIIGNYCTPDKIASIIGTIGYEVLTNLGS 347

Query: 364 RYAKFY 369
           RY + Y
Sbjct: 348 RYKRKY 353


>gi|238650557|ref|YP_002916409.1| alanine racemase [Rickettsia peacockii str. Rustic]
 gi|259710073|sp|C4K1B0|ALR_RICPU RecName: Full=Alanine racemase
 gi|238624655|gb|ACR47361.1| alanine racemase [Rickettsia peacockii str. Rustic]
          Length = 355

 Score =  183 bits (464), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 123/366 (33%), Positives = 186/366 (50%), Gaps = 23/366 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           ++I+L+ +KNN+  +  +   +   A VK N YGLG  +I+ AL     + FFV S EEG
Sbjct: 6   VEINLSTIKNNYLLLQDVCKTSLVGAAVKANGYGLGAVQISKALIEENCRHFFVASSEEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYAL 126
           V LR        I VL G+       + + NL PV++++ Q+  + K  +      P  L
Sbjct: 66  VNLRNALGLDVNILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSNLKNRLLPCYL 125

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
             +TG NRLGLS  E     ++    K   L  IISHLA +++  +  N  QL RF+  +
Sbjct: 126 HFNTGINRLGLSSDEIEQLINDRDLLKGLDLQYIISHLAISEEIDNPYNLEQLNRFKAYL 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM-QTVVTAEARIILI 245
            ++  ++ASLA+S GI LG +YHF L RPG +LYG        +P+ +  VT +A II +
Sbjct: 186 QYFPNVKASLANSGGIFLGQDYHFDLARPGAALYG-------LNPLTKNPVTLKAPIIHL 238

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           +       + Y       RDS+IA   +GYADG+    S             G+ FI   
Sbjct: 239 QNLTLDSHIGYNMTFTTKRDSVIATLPLGYADGFSRNFSN-----------QGEVFINSR 287

Query: 306 MVPILGKITMDMTMFDITDSLSIEV--GDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            VPI+G+++MD+   D+TD    E+  G   +I G     D +A   GT  Y++L  +G+
Sbjct: 288 SVPIVGRVSMDLINIDVTDLPPSEIFLGQEAEIIGNYCTPDKIASIIGTIGYEVLTNLGS 347

Query: 364 RYAKFY 369
           RY + Y
Sbjct: 348 RYKRKY 353


>gi|85374046|ref|YP_458108.1| alanine racemase [Erythrobacter litoralis HTCC2594]
 gi|84787129|gb|ABC63311.1| alanine racemase [Erythrobacter litoralis HTCC2594]
          Length = 348

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 120/365 (32%), Positives = 190/365 (52%), Gaps = 30/365 (8%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           LRL ID  AL+ NW +++ LSG AR  A VK + YGLG +   P L +AG +DFFV    
Sbjct: 10  LRLDIDREALEANWRALDRLSGKARAGAAVKADCYGLGVDTCVPVLRDAGARDFFVAHWS 69

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           E   +  +    +I VL+G +  +E +        PV++S+ Q   +  + S G   P  
Sbjct: 70  EVADVARHVLPEQIAVLHGANTAEEAEYARSIGARPVVNSLHQANVW--IDSGG--GPCH 125

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           + VDTG +RLG++  E         +     + +++SHL+ AD+  + VN+ QLE FR L
Sbjct: 126 MMVDTGIHRLGIAPSEVAANVIRQLD-----VQVLMSHLSSADE-DTPVNAAQLEAFRAL 179

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
                  E SLA+S+GI L  ++ F LTRPG+SLYGG  +   +  ++ V   +A II +
Sbjct: 180 KGQLGAQELSLANSAGIGLNDDFAFDLTRPGLSLYGGVQRPELAEHIRQVAYPKAAIIQV 239

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG---FI 302
            +  AG+ V Y G+        +   ++GYADG+                 GGKG   + 
Sbjct: 240 AELRAGDHVGYNGEFTAPDAMRVGTVSLGYADGFLRA-------------WGGKGLALYH 286

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
           +G  +P+LGK++MDM + D+     + VG ++ +      L   + A+G + Y+LL  +G
Sbjct: 287 EGRSLPLLGKVSMDMVVVDLAAEPDLSVGTWLDV---PYDLPRASEATGLSQYELLTILG 343

Query: 363 TRYAK 367
            R+A+
Sbjct: 344 QRFAR 348


>gi|51473254|ref|YP_067011.1| alanine racemase [Rickettsia typhi str. Wilmington]
 gi|81826340|sp|Q68XW3|ALR_RICTY RecName: Full=Alanine racemase
 gi|51459566|gb|AAU03529.1| alanine racemase [Rickettsia typhi str. Wilmington]
          Length = 402

 Score =  182 bits (462), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 129/406 (31%), Positives = 190/406 (46%), Gaps = 56/406 (13%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L+I+L+A+KNN+  +  +   A   A VK N YG+G  +IA AL     Q FFV + EEG
Sbjct: 6   LEINLSAIKNNYRLLQDICTTALVGAAVKANGYGIGAMQIAKALIEENCQYFFVATSEEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVS-HPYAL 126
           + LR        I VL G+       +   NL PV++++ Q+  + K  +      P  L
Sbjct: 66  INLRKALNNDITILVLNGVFTHDALELIQYNLTPVLNNLKQIEIWQKFSNLKEKILPCYL 125

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
             +TG NR GL+  E     ++    K   L  IISHLA +++  +  N  QL RF+  +
Sbjct: 126 HFNTGLNRFGLNYDEIEQLINDRDLLKGLDLQYIISHLAASEEMDNPYNLAQLNRFKDYL 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG------------------------- 221
            ++  ++ASLA+S GI LG +YHF L RPG +LYG                         
Sbjct: 186 EYFPNVKASLANSGGIFLGQDYHFDLARPGAALYGLNSLIEVSYNLSYKEKFERNTPALA 245

Query: 222 GTDKINK----------------SHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRD 265
            T  INK                S+ +Q  VT +A II ++       + Y       RD
Sbjct: 246 TTVCINKCADVNTRLTYKVPLKGSYRLQNPVTLKAPIIHLQNLTLDSHIGYNMTFTTKRD 305

Query: 266 SLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDS 325
           S+IA   +GYADG+    S             G+ FI    VPI+G+++MD+   D+TD 
Sbjct: 306 SIIATLPLGYADGFSRNFSN-----------QGEVFINSRSVPIVGRVSMDLINIDVTDL 354

Query: 326 LSIEV--GDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFY 369
              EV  G  ++I G     D +A   GT  Y++L  +G+RY + Y
Sbjct: 355 PPSEVFLGQEVEIIGNYCTPDKIASIIGTVGYEVLTSLGSRYKRKY 400


>gi|15603973|ref|NP_220488.1| alanine racemase [Rickettsia prowazekii str. Madrid E]
 gi|6647413|sp|Q9ZE52|ALR_RICPR RecName: Full=Alanine racemase
 gi|3860664|emb|CAA14565.1| ALANINE RACEMASE (alr) [Rickettsia prowazekii]
          Length = 404

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 130/408 (31%), Positives = 190/408 (46%), Gaps = 58/408 (14%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L+I+L+A+KNN+  +  +   A   AVVK N YGLG  +IA AL     Q FFV + EEG
Sbjct: 6   LEINLSAIKNNYRLLQDICKTALVGAVVKANGYGLGAMQIAKALIKENCQYFFVATSEEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYAL 126
           + LR +      I VL G+       +   NL PV++++ Q+  + K  +  G   P  L
Sbjct: 66  INLRKVLNNDITILVLNGVFTHDALELIQYNLTPVLNNLSQIEIWQKFSNLKGKILPCYL 125

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
             +TG NR GL+  E     ++    K   L  IISHLA +++  +  N +QL RF+  +
Sbjct: 126 HFNTGLNRFGLNSDEIEQLINDRDLLKGLDLQYIISHLAASEETGNPYNLIQLNRFKVYL 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG------------------------- 221
            ++  ++AS A+S GI LG +YHF L RPG +LYG                         
Sbjct: 186 EYFPNVKASFANSGGIFLGQDYHFDLARPGAALYGLNSLIEVSSNLSYTEEFESNTAALT 245

Query: 222 GTDKINKSHP------------------MQTVVTAEARIILIRKALAGELVSYGGQKKLT 263
            T  INK                     +Q  VT +A II ++       + Y       
Sbjct: 246 TTACINKCPDVSVRLTPKLPLKGSYTVRLQNPVTLKAPIIDLQNLTLDSHIGYNMTFTTK 305

Query: 264 RDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDIT 323
           RDS+IA   +GYADG+    S             G+ FI    VPI+G+++MD+   D+T
Sbjct: 306 RDSVIATLPLGYADGFSRNFSS-----------QGEVFINSCSVPIVGRVSMDLINIDVT 354

Query: 324 DSLSIEV--GDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFY 369
           D    EV  G   +I G     D +A   GT  Y++L  +G+RY + Y
Sbjct: 355 DLPPSEVFLGQEAEIIGNYCTPDKIASIIGTIGYEVLTSLGSRYKRKY 402


>gi|85708650|ref|ZP_01039716.1| alanine racemase [Erythrobacter sp. NAP1]
 gi|85690184|gb|EAQ30187.1| alanine racemase [Erythrobacter sp. NAP1]
          Length = 355

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 116/363 (31%), Positives = 190/363 (52%), Gaps = 28/363 (7%)

Query: 3   SNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFV 62
           SNE   L++D  ALK+NW  ++ +SG+A   A VK + YGLG     P L  AG ++FFV
Sbjct: 15  SNE---LRVDTEALKDNWRMLDRMSGDAGAGAAVKADCYGLGVSICVPTLVEAGCRNFFV 71

Query: 63  TSVEEGVKLRLYTPQARIFVLYG-IHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVS 121
            + +E  +L  Y    +I VL G + P +      + ++PVI+S+ Q   ++K    G  
Sbjct: 72  ANWDEAEELSHYVAPEQIAVLQGPVTPQEADFAKASGILPVINSIHQAKLWTK-AGGGTC 130

Query: 122 HPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
           H   L +DTG NRLG++  +  D    + +     + + +SHLA AD+    +N+ QL  
Sbjct: 131 H---LMIDTGINRLGIAPSDISDPAIAALD-----IDVAMSHLASADE-DGPMNARQLAL 181

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEAR 241
           +R  +   +    SLA+S+GI LG +Y F LTRPG++LYGG  +      ++ V   +A 
Sbjct: 182 YRECLGSVRHKRESLANSAGIALGMDYAFDLTRPGLALYGGIARPELEGRIKQVAYIKAC 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           ++  R   AG+ V Y G+   +    +   +IGYADG+      L +      F+     
Sbjct: 242 VLQTRSLKAGDAVGYNGEFVASEPMRVGTISIGYADGF------LRARGPGEAFM----- 290

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
            +G  +P+LGK++MDM + D+  +  ++ GD++ +      L + A  S  + Y+LL  +
Sbjct: 291 FEGKRLPLLGKVSMDMVVVDLAHAPEVKEGDWLDV---PFDLLNAARQSSVSQYELLTVL 347

Query: 362 GTR 364
           G R
Sbjct: 348 GRR 350


>gi|157828002|ref|YP_001494244.1| alanine racemase [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165932698|ref|YP_001649487.1| alanine racemase [Rickettsia rickettsii str. Iowa]
 gi|166969428|sp|A8GQR1|ALR_RICRS RecName: Full=Alanine racemase
 gi|189027390|sp|B0BW55|ALR_RICRO RecName: Full=Alanine racemase
 gi|157800483|gb|ABV75736.1| alanine racemase [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165907785|gb|ABY72081.1| alanine racemase [Rickettsia rickettsii str. Iowa]
          Length = 355

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 186/366 (50%), Gaps = 23/366 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           ++I+L+ +KNN+  +  +   +   A VK N YGLG  +I+ AL     + FFV S EEG
Sbjct: 6   VEINLSTIKNNYLLLQDVCKTSLVGAAVKANGYGLGAIQISKALIEENCRHFFVASSEEG 65

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYAL 126
           V LR        I VL G+       + + NL PV++++ Q+  + K  +      P  L
Sbjct: 66  VNLRNALGLDINILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSNLKNRLLPCYL 125

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
             +TG NRLGLS  E     ++    K   L  IISHLA +++  +  N  QL RF+  +
Sbjct: 126 HFNTGINRLGLSSDEIEQLINDRDLLKGLDLQYIISHLAISEEIDNPYNLEQLNRFKAYL 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM-QTVVTAEARIILI 245
            ++  ++ASLA+S GI LG +YHF L RPG +LYG        +P+ +  VT +A II +
Sbjct: 186 QYFPNVKASLANSGGIFLGQDYHFDLARPGAALYG-------LNPLTKNPVTLKAPIIHL 238

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           +       + Y       RDS+IA   +GYADG+    S             G+ FI   
Sbjct: 239 QNLTLDSHIGYNMTFTTKRDSVIATLPLGYADGFSRNFSN-----------QGEVFINSR 287

Query: 306 MVPILGKITMDMTMFDITDSLSIEV--GDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            VPI+G+++MD+   D+TD    E+  G   +I G     + +A   GT  Y++L  +G+
Sbjct: 288 SVPIVGRVSMDLINIDVTDLPPSEIFLGQEAEIIGNYCTPNKIASIIGTIGYEVLTNLGS 347

Query: 364 RYAKFY 369
           RY + Y
Sbjct: 348 RYKRKY 353


>gi|153871849|ref|ZP_02000914.1| alanine racemase 2, PLP-binding, catabolic [Beggiatoa sp. PS]
 gi|152071686|gb|EDN69087.1| alanine racemase 2, PLP-binding, catabolic [Beggiatoa sp. PS]
          Length = 357

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 115/361 (31%), Positives = 188/361 (52%), Gaps = 23/361 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL+ N   +   + N+R  AV+K N YG G  ++A  +  A V  F V+ +EE ++
Sbjct: 9   IDTAALRGNVQRVKVCAPNSRIMAVIKANGYGHGAIRMAQTI-EASVNAFAVSCLEEALQ 67

Query: 71  LRLYTPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G  HP +  II D +L  V+ +  Q   +  L+   +  P    L+
Sbjct: 68  LREAEITIPIVLLEGFFHPNELPIIADQDLHIVVHTHKQ---FEDLLKAPLEKPITIWLK 124

Query: 128 VDTGFNRLGLSLQEALD-FTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           VDTG +RLG +  +    +     ++++ Q   ++SHL+CADD    +   Q + F  L 
Sbjct: 125 VDTGMHRLGFAPSDIEPIYKLLKHSQQIAQPIRLMSHLSCADDRQDEITEQQTQIFMALA 184

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
            H   +EASLA+S+G+L  PN H    RPGI LYG +       K   +Q+V+  ++ +I
Sbjct: 185 RHLN-LEASLANSAGVLGWPNTHADWVRPGIMLYGVSPFLKSAGKREGLQSVMQLQSTLI 243

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +++   GE + YG   +  +  L+ V AIGYADGYP         H+PS   G    + 
Sbjct: 244 SVKRHRKGEAIGYGATWRCPQTMLVGVVAIGYADGYP--------RHAPS---GTPVLVN 292

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VP++G+++MDM   D+    +  +GD + ++G  + ++++A  +GT  Y+LL  +  
Sbjct: 293 GRRVPLVGRVSMDMITVDLRSQPNARIGDPVVLWGRHLPVEEIANDAGTIAYELLCHVNH 352

Query: 364 R 364
           R
Sbjct: 353 R 353


>gi|56697512|ref|YP_167880.1| alanine racemase [Ruegeria pomeroyi DSS-3]
 gi|56679249|gb|AAV95915.1| alanine racemase [Ruegeria pomeroyi DSS-3]
          Length = 377

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 132/371 (35%), Positives = 198/371 (53%), Gaps = 44/371 (11%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL +NW ++NA +  A TAAVVK + YGLG  ++A  L  AG + FFV + EEG
Sbjct: 10  LTIDLDALADNWQALNART-TAETAAVVKADGYGLGAARVAARLARAGARTFFVAAAEEG 68

Query: 69  VKLRLYT-PQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
             +R    P   I V  G   G   I+    L P+I+SV Q+  + + +     H + +Q
Sbjct: 69  AAVRKAVGPDPMIGVFSGHMEGDAGILRANRLTPMINSVDQMLRHVEQLP---GHRFGVQ 125

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +DTG NRLGL  ++       +  +     +L++SHLACAD+P   +N  QL  F+ +  
Sbjct: 126 LDTGMNRLGLEPEDWAQLREIALRQNP---ALVMSHLACADEPGHDMNRKQLRLFKEMTD 182

Query: 188 HYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILI 245
              GI+A  SLA++ GILLGP+YHF L RPG+ LYGG +  +++   + VVT +  +I +
Sbjct: 183 ---GIKAPRSLAATGGILLGPDYHFDLCRPGVGLYGG-EPFDEA---KAVVTLDLPVIQV 235

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG---FI 302
           R    GE V YG      R   IA  A GYADG    +              G+G   F 
Sbjct: 236 RDLAEGETVGYGNSWTAPRACRIATVAAGYADGLHRAM--------------GRGITLFA 281

Query: 303 KGYMVPILGKITMDMTMFDIT----DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
                P++G+I+MD+   D++    +  S+++ + +Q       +DD+A A+GT  Y++L
Sbjct: 282 GKTACPVVGRISMDLITVDVSGLDHEPASLQLLNRLQT------VDDLAEAAGTIGYEIL 335

Query: 359 VRIGTRYAKFY 369
             +G RY + Y
Sbjct: 336 TSMGRRYRRSY 346


>gi|157964159|ref|YP_001498983.1| alanine racemase [Rickettsia massiliae MTU5]
 gi|157843935|gb|ABV84436.1| Alanine racemase [Rickettsia massiliae MTU5]
          Length = 377

 Score =  179 bits (454), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 187/366 (51%), Gaps = 23/366 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           ++I+L+ +KNN+  +  +   +   A VK N YGLG  +I+ AL     + FFV S EEG
Sbjct: 28  VEINLSTIKNNYLLLQDICKTSLVGAAVKANGYGLGAVQISKALIEENCRHFFVASSEEG 87

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYAL 126
           V LR        I VL G+       + + NL PV++++ Q+  + K  +      P  L
Sbjct: 88  VNLRNALGLDVNILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSNLKNRLLPCYL 147

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
             +TG NRLGLS  E     ++    K   L  IISHLA +++  +  N  QL RF+  +
Sbjct: 148 HFNTGINRLGLSSDEIEQLINDRDLLKGLDLQYIISHLAISEEIDNPYNLEQLNRFKAYL 207

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM-QTVVTAEARIILI 245
            ++  ++ASLA+S GI LG +YHF L R G +LYG        +P+ +  VT +A II +
Sbjct: 208 QYFPNVKASLANSGGIFLGQDYHFDLARSGAALYG-------LNPLTKNPVTLKAPIIHL 260

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           +       + Y       RDS+IA   +GYADG+    S     +   VF+  +G     
Sbjct: 261 QNLTLDSHIGYNMTFTTKRDSVIATLPLGYADGFSRNFS-----NQGEVFINSRG----- 310

Query: 306 MVPILGKITMDMTMFDITDSLSIEV--GDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
            VPI+G+++MD+   D+TD    E+  G   +I G     D +A   GT  Y++L  +G+
Sbjct: 311 -VPIVGRVSMDLINIDVTDLPPSEIFLGQEAEIIGNYCTPDKIASIIGTIGYEVLTNLGS 369

Query: 364 RYAKFY 369
           RY + Y
Sbjct: 370 RYKRKY 375


>gi|192360177|ref|YP_001981190.1| alanine racemase [Cellvibrio japonicus Ueda107]
 gi|190686342|gb|ACE84020.1| alanine racemase [Cellvibrio japonicus Ueda107]
          Length = 379

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 123/372 (33%), Positives = 185/372 (49%), Gaps = 25/372 (6%)

Query: 9   LKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L IDL A+  NWH + N ++ +   AAVVK NAYGLG   +  AL   G   FF  + EE
Sbjct: 20  LTIDLHAICANWHFLKNQVAPHVDVAAVVKANAYGLGAVPVVRALRKEGCTTFFFATKEE 79

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS---VPQLTFYSKLMSCGVSHPY 124
            +   L        VL G+  G E    +  L PV+ S   V +   Y+K  +C    P 
Sbjct: 80  ALASGLNGEHCLKIVLSGVRSGDEPFFVEGQLTPVLYSLADVQRWNAYAK--NCCKRLPC 137

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
            L+VDTG  R+G+S++E   F     +  +  L  ++SHLACAD PS   N  QL+ F+ 
Sbjct: 138 ILKVDTGMTRMGMSIEELEAFCEAHASIHIAPL-FLMSHLACADTPSHPANQRQLQLFKQ 196

Query: 185 LIS----HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEA 240
            +      +  I+ASLA+S+GILLG ++HF L RPG +LYG        + ++ V+T   
Sbjct: 197 ALDIAQVRFPEIKASLANSAGILLGADWHFDLVRPGAALYGINPVSGIPNLLKPVITLSL 256

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
            ++ IR       V Y         S +AV A GYADG   TL        P     G  
Sbjct: 257 PVLQIRSLQHDAYVGYSATHFAKAGSRLAVVAGGYADGIHRTLG-----FKPLAQFNGMA 311

Query: 301 FIKGYMVPILGKITMDMTMFDIT---DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
           F        +G+++MD  +FDI+   ++   +VGDY+++    + L+ +   + +  Y++
Sbjct: 312 F------EAVGRVSMDSCVFDISQCPENRLPQVGDYLEVVNESLSLNFLMERNASLGYEV 365

Query: 358 LVRIGTRYAKFY 369
           L  +GTR+ + Y
Sbjct: 366 LNSLGTRFHRIY 377


>gi|260770257|ref|ZP_05879190.1| alanine racemase biosynthetic [Vibrio furnissii CIP 102972]
 gi|260615595|gb|EEX40781.1| alanine racemase biosynthetic [Vibrio furnissii CIP 102972]
          Length = 387

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 122/371 (32%), Positives = 194/371 (52%), Gaps = 34/371 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N+  + ALSG+ +  AV+K +AYG G  ++A AL +A    F V+ +EE  +
Sbjct: 8   IDLNALQHNYRRLKALSGSQQVVAVIKGDAYGHGAVQLASALPDA--DRFAVSRLEEAEE 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YALQ 127
           LRL      I +L G     + K   +  L   I    QL     L +  ++HP    L+
Sbjct: 66  LRLAGITQPILLLEGCFCADDLKRAAELKLDTTIHCEEQL---HDLETSTLAHPIHVWLK 122

Query: 128 VDTGFNRLGLSLQEALDF------THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
           VDTG +RLG+   +  ++      TH   N+KLG     ISH +CADD +      QL  
Sbjct: 123 VDTGMHRLGVQPFQVPEYVSRIERTHK-LNEKLG----FISHFSCADDINHPTTQRQLAC 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG---GTDKINKSHPMQTVVTA 238
           F    + Y G + ++A+S+GIL  P   F + R GI+L+G     +   + H +  V+T 
Sbjct: 178 FNQATAQYDGPK-TIANSAGILFWPESQFDVARAGIALFGISPSAEHTGRDHALVPVMTL 236

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
             R+I +RK  A   V YG      +D+ I V A+GY DGYP +        +PS   G 
Sbjct: 237 NTRLIAVRKHQASRPVGYGETWHAQQDTHIGVIAMGYGDGYPRS--------APS---GT 285

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             F+ G +VPI+G+++MDM   D+    + +VGD ++++G ++ ++ +A   GT  Y+L 
Sbjct: 286 PVFVNGRLVPIVGRVSMDMITVDLGPDATDQVGDVVEMWGKNLPIETIANHVGTIPYELT 345

Query: 359 VRIGTRYAKFY 369
           +++  R  + Y
Sbjct: 346 IKLTPRVHRHY 356


>gi|13475189|ref|NP_106753.1| alanine racemase [Mesorhizobium loti MAFF303099]
 gi|20137424|sp|Q98A05|ALR1_RHILO RecName: Full=Alanine racemase, biosynthetic
 gi|14025940|dbj|BAB52539.1| alanine racemase [Mesorhizobium loti MAFF303099]
          Length = 397

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 116/367 (31%), Positives = 193/367 (52%), Gaps = 24/367 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGN-ARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L+IDL A++ N+  ++ L G+  + AAVVK +AYGLG   IA  L +AG    FV +++E
Sbjct: 13  LEIDLAAIRANFQKISTLVGDKVKVAAVVKSDAYGLGLVDIARTLIDAGCDLLFVANLDE 72

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
            + LR    +  I V                LIPV+++  +L     + + G    Y L 
Sbjct: 73  ALLLRSSFSRVAIAVFRDEFDRFGTWYRSHGLIPVVNNCKEL---HAVGTAGEPQSYFLN 129

Query: 128 VDTGFNRLGLSLQE-ALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           V+TGF+R GLS+ +   ++   +F +   + S+++SHLAC +  S  +N +Q +RFRT+ 
Sbjct: 130 VETGFSRFGLSVGDIQREYLLRTFERY--RPSIVLSHLACGECISDPMNQLQRDRFRTVY 187

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
              K    SL++S+G+ LG +YHF + R G +LYG  +   +++P++ VV   ARI+ +R
Sbjct: 188 DLLKPTRGSLSASAGVWLGKSYHFDMVRVGSALYGIHNAGVQTNPLKPVVKLRARILDVR 247

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK--G 304
              AGE V YG   +  R S +A+  IGY  G P + +              K F++   
Sbjct: 248 SVPAGEAVGYGATFRTDRASRVAIVGIGYKHGLPWSCA-------------NKIFVRLAE 294

Query: 305 YMVPILGKITMDMTMFDITD--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
           Y  P +G+I+M+  + DITD  +     G + ++   D  ++D+  A+G +  + L R+G
Sbjct: 295 YSAPSIGRISMEYMIIDITDVPARRCSPGTFAELLSEDFTVNDLGAAAGVSPQEALTRLG 354

Query: 363 TRYAKFY 369
               + Y
Sbjct: 355 AGCTRKY 361


>gi|315182757|gb|ADT89670.1| alanine racemase [Vibrio furnissii NCTC 11218]
          Length = 387

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 191/366 (52%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N+  + ALSG+ +  AV+K +AYG G  ++A AL +A    F V+ +EE  +
Sbjct: 8   IDLNALQHNYRRLKALSGSQQVVAVIKGDAYGHGAVQLASALPDA--DRFAVSRLEEAEE 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YALQ 127
           LRL      I +L G     + K   +  L   I    QL     L +  ++HP    L+
Sbjct: 66  LRLAGITQPILLLEGCFCADDLKRAAELKLDTTIHCEEQL---HDLETSTLAHPIHVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           VDTG +RLG+   +  ++       +KL +    ISH +CADD +      QL  F    
Sbjct: 123 VDTGMHRLGVQPFQVPEYVSRIERTRKLSEKLGFISHFSCADDINHPTTQRQLACFNQAT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG---GTDKINKSHPMQTVVTAEARII 243
           + Y G + ++A+S+GIL  P   F + R GI+L+G     +   + H +  V+T   R+I
Sbjct: 183 AQYDGPK-TIANSAGILFWPESQFDVARAGIALFGISPSAEHTGRDHALVPVMTLNTRLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +RK  A   V YG      +D+ I V A+GY DGYP +        +PS   G   F+ 
Sbjct: 242 AVRKHQASRPVGYGETWHAQQDTHIGVIAMGYGDGYPRS--------APS---GTPVFVN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G +VPI+G+++MDM   D+    + +VGD ++++G ++ ++ +A   GT  Y+L +++  
Sbjct: 291 GRLVPIVGRVSMDMITVDLGPDATDQVGDVVEMWGKNLPIETIANHVGTIPYELTIKLTP 350

Query: 364 RYAKFY 369
           R  + Y
Sbjct: 351 RVHRHY 356


>gi|146305685|ref|YP_001186150.1| alanine racemase [Pseudomonas mendocina ymp]
 gi|145573886|gb|ABP83418.1| alanine racemase [Pseudomonas mendocina ymp]
          Length = 358

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 120/367 (32%), Positives = 185/367 (50%), Gaps = 26/367 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL+A+ +N+      +   +  AVVK NAYG G  ++  AL+      F V S+EE  +
Sbjct: 8   VDLSAIAHNYAVAKRCAPGRQAFAVVKANAYGHGVREVVTALHEVA-DGFAVASLEEAAE 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YALQ 127
           +R    +ARI +L G     E  I     L  V+ S  Q      L++C  + P    L+
Sbjct: 67  VRAMHGEARILLLEGCFEASEYAIAAQLGLDLVVQSAAQ---ADALLACEPARPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFN--KKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +D+G +RLG     +L   H      +++ +L+L+ SH ACAD+    +  +Q+ERF  L
Sbjct: 124 LDSGMHRLGFD-AASLRQWHARLEMAEQVAELNLL-SHFACADERGHPLTELQVERFLDL 181

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARI 242
           +        SLA+S+ +L  P  H    RPGI LYG T   D   +   ++  +T  AR+
Sbjct: 182 LD-LDFNHRSLANSAAVLTIPAAHMDWLRPGIMLYGATPFADFSARELGLKPAMTLAARV 240

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R+   GE V YG      R S IA  + GYADGYP         H+PS   G    +
Sbjct: 241 IAVRQVAVGESVGYGATWVAERPSRIATVSCGYADGYP--------RHAPS---GTPVLV 289

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G   P+ G+++MDM   DITD   + +   ++++G  + +D+VA ASGT  Y+LL ++ 
Sbjct: 290 DGQRAPLAGRVSMDMLTVDITDLPEVGIDSSVELWGAQLPVDEVAHASGTIGYELLTKVT 349

Query: 363 TRYAKFY 369
            R  + Y
Sbjct: 350 ARVPRRY 356


>gi|71279952|ref|YP_269587.1| alanine racemase [Colwellia psychrerythraea 34H]
 gi|71145692|gb|AAZ26165.1| alanine racemase [Colwellia psychrerythraea 34H]
          Length = 360

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 119/365 (32%), Positives = 191/365 (52%), Gaps = 22/365 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL  N+  ++ L+ N+ T AV+K +AYG    K+A AL ++ V+ F V  ++E + 
Sbjct: 12  INLDALVKNYQYLDNLASNSNTIAVLKADAYGHDASKVAHAL-SSEVKVFAVAFIDEALA 70

Query: 71  LRLYTPQARIFVLYGIHPGQE---KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           LR    +  + +L G  P  E   +I  + N   ++ S  QL +  K ++   S    L+
Sbjct: 71  LRDAGIKNTVLILEG--PFNESDFEIALENNFALMLHSNYQLEWL-KSITPEFSGELWLK 127

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           VDTG NRLG  +++  +       +++  L ++ SH A AD       + QL + + L++
Sbjct: 128 VDTGMNRLGFQVEQIDNVMSQLSAQQINNL-VLCSHFATADQIDCARPAKQLAKLKALVA 186

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD--KINKSHPMQTVVTAEARIILI 245
            + G + S+A+S+GIL  P  H    R G++LYG +      KS P+   +T +A II I
Sbjct: 187 KH-GCKYSMANSAGILNWPESHGHYNRLGLALYGASPIGDSPKSQPLIPAMTLQANIIAI 245

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
                GE V YG   +  R++ +A  AIGYADGYP                G   FI G 
Sbjct: 246 HTVNVGESVGYGNNWQAERETKLATVAIGYADGYPRNAKS-----------GTPVFINGA 294

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
             P++G+++MDM   DITD     +GD ++++G ++ +D VA  S T NY+LL R+  R 
Sbjct: 295 QAPLVGRVSMDMITVDITDLKHTAIGDTVELWGKNLSIDIVAQNSDTINYELLTRVSKRV 354

Query: 366 AKFYT 370
            + +T
Sbjct: 355 PRVFT 359


>gi|77919828|ref|YP_357643.1| alanine racemase [Pelobacter carbinolicus DSM 2380]
 gi|77545911|gb|ABA89473.1| alanine racemase [Pelobacter carbinolicus DSM 2380]
          Length = 378

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 128/382 (33%), Positives = 189/382 (49%), Gaps = 40/382 (10%)

Query: 8   RLKIDLTALKNNWHSMNALSGNAR-TAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           R++IDL ALK+N++    L+G  +   AVVK +AYG G   +A AL   GV+ F V  VE
Sbjct: 11  RVEIDLEALKHNFYQAQRLAGPGQGVLAVVKADAYGHGAAHVAMALQGVGVEMFGVAIVE 70

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC----GVSH 122
           EGV LR       I VL G++PGQE+ +    L+P +     +    +L SC    GV  
Sbjct: 71  EGVALREAGVVCPILVLGGLYPGQEENLLRYGLVPTLFD---MDVARRLDSCARAAGVVL 127

Query: 123 PYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLS-----LIISHLACADDPSSHVNSV 177
           PY ++VDTG +R+G    +          ++LG LS      + SHLA AD+P + VN  
Sbjct: 128 PYHMKVDTGMSRVGFRPDDL-----PRVLEELGALSGLRMDGLFSHLAMADEPENTVNQK 182

Query: 178 QLERFRTLISHYKGIE-----ASLASSSGILLGPNYHFQLTRPGISLYGG--TDKINKSH 230
           QLE FR  +   +          L++S+ +L        L+RPGI LYG   +       
Sbjct: 183 QLEIFRGCLDRVRQAGFAPRYVHLSNSAALLTREVPECNLSRPGILLYGALPSPAFAGRF 242

Query: 231 PMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEH 290
            ++ V++   RI  IRK   G  VSYG +    R +++AV  +GYADGY   LS +    
Sbjct: 243 DLKPVMSFRTRIAQIRKVPEGTGVSYGHRFVAERPTVLAVIPVGYADGYSRQLSNV---- 298

Query: 291 SPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDV 346
                  G+  ++G    + G + MD TM D+TD   + VGD + + G D    I  D+ 
Sbjct: 299 -------GEMLVRGQRARVAGTVCMDWTMIDVTDIPDVAVGDEVTLLGCDNGQCITADEW 351

Query: 347 ALASGTTNYDLLVRIGTRYAKF 368
           A   GT +Y++  +   R  + 
Sbjct: 352 AERIGTISYEVFCQFSKRVPRL 373


>gi|323974227|gb|EGB69357.1| alanine racemase domain-containing protein [Escherichia coli
           TW10509]
          Length = 355

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 113/359 (31%), Positives = 179/359 (49%), Gaps = 15/359 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           + ++L A+ +N+ ++      A+  AV+K NAYGLG E IAPALY A  + FFV  + EG
Sbjct: 1   MCVNLAAIVDNYRTLARHVAPAQCGAVLKANAYGLGAEAIAPALYAANCRIFFVAQLSEG 60

Query: 69  VKLRLYTP-QARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVS-HPYAL 126
           V LR   P  A + VL G+ P      +   + P+++S+ Q+  +  L+          +
Sbjct: 61  VALRKILPTDAMVVVLNGVMPEAMAYCYAQQITPLLNSIDQVMAWLTLLETRQQRRAVMI 120

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G +RLG+  Q+ +        +       IISHLA AD P   +N  Q   F+   
Sbjct: 121 QLDSGMSRLGVMPQQLMRLAAIFRERNWPAPDYIISHLANADRPDHALNVAQHALFQQAK 180

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + +     SLA+S G+ L P +   L RPGI+L+ G  +   S P++   T    I+ ++
Sbjct: 181 TVFPSSRFSLANSCGMFLQPGWREDLCRPGIALF-GVAQPWFSRPLKPAFTLTLTILRVQ 239

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AG  V YG     TR   IA  + GYADG P  +        P+    G  + +G  
Sbjct: 240 DVPAGTPVGYGSTITATRPLRIATISAGYADGVPRNM------RPPA----GVCW-RGVR 288

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           +P+LG++ MD  M D   +++   GD ++  G    L+ VA A  T  Y+++ R+G R+
Sbjct: 289 LPVLGRVCMDSFMVD-ASAVTPTAGDKVEFIGAGQTLEQVAAACNTIPYEIMTRLGARF 346


>gi|221133975|ref|ZP_03560280.1| alanine racemase [Glaciecola sp. HTCC2999]
          Length = 367

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 124/372 (33%), Positives = 196/372 (52%), Gaps = 29/372 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSVEEGV 69
           ID+ AL +N+H     +  ++T AV+K + YG G  KIA  L  A V D F V  ++E +
Sbjct: 9   IDINALLHNYHQAKNAAPQSQTMAVIKADGYGHGMLKIAQCL--ADVADGFAVAFIDEAI 66

Query: 70  KLRLYTPQARIFVLYGIHPGQEKII-FDTNLIPVISSVPQLTF---YSKLMSCGVSHPYA 125
             R       I VL G H  ++ ++  D +L  V+    Q+ +   +   +S   + P  
Sbjct: 67  ACRDAGLTQPILVLEGAHSPEDIVLAVDYDLWLVMHQPEQIDWLVEFDATLSVDETKPTV 126

Query: 126 -LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
             + DTG +RLGLS  E L+        +    ++++ H ACADD S+ +N+ QL +   
Sbjct: 127 WFKCDTGLHRLGLSPNE-LETALRRVPSEYLDNAVLMGHFACADDLSNPMNAHQLTQLND 185

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQT------VVTA 238
           L + Y+ +  S+A+S  I+   + H Q  R GI+LYG  + +N+S  +Q+      V+T 
Sbjct: 186 LANRYQ-LPISMANSPAIVADTDSHGQWNRLGIALYGA-EPLNRSSAVQSNVVLKPVMTL 243

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            A II +R+   G+ V YG   +  R S+IA  AIGY DGYP         H+PS   G 
Sbjct: 244 TAAIIGLRQIQPGDAVGYGQTWQAQRPSMIATVAIGYGDGYP--------RHAPS---GT 292

Query: 299 KGFIKGYMVPILGKITMDMTMFDITD-SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
             F++G  VP++G+++MDM   D+TD S    +GD ++++G ++ +  VA    T NY+L
Sbjct: 293 PVFLQGQTVPLVGRVSMDMITVDVTDLSQVPNIGDMVELWGANLSVTTVAAHINTINYEL 352

Query: 358 LVRIGTRYAKFY 369
           + RI  R  K Y
Sbjct: 353 VTRISPRVTKTY 364


>gi|304312030|ref|YP_003811628.1| Alanine racemase, catabolic [gamma proteobacterium HdN1]
 gi|301797763|emb|CBL45985.1| Alanine racemase, catabolic [gamma proteobacterium HdN1]
          Length = 362

 Score =  173 bits (438), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 120/373 (32%), Positives = 201/373 (53%), Gaps = 29/373 (7%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           R  +D++AL++N+  +  L+   R  A++K +AYG G   IA AL +A    F V  + E
Sbjct: 6   RAVVDISALRHNYQRLRTLAQGRRVMALMKADAYGHGALGIASALPDADA--FGVAYLGE 63

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA-- 125
            V+LR    +A I +L G     E        + V+  + Q      L +  +S P    
Sbjct: 64  AVQLREAGVRAPIVLLEGAMAIDELAYAAALDLAVV--IHQHEQLQWLKNSSLSRPLTIW 121

Query: 126 LQVDTGFNRLGLSLQEA------LDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQL 179
           L+VDTG +RLG++  EA      L+    + + K+ ++ +++SHLACAD P   + + QL
Sbjct: 122 LKVDTGMHRLGIAPSEAASVLAELECLQRAPDPKVREV-VVMSHLACADLPDHPMTAQQL 180

Query: 180 ERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVV 236
           + F+  ++   G + S+A+S+G+LLG ++ F   RPGI LYGG+ + ++S     ++ V+
Sbjct: 181 KAFQE-VTRGVGGQRSIANSAGLLLGDDFGFDWVRPGIMLYGGSPRNDRSAEQLGLRAVM 239

Query: 237 TAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFL 296
              A II IR   AGE V YG      RD+ + + A+GY DGYP         H   V  
Sbjct: 240 KLVAPIIAIRTVAAGESVGYGASWVAERDTRVGIVAVGYGDGYP--------RH---VRA 288

Query: 297 GGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYD 356
           G    + G    +LG+++MDM   D++ +++ ++GD ++++GP + ++ VA  +GT NY+
Sbjct: 289 GACVLLHGCECLLLGRVSMDMLAIDLS-AVNAQLGDEVELWGPSLPVERVANWAGTINYE 347

Query: 357 LLVRIGTRYAKFY 369
           L  +I  R  + Y
Sbjct: 348 LFCQITGRVRREY 360


>gi|261322850|ref|ZP_05962047.1| alanine racemase [Brucella neotomae 5K33]
 gi|261298830|gb|EEY02327.1| alanine racemase [Brucella neotomae 5K33]
          Length = 314

 Score =  172 bits (437), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 107/281 (38%), Positives = 152/281 (54%), Gaps = 15/281 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N+ ++       RTAAVVK +AYGLG  ++APA Y AG +DFFV  + E 
Sbjct: 21  LTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRVAPAFYEAGCRDFFVAHLGEA 80

Query: 69  VKLRLY-TPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
           V L+ +  P A ++VL G+ PG E       ++PV++S+ Q+  ++ L +  G   P  L
Sbjct: 81  VALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLEQVENWAALATRLGKKLPALL 140

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGLS +E      N        +   ISHLA  D+P +  N+ QL +   L+
Sbjct: 141 QFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLANGDEPGNAANARQLAKMTALL 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--------GTDKI---NK--SHPMQ 233
           +    + A+LA+S G  LG  Y+F L RPGI+LYG         +DK+   NK   H + 
Sbjct: 201 ARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPERQHDFSDKVAHENKKPKHSIL 260

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIG 274
            V+T  AR+I +R    G  V YGG         IA  A+G
Sbjct: 261 PVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAVG 301


>gi|218551070|ref|YP_002384861.1| Alanine racemase 3 [Escherichia fergusonii ATCC 35469]
 gi|218358611|emb|CAQ91259.1| Alanine racemase 3 [Escherichia fergusonii ATCC 35469]
          Length = 388

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 116/362 (32%), Positives = 180/362 (49%), Gaps = 15/362 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           + I+  A+ +N+  +   +  A+  AV+K NAYGLG E IAPALY A  + FFV  + EG
Sbjct: 34  MCINRAAIVDNYRMLARHAAPAQCGAVLKANAYGLGAETIAPALYAANCRIFFVAQLSEG 93

Query: 69  VKLRLYTP-QARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVS-HPYAL 126
           V LR   P  A + VL G+ P      F   + P+++S+ Q+  +  L+          +
Sbjct: 94  VALRKILPTDAMVVVLNGVMPEAMVFCFAQQITPLLNSIDQVMAWLTLLETRQQRRAVMI 153

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G +RLG+  Q+ +        +       IISHLA AD P   +N VQ  R +   
Sbjct: 154 QLDSGMSRLGVMSQQLMRLAAIFRERNWPAPDYIISHLANADRPDHALNMVQHARLQQAK 213

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + +     SLA+S G+ L   +   L RPGI+L+G T     S  ++ V T    I+ ++
Sbjct: 214 AVFPSSRFSLANSCGMFLHLGWREDLCRPGIALFGVTQPWF-SRLLKPVFTLTLTILRVQ 272

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AG  V YG     TR   IA  + GYADG P  +        P+    G  + +G  
Sbjct: 273 DVPAGTPVGYGSTVTATRPLRIATISAGYADGVPRNM------RPPA----GVCW-RGVR 321

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
           +P+LG++ MD  M D   ++S   GD ++  G    L++VA A  T  Y+++ R+G R+ 
Sbjct: 322 LPVLGRVCMDSFMVD-ASAVSPTAGDVVEFIGTGQTLEEVAAACDTIPYEIMTRLGARFQ 380

Query: 367 KF 368
           + 
Sbjct: 381 RI 382


>gi|13488309|ref|NP_085891.1| alanine racemase [Mesorhizobium loti MAFF303099]
 gi|20137422|sp|Q981H7|ALR3_RHILO RecName: Full=Alanine racemase 3
 gi|14028426|dbj|BAB54978.1| alanine racemase [Mesorhizobium loti MAFF303099]
          Length = 388

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 120/374 (32%), Positives = 189/374 (50%), Gaps = 38/374 (10%)

Query: 9   LKIDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L+IDL+A++ N+ +++AL G   R AAVVK +AYGLG  K+A AL +AG    FV ++ E
Sbjct: 12  LEIDLSAIQANFQTISALVGPQVRVAAVVKSDAYGLGLVKVAGALIDAGCDLLFVGNLHE 71

Query: 68  GVKLRLYTPQARI------FVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGV 120
            + LR     A +      F  YG H       + +N LIPV+++  +L        CG 
Sbjct: 72  ALLLRSSHISAAVAVFCDEFARYGEH-------YRSNGLIPVVNNSVELDAI-----CGA 119

Query: 121 SHP--YALQVDTGFNRLGLSLQEALD-FTHNSFNKKLGQLSLIISHLACADDPSSHVNSV 177
             P  Y L V+TG +RLGL+  +    +    F ++    S+++SHLAC++     +N +
Sbjct: 120 REPQAYFLNVETGLSRLGLAFDDVRRRYLGGIFKRR--PPSVVLSHLACSERAGDAMNLL 177

Query: 178 QLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVT 237
           Q  RFR      K    SLA+S+G+ LG  YHF + R G +LYG      + +P++ VV 
Sbjct: 178 QWNRFRATSDLLKPTLLSLAASAGVWLGKRYHFDMVRVGSALYGLNSAGIRPNPLKPVVG 237

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
            +A+ +  R     E V YG   +  R S +A+A IGY  G P   +   S         
Sbjct: 238 VKAKTLDARNVARSEAVGYGATFRTGRASRLAIAGIGYKHGLPWACANKISVR------- 290

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEV--GDYIQIFGPDIKLDDVALASGTTNY 355
                 GY  P++G+++M+    D+TD        G  +++   D  +DD+A ++G    
Sbjct: 291 ----FAGYSAPLVGRVSMEYITIDVTDVPEALCGPGTNVELLSDDFTVDDLAASAGVHPQ 346

Query: 356 DLLVRIGTRYAKFY 369
           ++L R+G   A+ Y
Sbjct: 347 EVLTRLGVGCARQY 360


>gi|304319746|ref|YP_003853389.1| alanine racemase region protein [Parvularcula bermudensis HTCC2503]
 gi|303298649|gb|ADM08248.1| alanine racemase region protein [Parvularcula bermudensis HTCC2503]
          Length = 382

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 127/375 (33%), Positives = 185/375 (49%), Gaps = 32/375 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGN-ARTAAVVKDNAYGLGCEKIAPALY-NAGVQDFFVTSVE 66
           L +DL AL  N+  +   +G  +  A VVK NAYGLG   IA  LY   G + FF  +  
Sbjct: 10  LTVDLGALGRNYDELKRRTGGTSAVAPVVKANAYGLGMHAIARTLYREKGARLFFTATCR 69

Query: 67  EGVKL-----RLYT-PQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGV 120
           E + L     R +     R++VL G   G   +      +P++S    +  +      G 
Sbjct: 70  EALALLVDGQRFFDDAPPRVYVLNGFD-GDRALQEKVGYLPILSDWQDVGDWV----AGG 124

Query: 121 SHPYALQVDTGFNRLGLSLQEALDFTHNS-FNKKLGQLSLIISHLACADDPSSHVNSVQL 179
             P  + VD G NRLG+S Q+A     ++  N     + LI+ HL+ + DP++  N +Q 
Sbjct: 125 GGPCGISVDIGMNRLGMSFQDAGGLPQDTRLNPD--DVQLIMMHLSHSGDPTAPENELQA 182

Query: 180 ERFRT----LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTV 235
           E+F T    L   Y   + SL++S GILLG     Q+ R G +LYGG         +  V
Sbjct: 183 EKFFTSGMMLARLYPKAQFSLSNSGGILLGLAPEQQIVRAGYALYGGAPNGLPGQGLDQV 242

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
            T EA ++ +R   +GE V Y G  +  R + +AV   GYADG    LS     +  +V+
Sbjct: 243 TTFEASVLQVRDIGSGESVGYNGTWRAERPTRLAVLGAGYADGIQRALS-----NRGAVW 297

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLS-IEVGDYIQIFGPDIKLDDVALASGTTN 354
           LGG       + PI G ++MD+   DITD+ S +  GD  +I+G  I LD VA  +GT  
Sbjct: 298 LGGG------LCPIRGAVSMDLVTVDITDAPSPVTRGDKAEIWGAQIDLDLVARQAGTIG 351

Query: 355 YDLLVRIGTRYAKFY 369
           YDLL  +G+R  + Y
Sbjct: 352 YDLLTGVGSRVERIY 366


>gi|222080194|ref|YP_002540057.1| alanine racemase [Agrobacterium vitis S4]
 gi|221738839|gb|ACM39618.1| alanine racemase [Agrobacterium vitis S4]
          Length = 294

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/271 (37%), Positives = 142/271 (52%), Gaps = 3/271 (1%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL  N+  +  ++    TAAVVK +AYGLG E++A  LY  G + FFV    E 
Sbjct: 24  LTIDLGALSRNYELLAGMAAPGNTAAVVKADAYGLGAERVARTLYAKGCRHFFVAQFIEA 83

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYAL 126
            +LR   +  ARIFVL G+ PG E +    N++PVI+S+ Q    ++     G   P  +
Sbjct: 84  TRLRPALSYDARIFVLNGLQPGNEDVCAYENIVPVINSMDQWRNRNRTARRLGRRLPIVV 143

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q DTG +RLGL  +E               +  ++SHLA ADD  S  N  QLE  R + 
Sbjct: 144 QFDTGMSRLGLPPEERPLLAEAVAQGSDVDILFLMSHLASADDEKSAQNGEQLEELRKIA 203

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
           + + G + S A+S GI LG +Y   L RPGI+LYGG     + +PM+ VV  +  ++  R
Sbjct: 204 AEFPGYDLSFANSGGIFLGDDYRGLLARPGIALYGGAPSAAR-NPMEAVVRLDVAVVQTR 262

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYAD 277
                  V YGG    TR++ +A  A G  D
Sbjct: 263 TVPGSTKVGYGGAHVTTRETRLATIAAGECD 293


>gi|284107226|ref|ZP_06386367.1| Alanine racemase [Candidatus Poribacteria sp. WGA-A3]
 gi|283829973|gb|EFC34252.1| Alanine racemase [Candidatus Poribacteria sp. WGA-A3]
          Length = 386

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 121/371 (32%), Positives = 182/371 (49%), Gaps = 23/371 (6%)

Query: 11  IDLTALKNNWHSMN-ALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           IDL AL +N   +   L+      AV+K N YG G + +A AL   GV+ F V SV EGV
Sbjct: 14  IDLNALAHNLRELRRVLAPRVDILAVIKANGYGHGYKALAEALSQLGVRRFGVASVHEGV 73

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYALQV 128
            LR       + V+ G+ PGQ K +   NLIP +S    +   S+ +S     +P  ++V
Sbjct: 74  LLREAGRLEDVIVMGGMLPGQVKDLVHANLIPTLSDADTMHALSREVSQHDRPYPIHVKV 133

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           DTG  RLG + +E L    +     L     +++HLA AD+P      +QL+RF   +S 
Sbjct: 134 DTGMRRLGFTTREVLPLLQSPAFSHLLSCQGLMTHLADADNPDPAFTLLQLDRFHETVSS 193

Query: 189 YKG----IEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP--MQTVVTAEARI 242
                       A+++ IL  P  H  + RPG+ LYG T   ++  P  +Q V++   ++
Sbjct: 194 LPANGPRPWRHAANTAAILWHPRAHLDMVRPGLLLYGYTPAQDRDVPVSLQPVLSLTTKV 253

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           + ++ A  GE VSYG   +  RDS +A+  IGYA GY   LS             G+  I
Sbjct: 254 VHLKTAGKGEPVSYGDLYRTRRDSRLAILPIGYAHGYNRRLSNT-----------GEVII 302

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALASGTTNYDLL 358
                PI+G+I MDMT+ D+TD  +I+ GD + + G      I   D+A    +  Y++L
Sbjct: 303 HDRRFPIVGRICMDMTVVDVTDDPTIKQGDDVILMGRSATQAITAYDLANWQDSIPYEVL 362

Query: 359 VRIGTRYAKFY 369
             +G    + Y
Sbjct: 363 CNLGPNVPREY 373


>gi|149918225|ref|ZP_01906717.1| alanine racemase [Plesiocystis pacifica SIR-1]
 gi|149820985|gb|EDM80392.1| alanine racemase [Plesiocystis pacifica SIR-1]
          Length = 402

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 112/341 (32%), Positives = 180/341 (52%), Gaps = 25/341 (7%)

Query: 11  IDLTALKNNWHSMNALSGN-ARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +D  AL +N  ++ A  G   R  AVVK + YG G  + A A  +AG     V+ VEEGV
Sbjct: 38  VDEGALAHNLRTVQAHVGERCRVLAVVKADGYGHGAVESARAFVDAGAWGLAVSLVEEGV 97

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVP--QLTFYSKLMSCGVSHPYALQ 127
           +LR +  +A + VL G+HPG E +I    L PV+ S    QL   +   S   + P  ++
Sbjct: 98  ELRQHGVRAPVLVLSGVHPGSEDVIVHGALTPVVWSPQHFQLLTSAVRRSGAATLPVHIK 157

Query: 128 VDTGFNRLGL---SLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSV-QLERFR 183
           +DTG +RLG+    L   LD+       +L ++  +++H ACADD    + S  QLERF+
Sbjct: 158 IDTGMSRLGVLPEDLGALLDWYQAHAASEL-RIEGVMTHFACADDAEDALTSARQLERFQ 216

Query: 184 TLIS--HYKGIEASL---ASSSGILLGPNYHFQLTRPGISLYG-GTDKINKSHPMQTVVT 237
             +     + I  S+    +S+G++     H  + RPGI+LYG G+ +  +   ++  + 
Sbjct: 217 ACLRVLGERRIHPSIRHVCNSAGLVRFSEAHLDMVRPGIALYGAGSSRAVELPELRMAMG 276

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             +R++ IR+  AG  VSYG ++ L R S + +  +GY DGYP T+SG            
Sbjct: 277 VHSRLLGIRELPAGTAVSYGHRQVLDRPSRLGIVPVGYGDGYPRTMSGR----------- 325

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFG 338
            +  I+G+  P++G ITMD++M D+T+      G+ + + G
Sbjct: 326 AQMLIRGHRCPVVGNITMDLSMVDVTELPDAREGERVTLMG 366


>gi|114777489|ref|ZP_01452486.1| biosynthetic alanine racemase [Mariprofundus ferrooxydans PV-1]
 gi|114552271|gb|EAU54773.1| biosynthetic alanine racemase [Mariprofundus ferrooxydans PV-1]
          Length = 358

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 119/365 (32%), Positives = 177/365 (48%), Gaps = 26/365 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L  L +N+  +   + +A   AVVK NAYG G   +APAL+ AG + F VT  +EG K
Sbjct: 9   INLDHLCHNYRLLQQAATDASVMAVVKANAYGHGLNLVAPALFRAGCRLFAVTDADEGAK 68

Query: 71  LRLY------TPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP 123
           LR             I +L GI   G   +    +L P IS   Q      L +      
Sbjct: 69  LRNILRSDDPAGDTEIALLSGIFDAGDASLATTEHLTPTISDSAQCDM---LQAADFDGA 125

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR 183
             ++VDTG NRLG +  + L          + Q+   +SHLACAD P   +N  Q ERF 
Sbjct: 126 AWIKVDTGMNRLGAAEPQVL--IRQCLQAGI-QIRGFMSHLACADTPLHPMNRQQAERFA 182

Query: 184 TLISHYK-GIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARI 242
           +L       +  SL +S+GI+  P+    + RPGI+LYG      K   ++ V+   AR+
Sbjct: 183 SLCDQAAPQLPRSLLNSAGIISMPDQCLDVVRPGIALYGAEPVAEKPMGLKPVMRMTARV 242

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R   AGE VSY           IA+ + GYADG P  LSG            G+   
Sbjct: 243 IQVRDIKAGETVSYSASFTAETSMRIAIVSAGYADGIPRALSGC-----------GQASC 291

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
              ++P+ G++ MD TM +++D+ +I+ GD ++ +G ++  +DVA    T +Y L   +G
Sbjct: 292 HDRLLPVTGRVCMDYTMLNVSDT-NIQSGDNVEFWGMELAANDVASMIDTISYTLFTGVG 350

Query: 363 TRYAK 367
            R  +
Sbjct: 351 ERVRR 355


>gi|146283965|ref|YP_001174118.1| alanine racemase, catabolic [Pseudomonas stutzeri A1501]
 gi|166969424|sp|A4VQM5|ALR_PSEU5 RecName: Full=Alanine racemase
 gi|145572170|gb|ABP81276.1| alanine racemase, catabolic [Pseudomonas stutzeri A1501]
          Length = 358

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 183/367 (49%), Gaps = 26/367 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DLTAL++N+      +   +  AVVK NAYG G  +   AL       F V  +EE   
Sbjct: 8   VDLTALRHNYLLAKQCAPQRKAFAVVKANAYGHGAPEAVTALREIA-DGFAVACLEEAEV 66

Query: 71  LRLYTPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YALQ 127
           +R   P+ARI +L G   P +     +  L   +    Q  +   L++  ++ P    L+
Sbjct: 67  IRGCAPEARILLLEGCFEPSEYLRAAELGLDIAVQDARQADW---LLAADLARPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFN--KKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +D+G +RLG S+ + L   H       ++G+L+LI SH ACAD+    +   QLER+  L
Sbjct: 124 LDSGMHRLGFSV-DGLRECHARLKGAAQVGELNLI-SHFACADERGHALTETQLERYAEL 181

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARI 242
           +        SLA+S+ +L  P  H    RPGI LYG T   +   +   ++ V+T    +
Sbjct: 182 L-ELPFEHCSLANSAAVLTLPQAHMAWIRPGIMLYGATPFAELSARELGLKPVMTLTGAL 240

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R    GE V YG      R S I   + GYADGYP T        +PS   G    I
Sbjct: 241 IAVRDVPVGESVGYGASWVAQRPSRIGTVSCGYADGYPRT--------APS---GTSVVI 289

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  VP+ G+++MDM   D+TD    ++GD ++++G  + +D++A A GT  Y+LL ++ 
Sbjct: 290 HGQRVPLAGRVSMDMLAVDLTDLPQAQLGDAVELWGAQMPIDELAQACGTIGYELLTKVT 349

Query: 363 TRYAKFY 369
            R  + Y
Sbjct: 350 GRVPRRY 356


>gi|238918209|ref|YP_002931723.1| alanine racemase [Edwardsiella ictaluri 93-146]
 gi|259710066|sp|C5BCC5|ALR_EDWI9 RecName: Full=Alanine racemase
 gi|238867777|gb|ACR67488.1| alanine racemase, putative [Edwardsiella ictaluri 93-146]
          Length = 363

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 187/368 (50%), Gaps = 26/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N+  +   + ++R  AVVK NAYG G  + A  L  A    + V  + E + 
Sbjct: 8   IDRRALRHNFQQIRKFAPHSRLIAVVKANAYGHGLLETAKILNQADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +  ++   N+   + S  QL     L + G+  P    ++
Sbjct: 66  LRSGGIVKPILLLEGFFSASDLPVLVANNIETAVHSEEQL---QALENAGLERPIRVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++A  F         + Q    +SH +CAD+P S    VQL  F   +
Sbjct: 123 LDTGMHRLGVRPEQAEAFYRRLCACPNVAQPVNFMSHFSCADEPDSGRTEVQLACFDDFV 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS-----HPMQTVVTAEAR 241
               G E S+A+S GILL P  H  + RPGI +YG + + + S     + +Q  +T ++ 
Sbjct: 183 RGKTG-EQSIAASGGILLWPQSHRDMVRPGIIMYGVSPQADLSLAADHYGLQPAMTLQSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ + V AIGY DGYP +        +PS   G    
Sbjct: 242 LIAVREHKAGEPVGYGGAWVAQRDTRLGVVAIGYGDGYPRS--------APS---GTPVL 290

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           I G  VPI+G+++MDM   D+    +  VGD + ++GP + ++ VA  +G + Y+L+ ++
Sbjct: 291 INGREVPIVGRVSMDMISVDLGPQAADRVGDNVIMWGPGLPVEKVAACTGISAYELITKL 350

Query: 362 GTRYAKFY 369
            +R A  Y
Sbjct: 351 TSRVAMEY 358


>gi|183597310|ref|ZP_02958803.1| hypothetical protein PROSTU_00561 [Providencia stuartii ATCC 25827]
 gi|188023331|gb|EDU61371.1| hypothetical protein PROSTU_00561 [Providencia stuartii ATCC 25827]
          Length = 360

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 114/366 (31%), Positives = 196/366 (53%), Gaps = 23/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+ ++R  A+VK NAYG G  +++  L +  V  F V  ++E + 
Sbjct: 8   INRRALRHNLQRVRELAPHSRLIAIVKANAYGHGLTEVSTTLEDL-VDGFGVARLKEALA 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR     A I +L G     +  ++ +  +  VI  V QL     L +  +++P    ++
Sbjct: 67  LRERGITAPIVLLEGFFEHSDLPLLVEHQIDTVIHCVEQLAM---LEATELANPIKVWMK 123

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  Q+A  F       K +     IISH   AD+P     + Q+  F+  +
Sbjct: 124 LDTGMHRLGVLPQDAEAFYQRLQACKNVKHPINIISHFCQADEPELPTTANQIHCFKQFV 183

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
           ++  G E S+A+S+GILL P+ H+   RPGI +YG + +   S     +Q+V+T ++ +I
Sbjct: 184 ANKAG-EKSIAASAGILLWPDAHYDWVRPGIIMYGASPQEGTSAEHFGLQSVMTLKSTLI 242

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+  AG+ V YG      RD+ + V AIGY DGYP +        +PS   G    + 
Sbjct: 243 AVREHAAGQCVGYGATWCSQRDTRLGVVAIGYGDGYPRS--------APS---GTPVLVN 291

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI+G+++MDM   D+  + + +VGD + ++G  + ++++A  +G  NY+LL ++ +
Sbjct: 292 GRKVPIVGRVSMDMITVDLGPNANDKVGDEVILWGKSLPVEEIAAQTGIINYELLTKLTS 351

Query: 364 RYAKFY 369
           R    Y
Sbjct: 352 RVVMEY 357


>gi|254230408|ref|ZP_04923789.1| alanine racemase [Vibrio sp. Ex25]
 gi|151937067|gb|EDN55944.1| alanine racemase [Vibrio sp. Ex25]
          Length = 366

 Score =  169 bits (428), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 189/367 (51%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL+AL++N   + A +  ++  AVVK N YG G   +A    +A    F V  +EE ++
Sbjct: 16  IDLSALQHNLQRVKAQAPQSKVMAVVKANGYGHGLRHVAKHANHADA--FGVARIEEALQ 73

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 74  LRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQLI---ALEQADLETPVVVWLK 130

Query: 128 VDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++  +F T       + +    +SH  CAD+  SH+   Q+E F++L 
Sbjct: 131 IDSGMHRLGVRPEQYDEFVTRLKECPNVAKPLRYMSHFGCADELDSHITPQQIELFKSLT 190

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           S  +G E SLA+S+G+L  P  H    RPGI +YG +   DK  +    Q V+T ++ +I
Sbjct: 191 SGCQG-ERSLAASAGLLAWPQSHLDWVRPGIIMYGVSPFDDKTAQDLGYQPVMTLKSHLI 249

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YGG     RD+ + V A+GY DGYP +        +P+   G   ++ 
Sbjct: 250 AVREVKKGESVGYGGMWTSKRDTKVGVIAVGYGDGYPRS--------APN---GTPVWVN 298

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI G+++MDM   D+    + +V D   ++G ++ +++VA   GT  Y+L+ ++  
Sbjct: 299 GRKVPIAGRVSMDMLTVDLGPDATDKVSDEAILWGKELPVEEVAGHIGTIAYELVTKLTP 358

Query: 364 RYAKFYT 370
           R    Y+
Sbjct: 359 RVEMEYS 365


>gi|260773727|ref|ZP_05882642.1| alanine racemase biosynthetic [Vibrio metschnikovii CIP 69.14]
 gi|260610688|gb|EEX35892.1| alanine racemase biosynthetic [Vibrio metschnikovii CIP 69.14]
          Length = 366

 Score =  169 bits (428), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 123/368 (33%), Positives = 191/368 (51%), Gaps = 28/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFF-VTSVEEGV 69
           IDL AL++N+  + +LSG  +  AV+K +AYG G  ++A AL  A   D+F V  VEE  
Sbjct: 8   IDLIALRHNYLRLKSLSGQQKLIAVIKGDAYGHGAVQLAKALPMA---DWFAVARVEEAE 64

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
           +L        + +L G     + +   D  L  VI    QL     L    +++P +  L
Sbjct: 65  ELIANGIDQPVLLLEGCFCADDLQRAADLKLATVIHCEEQL---RDLEQSNLANPISIWL 121

Query: 127 QVDTGFNRLGLSLQEALDFTH--NSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           ++DTG +RLG+  ++  ++        K  GQL  + SH +CADD S      Q+E F  
Sbjct: 122 KIDTGMHRLGVQPEQVTEYVQRIERSGKLKGQLGFM-SHFSCADDLSHPATLKQIECFSQ 180

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS---HPMQTVVTAEAR 241
               Y G + SLA+S+GIL  P   F + R GI+LYG +  +  S   H +  V+T   R
Sbjct: 181 AAFPYSGPK-SLANSAGILFWPESQFNVARAGIALYGISPSLYHSGIDHQLLPVMTVTTR 239

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  A + V YG      RD+ I V A+GY DGYP +        +P+   G   F
Sbjct: 240 LIAVRQHTANQPVGYGETWYAKRDTKIGVIAMGYGDGYPRS--------APA---GTPVF 288

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           I G  VPI+G+++MDM   D+      +VGD ++++G ++ ++ VA   GT  Y+L +++
Sbjct: 289 INGRQVPIVGRVSMDMITVDLGPDAMDKVGDSVEMWGKNLPVETVAKHIGTIPYELTIKL 348

Query: 362 GTRYAKFY 369
             R A+ Y
Sbjct: 349 TNRVARHY 356


>gi|262393111|ref|YP_003284965.1| alanine racemase biosynthetic [Vibrio sp. Ex25]
 gi|262336705|gb|ACY50500.1| alanine racemase biosynthetic [Vibrio sp. Ex25]
          Length = 361

 Score =  169 bits (427), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 189/367 (51%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL+AL++N   + A +  ++  AVVK N YG G   +A    +A    F V  +EE ++
Sbjct: 11  IDLSALQHNLQRVKAQAPQSKVMAVVKANGYGHGLRHVAKHANHADA--FGVARIEEALQ 68

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 69  LRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQLI---ALEQADLETPVVVWLK 125

Query: 128 VDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++  +F T       + +    +SH  CAD+  SH+   Q+E F++L 
Sbjct: 126 IDSGMHRLGVRPEQYDEFVTRLKECPNVAKPLRYMSHFGCADELDSHITPQQIELFKSLT 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           S  +G E SLA+S+G+L  P  H    RPGI +YG +   DK  +    Q V+T ++ +I
Sbjct: 186 SGCQG-ERSLAASAGLLAWPQSHLDWVRPGIIMYGVSPFDDKTAQDLGYQPVMTLKSHLI 244

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YGG     RD+ + V A+GY DGYP +        +P+   G   ++ 
Sbjct: 245 AVREVKKGESVGYGGMWTSKRDTKVGVIAVGYGDGYPRS--------APN---GTPVWVN 293

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI G+++MDM   D+    + +V D   ++G ++ +++VA   GT  Y+L+ ++  
Sbjct: 294 GRKVPIAGRVSMDMLTVDLGPDATDKVSDEAILWGKELPVEEVAGHIGTIAYELVTKLTP 353

Query: 364 RYAKFYT 370
           R    Y+
Sbjct: 354 RVEMEYS 360


>gi|327482293|gb|AEA85603.1| alanine racemase, catabolic [Pseudomonas stutzeri DSM 4166]
          Length = 358

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 118/367 (32%), Positives = 183/367 (49%), Gaps = 26/367 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DLTAL++N+      +   +  AVVK NAYG G  +   AL       F V  +EE   
Sbjct: 8   VDLTALRHNYLLAKQCAPQRKAFAVVKANAYGHGAPEAVTALREIA-DGFAVACLEEAEV 66

Query: 71  LRLYTPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YALQ 127
           +R   P+ARI +L G   P +     +  L   +    Q  +   L++  ++ P    L+
Sbjct: 67  IRGCAPEARILLLEGCFEPSEYLRAAELGLDIAVQDARQADW---LLAADLARPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFN--KKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +D+G +RLG S+ + L   H       ++G+L+LI SH ACAD+    +   QLER+  L
Sbjct: 124 LDSGMHRLGFSV-DGLRECHARLKGAPQVGELNLI-SHFACADERGHALTETQLERYAEL 181

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARI 242
           +        SLA+S+ ++  P  H    RPGI LYG T   +   +   ++ V+T    +
Sbjct: 182 L-ELPFEHCSLANSAAVVTLPQAHMAWIRPGIMLYGATPFAELSARELGLKPVMTLTGAL 240

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R    GE V YG      R S I   + GYADGYP T        +PS   G    I
Sbjct: 241 IAVRDVPVGESVGYGASWVAQRPSRIGTVSCGYADGYPRT--------APS---GTSVVI 289

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  VP+ G+++MDM   D+TD    ++GD ++++G  + +D++A A GT  Y+LL ++ 
Sbjct: 290 HGQRVPLAGRVSMDMLAVDLTDLPQAQLGDAVELWGAQMPIDELAQACGTIGYELLTKVT 349

Query: 363 TRYAKFY 369
            R  + Y
Sbjct: 350 GRVPRRY 356


>gi|261346560|ref|ZP_05974204.1| alanine racemase [Providencia rustigianii DSM 4541]
 gi|282565263|gb|EFB70798.1| alanine racemase [Providencia rustigianii DSM 4541]
          Length = 360

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 189/365 (51%), Gaps = 19/365 (5%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+ N+R  AVVK NAYG G   +   +    V  F V  + E + 
Sbjct: 8   INRRALRHNLQRVRELAPNSRLIAVVKANAYGHGLVGVGTEVQEL-VDGFGVARLNEALL 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR       I +L G     + +++ + N+  VI  V QL              + +++D
Sbjct: 67  LRHQGINKPIVLLEGFFEQSDLQLMVEYNIDTVIHCVEQLEMLESAQLAKQIKVW-MKLD 125

Query: 130 TGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTLISH 188
           TG +RLG+  Q A  F     + +   L + I+SH   AD P     + Q+E F+  +S 
Sbjct: 126 TGMHRLGVLPQHAESFYQRLQSCQNVDLPINIVSHFCQADAPELPTTAKQIECFQQFVSD 185

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARIILI 245
             G E S+A+S+GILL P  H+   RPGI +YG + +  KS     +  V+T ++ +I +
Sbjct: 186 KPG-EKSIAASAGILLWPEAHYDWVRPGIMMYGASPQEGKSAASFGLLPVMTLKSSLIAV 244

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+  AG+ V YG   +  R++L+ V AIGY DGYP  +        PS   G    + G 
Sbjct: 245 REHSAGQCVGYGETWRSERNTLLGVVAIGYGDGYPRNV--------PS---GTPVLVNGR 293

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
            VPI+G+I+MDMT+ D+    + +VGD + ++G  + ++++A  +G  NY+LL ++ +R 
Sbjct: 294 KVPIIGRISMDMTVVDLGPDSTDKVGDDVILWGNALPVEEIAAQTGIINYELLTKLTSRV 353

Query: 366 AKFYT 370
           A  Y 
Sbjct: 354 AMEYV 358


>gi|269964436|ref|ZP_06178677.1| alanine racemase [Vibrio alginolyticus 40B]
 gi|269830774|gb|EEZ84992.1| alanine racemase [Vibrio alginolyticus 40B]
          Length = 366

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 119/382 (31%), Positives = 194/382 (50%), Gaps = 29/382 (7%)

Query: 1   MHSNEFLRLK-----IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNA 55
           M SN    +K     IDL+AL++N   + A +  ++  AVVK N YG G   +A    +A
Sbjct: 1   MMSNPMSYMKAAKACIDLSALQHNLQRVKAQAPQSKVMAVVKANGYGHGLRHVAKHANHA 60

Query: 56  GVQDFFVTSVEEGVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSK 114
               F V  +EE ++LR       I +L G + PG   ++   N+  V+    QL     
Sbjct: 61  DA--FGVARIEEALQLRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQLI---A 115

Query: 115 LMSCGVSHPYA--LQVDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPS 171
           L    +  P    L++D+G +RLG+  ++  +F T       + +    +SH  CAD+  
Sbjct: 116 LEQADLETPVVVWLKIDSGMHRLGVRPEQYDEFVTRLKECPNVAKPLRYMSHFGCADELD 175

Query: 172 SHVNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINK 228
           S +   Q+ERF++L S  +G E SLA+S+G+L  P  H    RPGI +YG +   DK  +
Sbjct: 176 SDITPQQIERFKSLTSGCQG-ERSLAASAGLLAWPQSHLDWVRPGIIMYGVSPFDDKTAQ 234

Query: 229 SHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDS 288
               Q V+T ++ +I +R+   GE V YGG     RD+ + V A+GY DGYP +      
Sbjct: 235 DLGYQPVMTLKSHLIAVREVKKGESVGYGGIWTSERDTKVGVIAVGYGDGYPRS------ 288

Query: 289 EHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVAL 348
             +P+   G   ++ G  VPI G+++MDM   D+    + +V D   ++G ++ +++VA 
Sbjct: 289 --APN---GTPVWVNGRKVPIAGRVSMDMLTVDLGPDATDKVSDEAILWGKELPVEEVAG 343

Query: 349 ASGTTNYDLLVRIGTRYAKFYT 370
             GT  Y+L+ ++  R    Y+
Sbjct: 344 HIGTIAYELVTKLTPRVEMEYS 365


>gi|56415949|ref|YP_153024.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197364876|ref|YP_002144513.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|56130206|gb|AAV79712.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197096353|emb|CAR61958.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 368

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 110/362 (30%), Positives = 176/362 (48%), Gaps = 15/362 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+ +N+ ++      A+  AV+K N YGLG E IAPALY A  + FFV  + EG
Sbjct: 14  LCVDLAAVVDNYQTLARHVAPAQCGAVLKANGYGLGEEAIAPALYAANCRIFFVAQLSEG 73

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYAL 126
           V LR + +  A + +L G+ P    +     + P+++SV Q+  +  L        P  +
Sbjct: 74  VALRKILSADAMVVLLNGVMPQAMPLCCAQQITPLLNSVDQVMAWLALQEARSQRRPVLI 133

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G +RLG++ ++          +       IISHLA AD P   +N  Q    +   
Sbjct: 134 QLDSGMSRLGVTPEQLARLAAIFRQRGWAAPDYIISHLANADRPDHALNVYQHTLLQQAK 193

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
             +     SLA+S G+ L P +   L RPG++L+ G  +   S P++   T    I+ ++
Sbjct: 194 KAFPTSRYSLANSCGMFLHPAWREDLCRPGVALF-GVAQPWFSTPLKPAFTLTLTILRVQ 252

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G  + YG     TR   IA  + GYADG P  L            L G  + +G  
Sbjct: 253 DVPVGTPIGYGSTVTTTRPLRIATVSAGYADGIPRNLRP----------LAGVCW-RGVR 301

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
           +P+LG++ MD  M D +  +    GD ++  G    L++VA A  T  Y+++ R+G R+ 
Sbjct: 302 LPVLGRVCMDSFMVDASAIMPTS-GDVVEFIGVSQTLEEVAAACDTIPYEIIARLGARFR 360

Query: 367 KF 368
           + 
Sbjct: 361 RI 362


>gi|207859294|ref|YP_002245945.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|206711097|emb|CAR35471.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
          Length = 368

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 110/362 (30%), Positives = 177/362 (48%), Gaps = 15/362 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+ +N+ ++      A+  AV+K N YGLG E IAPALY A  + FFV  + EG
Sbjct: 14  LCVDLAAVVDNYQTLARHVAPAQCGAVLKANGYGLGAEAIAPALYAANCRIFFVAQLSEG 73

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYAL 126
           V LR + +  A + +L G+ P    +     + P+++SV Q+  +  L        P  +
Sbjct: 74  VALRKILSADAMVVLLNGVMPQAMPLCCAQQITPLLNSVDQVMAWLALQEARSQRRPVLI 133

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G +RLG++ ++          +       IISHLA AD P   +N  Q    +   
Sbjct: 134 QLDSGMSRLGVTPEQLARLAAIFRQRGWAAPDYIISHLANADRPDHALNVYQHTLLQQAK 193

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
             +     SLA+S G+ L P +   L RPG++L+ G  +   S P++   T    I+ ++
Sbjct: 194 EAFPTSRYSLANSCGMFLHPAWREDLCRPGVALF-GVAQPWFSTPLKPAFTLTLSILRVQ 252

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G  + YG     TR   IA  + GYADG P  L        P+    G  + +G  
Sbjct: 253 DVPVGTPIGYGSTVTTTRPLRIATVSAGYADGIPRNL------RPPA----GVCW-RGVR 301

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
           +P+LG++ MD  M D +  +    GD ++  G    L++VA A  T  Y+++ R+G R+ 
Sbjct: 302 LPVLGRVCMDSFMVDASAIMPTP-GDVVEFIGVSQTLEEVAAACDTIPYEIMTRLGGRFR 360

Query: 367 KF 368
           + 
Sbjct: 361 RI 362


>gi|16762331|ref|NP_457948.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29143819|ref|NP_807161.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|213052147|ref|ZP_03345025.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
 gi|213427047|ref|ZP_03359797.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|289830029|ref|ZP_06547478.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|20137366|sp|Q8Z300|ALR3_SALTI RecName: Full=Alanine racemase 3
 gi|25291653|pir||AD0937 alanine racemase [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16504635|emb|CAD09518.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29139455|gb|AAO71021.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
          Length = 368

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 110/362 (30%), Positives = 176/362 (48%), Gaps = 15/362 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+ +N+ ++      A+  AV+K N YGLG E IAPALY A  + FFV  + EG
Sbjct: 14  LCVDLAAVVDNYQTLARHVAPAQCGAVLKANGYGLGAEAIAPALYAANCRIFFVAQLSEG 73

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYAL 126
           V LR + +  A + +L G+ P          + P+++SV Q+  +  L        P  +
Sbjct: 74  VALRNILSADAMVVLLNGVMPQAMPFCCAQQITPLLNSVDQVMTWLALQEARSQRRPVLI 133

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G +RLG++ ++          +       IISHLA AD P   +N  Q    +   
Sbjct: 134 QLDSGMSRLGVTPEQLARLAAIFRQRGWAAPDYIISHLANADRPDHALNVYQHTLLQQAK 193

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
             +     SLA+S G+ L P +   L RPG++L+ G  +   S P++   T    I+ ++
Sbjct: 194 KAFPTSRYSLANSCGMFLHPAWREDLCRPGVALF-GVAQPWFSTPLKPAFTLTLTILRVQ 252

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G  + YG     TR   IA  + GYADG P  L        P+    G  + +G  
Sbjct: 253 DVPVGTPIGYGSTVTTTRPLRIATVSAGYADGIPRNL------RPPA----GVCW-RGVR 301

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
           +P+LG++ MD  M D +  +    GD ++  G    L++VA A  T  Y+++ R+G R+ 
Sbjct: 302 LPVLGRVCMDSFMVDASAIMPTS-GDVVEFIGVSQTLEEVAAACDTIPYEIMARLGARFR 360

Query: 367 KF 368
           + 
Sbjct: 361 RI 362


>gi|213583064|ref|ZP_03364890.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-0664]
          Length = 362

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 110/362 (30%), Positives = 176/362 (48%), Gaps = 15/362 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+ +N+ ++      A+  AV+K N YGLG E IAPALY A  + FFV  + EG
Sbjct: 14  LCVDLAAVVDNYQTLAHHVAPAQCGAVLKANGYGLGAEAIAPALYAANCRIFFVAQLSEG 73

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYAL 126
           V LR + +  A + +L G+ P          + P+++SV Q+  +  L        P  +
Sbjct: 74  VALRNILSADAMVVLLNGVMPQAMPFCCAQQITPLLNSVDQVMTWLALQEARSQRRPVLI 133

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G +RLG++ ++          +       IISHLA AD P   +N  Q    +   
Sbjct: 134 QLDSGMSRLGVTPEQLARLAAIFRQRGWAAPDYIISHLANADRPDHALNVYQHTLLQQAK 193

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
             +     SLA+S G+ L P +   L RPG++L+ G  +   S P++   T    I+ ++
Sbjct: 194 KAFPTSRYSLANSCGMFLHPAWREDLCRPGVALF-GVAQPWFSTPLKPAFTLTLTILRVQ 252

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G  + YG     TR   IA  + GYADG P  L        P+    G  + +G  
Sbjct: 253 DVPVGTPIGYGSTVTTTRPLRIATVSAGYADGIPRNL------RPPA----GVCW-RGVR 301

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
           +P+LG++ MD  M D +  +    GD ++  G    L++VA A  T  Y+++ R+G R+ 
Sbjct: 302 LPVLGRVCMDSFMVDASAIMPTS-GDVVEFIGVSQTLEEVAAACDTIPYEIMARLGARFR 360

Query: 367 KF 368
           + 
Sbjct: 361 RI 362


>gi|238754673|ref|ZP_04616026.1| Alanine racemase 1 [Yersinia ruckeri ATCC 29473]
 gi|238707132|gb|EEP99496.1| Alanine racemase 1 [Yersinia ruckeri ATCC 29473]
          Length = 359

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 120/366 (32%), Positives = 188/366 (51%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +  L+  +R  AVVK NAYG G  + A  L +A    + V  + E + 
Sbjct: 8   IDRRALRHNLQQVRRLAPQSRLIAVVKANAYGHGLLETAHTLQDADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHP--YALQ 127
           LR       I +L G    ++  +   N I   + S+ QL     L    + +P    ++
Sbjct: 66  LRSGGIVKPILLLEGFFSAEDLPVLVVNHIETAVHSIEQL---EALEQADLPYPINVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+   EA  F    S    + Q   I+SH + AD+P       Q+E F T +
Sbjct: 123 LDTGMHRLGVRPDEAEAFYQRLSACHNVVQPINIMSHFSQADEPEVSATRQQIECFDTFV 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           +   G + S+A+S GILL P+ H    RPGI LYG +    K      +Q  +T ++ +I
Sbjct: 183 ADKPG-KQSIAASGGILLWPDSHRDWVRPGIVLYGVSPIEQKNGADFGLQPGMTLKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +RK  AGE V YGG     RD+ + V A+GY DGYP +        +PS   G   ++ 
Sbjct: 242 AVRKHKAGEPVGYGGTWVSQRDTRLGVVAMGYGDGYPRS--------APS---GTPVWLN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI+G+++MDM   D+    S  VGD ++++G D+ ++ VA+A+G + Y+L+ ++  
Sbjct: 291 GREVPIVGRVSMDMISVDLGPDSSDRVGDEVELWGADLPVEKVAIATGISAYELITKLTP 350

Query: 364 RYAKFY 369
           R +  Y
Sbjct: 351 RVSMEY 356


>gi|91227270|ref|ZP_01261695.1| alanine racemase [Vibrio alginolyticus 12G01]
 gi|91188664|gb|EAS74953.1| alanine racemase [Vibrio alginolyticus 12G01]
          Length = 358

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 188/367 (51%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL+AL++N   + A +  ++  AVVK N YG G   +A    +A    F V  +EE ++
Sbjct: 8   IDLSALQHNLQRVKAQAPQSKVMAVVKANGYGHGLRHVAKHANHADA--FGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 66  LRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQLI---ALEQADLETPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++  DF T       + +    +SH  CAD+  S +   Q+E F++L 
Sbjct: 123 IDSGMHRLGVRPEQYDDFVTRLKECPNVAKPLRYMSHFGCADELDSDITPQQIELFKSLT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           S  +G E SLA+S+G+L  P  H    RPGI +YG +   DK  +    Q V+T ++ +I
Sbjct: 183 SGCQG-ERSLAASAGLLAWPQSHLDWVRPGIIMYGVSPFDDKTAQDLGYQPVMTLKSHLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YGG     RD+ + V A+GY DGYP +        +P+   G   ++ 
Sbjct: 242 AVREVKKGESVGYGGIWTSERDTKVGVIAVGYGDGYPRS--------APN---GTPVWVN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI G+++MDM   D+    + +V D   ++G ++ +++VA   GT  Y+L+ ++  
Sbjct: 291 GRKVPIAGRVSMDMLTVDLGPDATDKVSDEAILWGKELPVEEVAGHIGTIAYELVTKLTP 350

Query: 364 RYAKFYT 370
           R    Y+
Sbjct: 351 RVEMEYS 357


>gi|300724710|ref|YP_003714035.1| alanine racemase [Xenorhabdus nematophila ATCC 19061]
 gi|297631252|emb|CBJ91947.1| alanine racemase 1, PLP-binding, biosynthetic [Xenorhabdus
           nematophila ATCC 19061]
          Length = 359

 Score =  166 bits (419), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 188/366 (51%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   + A + +++  AVVK NAYG G  + A  + +A    F V  + E + 
Sbjct: 8   INRRALRHNLQQVRAQAPDSKVIAVVKANAYGHGLLETACTMEDADC--FGVARIGEALA 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLI-PVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +  +   N I  V+ S+ QL     L    +SHP    ++
Sbjct: 66  LRSGGLVKPILLLEGFFEAADLPVLVVNHIDTVVHSIEQL---EALEQADLSHPIKVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+ + EA  F    S    + Q   +ISH + AD+P+      Q+ERF   +
Sbjct: 123 LDTGMHRLGVRIDEAEAFYQRLSCCHNVEQPINLISHFSRADEPAVETTQQQIERFMAFV 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
           +   G E S+A+S G+LL    H    RPGI +YG +  ++K+     +   +T ++ +I
Sbjct: 183 ADKSG-EKSIAASGGVLLWLQAHLDWVRPGIMMYGVSPMVDKTAADFNLIPAMTLKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +RK   GE V YGG     RD+ + V A+GY DGYP +        +P+   G   FI 
Sbjct: 242 AVRKHKVGESVGYGGTWSSERDTCLGVVAMGYGDGYPRS--------APT---GMPVFIN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
              VPI+G+++MDM   D+  +   +VGD + ++G  + ++ +A  SG + Y+L+ ++ +
Sbjct: 291 DREVPIVGRVSMDMITVDLGPACQDKVGDEVILWGSALPVEKIAEHSGISAYELITKLTS 350

Query: 364 RYAKFY 369
           R A  Y
Sbjct: 351 RVAMEY 356


>gi|323493025|ref|ZP_08098160.1| alanine racemase [Vibrio brasiliensis LMG 20546]
 gi|323312723|gb|EGA65852.1| alanine racemase [Vibrio brasiliensis LMG 20546]
          Length = 358

 Score =  165 bits (418), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 118/367 (32%), Positives = 184/367 (50%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N   +   + +++  AVVK NAYG G   +A +    G   F V  +EE ++
Sbjct: 8   IDLEALQHNLQQIKLQAPSSKIMAVVKANAYGHGLRHVAKS--AKGADAFGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 66  LRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQLV---ALEQAELETPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++  DF T       + +    +SH  CAD+    + + Q E F TL 
Sbjct: 123 IDSGMHRLGVRPEQYSDFVTRLKACDNVAKPLRYMSHFGCADELDRPITNEQTELFMTLT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
              +G E SLA+S+G+L  P+      RPGI +YG +   DK  +    Q V+T ++ +I
Sbjct: 183 EGCEG-ERSLAASAGLLAWPDSQLDWVRPGIIMYGVSPFNDKTAQDLGYQPVMTLKSHLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R   AGE V YGG     RD+ + V AIGY DGYP T        +P+   G    + 
Sbjct: 242 AVRDVKAGESVGYGGVWTSERDTKVGVIAIGYGDGYPRT--------APN---GTPVLVN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI G+++MDM   D+      +VGD   ++G D+  ++VA   GT  Y+L+ ++ +
Sbjct: 291 GRKVPISGRVSMDMLTVDLGPDAKDQVGDEAILWGRDLPAEEVAGHIGTIAYELVTKLTS 350

Query: 364 RYAKFYT 370
           R    Y+
Sbjct: 351 RVDMEYS 357


>gi|268591426|ref|ZP_06125647.1| alanine racemase [Providencia rettgeri DSM 1131]
 gi|291313080|gb|EFE53533.1| alanine racemase [Providencia rettgeri DSM 1131]
          Length = 360

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 188/369 (50%), Gaps = 27/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  ++ N++  AVVK NAYG G   +  A+    V  F V  + E + 
Sbjct: 8   INRRALRHNLQRVKEIAPNSQMIAVVKANAYGHGLVGVGQAVEEL-VDGFGVARLNEALL 66

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLI-PVISSVPQLTFYSKLMSCGVSHPYALQV- 128
           LR +     I +L G     + ++   + I  VI  + QL             PY L+V 
Sbjct: 67  LRQHGVIKPIVLLEGFFEQSDLLLMAEHQIDTVIHCIEQLEMLE-----ATKLPYPLKVW 121

Query: 129 ---DTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRT 184
              DTG +RLG+  ++A  F       +  QL + I+SH   AD P       Q+  F+ 
Sbjct: 122 MKLDTGMHRLGILPKDAEGFYQRLQRCQQVQLPINIVSHFCQADAPHLPTTEKQIACFKQ 181

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEAR 241
            I   +G E S+A+S+GILL P  H+   RPGI +YG + +  KS     +  V+T ++ 
Sbjct: 182 FIDGKEG-EKSIAASAGILLWPEAHYDWVRPGIMMYGASPQEGKSAEDFGLLPVMTLKST 240

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AG+ V YG      +D+L+ V AIGY DGYP         + PS   G    
Sbjct: 241 LIAVREHAAGQCVGYGETWCSDKDTLLGVVAIGYGDGYP--------RNVPS---GTPVL 289

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           I G  VPI+G+I+MDMT+ D+  +   +VGD + ++G  + ++++A  +G  NY+LL ++
Sbjct: 290 INGRKVPIVGRISMDMTVVDLGLNADDKVGDDVILWGNQLPVEEIATQTGIINYELLTKL 349

Query: 362 GTRYAKFYT 370
            +R A  Y 
Sbjct: 350 TSRVAMEYV 358


>gi|218677912|ref|ZP_03525809.1| putative alanine racemase [Rhizobium etli CIAT 894]
          Length = 165

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/157 (51%), Positives = 110/157 (70%)

Query: 168 DDPSSHVNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKIN 227
           D+PS  +N  QLE FR + + Y+GI++SLA+S+GI LG +YHF LTRPGI+LYGG     
Sbjct: 1   DEPSHAMNRRQLESFRRVSAAYEGIDSSLAASAGIFLGEDYHFDLTRPGIALYGGEAVCG 60

Query: 228 KSHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLD 287
            ++PM+ V TA+ARII +R   AGE VSYG   +L RDS +A+ ++GYADGY  + S   
Sbjct: 61  MANPMRPVATAQARIIQVRNVEAGETVSYGRALQLRRDSRLAIVSVGYADGYMRSQSSGG 120

Query: 288 SEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITD 324
                 V  GG+GFI G+ VP+ G+ITMD+T+FD+TD
Sbjct: 121 VPLRQVVPQGGEGFIAGHKVPVAGRITMDLTIFDVTD 157


>gi|262172532|ref|ZP_06040210.1| alanine racemase biosynthetic [Vibrio mimicus MB-451]
 gi|261893608|gb|EEY39594.1| alanine racemase biosynthetic [Vibrio mimicus MB-451]
          Length = 364

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 184/369 (49%), Gaps = 28/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   + +++  AVVK N YG G   IA   Y  G   F V  +EE ++
Sbjct: 11  INLDALQHNLQRVKQQAPHSKIMAVVKANGYGHGLRHIA--RYAIGADAFGVARIEEALQ 68

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 69  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+      + Q E F +
Sbjct: 126 VDSGMHRLGVRPEQYRDFVNRLHQCAN--VAKPLRYMSHFGCADELDKSTTAEQTELFLS 183

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +    KS      Q V+T ++ 
Sbjct: 184 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFAEKSAEELGYQPVMTLKSH 242

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 243 VIAVREVKAGESVGYGGIWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 291

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+    +  VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 292 VNGRRVPIAGRVSMDMLTVDLGPEATDCVGDEAMLWGRELPVEEVAAHIGTLGYELVTKL 351

Query: 362 GTRYAKFYT 370
            +R    Y+
Sbjct: 352 TSRVEMSYS 360


>gi|262401537|ref|ZP_06078104.1| alanine racemase biosynthetic [Vibrio sp. RC586]
 gi|262352252|gb|EEZ01381.1| alanine racemase biosynthetic [Vibrio sp. RC586]
          Length = 361

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 184/369 (49%), Gaps = 28/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   + +++  AVVK N YG G   IA   Y  G   F V  +EE ++
Sbjct: 8   INLDALQHNLQRVKQQAPHSKIMAVVKANGYGHGLRHIA--RYAIGADAFGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 66  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+      + Q E F +
Sbjct: 123 VDSGMHRLGVRPEQYRDFVNRLHQCAN--VAKPLRYMSHFGCADELDKSTTAEQTELFLS 180

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +    KS      Q V+T ++ 
Sbjct: 181 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFAEKSAEELGYQPVMTLKSH 239

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 240 LIAVREVKAGESVGYGGIWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 288

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+    +  VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 289 VNGRRVPIAGRVSMDMLTVDLGPEATDCVGDEAMLWGRELPVEEVAAHIGTLGYELVTKL 348

Query: 362 GTRYAKFYT 370
            +R    Y+
Sbjct: 349 TSRVEMSYS 357


>gi|261210391|ref|ZP_05924685.1| alanine racemase biosynthetic [Vibrio sp. RC341]
 gi|260840449|gb|EEX67015.1| alanine racemase biosynthetic [Vibrio sp. RC341]
          Length = 364

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 183/369 (49%), Gaps = 28/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   + +++  AVVK N YG G   IA   Y  G   F V  +EE ++
Sbjct: 11  INLDALQHNLQRVKQQAPDSKIMAVVKANGYGHGLRHIA--RYAMGADAFGVARIEEALQ 68

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 69  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQTQLETPVMVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           +D+G +RLG+  ++  DF    H   N  + +    +SH  CAD+      + Q E F +
Sbjct: 126 IDSGMHRLGVRPEQYQDFVTRLHQCDN--VAKPLRYMSHFGCADELDKSTTAAQTELFLS 183

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM---QTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +    KS      Q V+T ++ 
Sbjct: 184 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFAEKSAAQLGYQPVMTLKSH 242

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R   AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 243 LIAVRDVKAGESVGYGGTWISQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 291

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+    S  VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 292 VNGRRVPIAGRVSMDMLTVDLGPEASDCVGDEAMLWGGELPVEEVAAHIGTLGYELVTKL 351

Query: 362 GTRYAKFYT 370
            +R    Y+
Sbjct: 352 TSRVEMSYS 360


>gi|300870894|ref|YP_003785765.1| alanine racemase [Brachyspira pilosicoli 95/1000]
 gi|300688593|gb|ADK31264.1| alanine racemase [Brachyspira pilosicoli 95/1000]
          Length = 368

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 120/374 (32%), Positives = 195/374 (52%), Gaps = 29/374 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +IDL AL+NN   + +++GN +   +VK NAYG G   ++  L N  V    V +VEEGV
Sbjct: 8   EIDLKALQNNIKIIRSMTGNTKLLTIVKANAYGHGIVDMSKQLENLNVDALGVATVEEGV 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL--- 126
           K+R    +  I VL+     + + +   +L P+IS+   L  Y + +    +H   L   
Sbjct: 68  KIREAGVKIPIIVLFQHFKNEAEDVCRYDLTPIISNAECLDDYDRFLK---NHNKKLKLH 124

Query: 127 -QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACA---DDPSSHVNSVQLERF 182
            +VDTG NR+G   ++ L   +   +    ++  I +H A +   DD S      Q++ F
Sbjct: 125 IKVDTGLNRMGAKPKDVLSLANKILSYGTLEIEGINTHYAASDGFDDISKEFTENQIKIF 184

Query: 183 RTLISHYK--GIE---ASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVT 237
             +++  K  GI+   A  A+S+ +L   N +F + R GI +YG T+K+      + ++ 
Sbjct: 185 TDVLNELKTNGIKINNAHTANSAALLYYKNAYFDMVRAGIVVYGYTEKL-YDFGFKPILN 243

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
            ++++IL RK    E VSYG   K  +D+ IAV  IGYADG    LS     ++  V + 
Sbjct: 244 LKSKVILTRKIKKNETVSYGMTWKADKDTNIAVIPIGYADGLSRKLS-----NNWEVKIN 298

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASG--TTNY 355
           GK +      PI+GKI MD+ M DI +  +I+  D + IFG D +L+   +A    + ++
Sbjct: 299 GKYY------PIIGKICMDIIMADIGNEDNIKEEDEVLIFGDDERLNANTMAKKIESISH 352

Query: 356 DLLVRIGTRYAKFY 369
           ++LVRIG R  + Y
Sbjct: 353 EVLVRIGERVKRVY 366


>gi|166367623|ref|YP_001659896.1| alanine racemase [Microcystis aeruginosa NIES-843]
 gi|166089996|dbj|BAG04704.1| alanine racemase [Microcystis aeruginosa NIES-843]
          Length = 397

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 112/364 (30%), Positives = 182/364 (50%), Gaps = 25/364 (6%)

Query: 9   LKIDLTALKNNWHSMNAL-SGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           ++ID +AL+ N   + AL +      AV+K +AYG G  K+A ++  AG Q   + ++ E
Sbjct: 30  VEIDRSALQQNVRKVKALLAPKTELIAVIKADAYGHGAVKVANSVLEAGAQSLAIATIGE 89

Query: 68  GVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYA 125
           G++LR     A I +L  ++ P +   +    L P +  + Q+  ++ +M       P  
Sbjct: 90  GIELREAGIVAPIMILGAVNTPEEVAALAHWQLQPTLVQIEQVQIFASVMRRLEQRLPVH 149

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +++DTG +RLG   Q    F          +++ I SH A ADDP+  +  +Q +RF+  
Sbjct: 150 IKLDTGMSRLGTQWQNGTKFVEQVLEAPNLKIASIYSHFATADDPNPEIMQLQRQRFQQA 209

Query: 186 ISHY--KGIEAS---LASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTA 238
           I+    KG       LA+S+  L   + H+   R G++LYG    D +    P+Q V+  
Sbjct: 210 IAELRSKGYHPPCLHLANSAATLSDRSLHYDRVRVGLALYGLYPADHLTDKVPLQPVLQV 269

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           +ARI  ++   AG  VSYG Q    +D+ IAV  IGYADG P  LS              
Sbjct: 270 KARIAQVKTIAAGSGVSYGHQYIAAKDTRIAVVGIGYADGIPRNLSN-----------RL 318

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALASGTTN 354
           K  ++G +VP +G ITMD  M D+++   ++ G+ + + G D    I  DD A   GT +
Sbjct: 319 KVSLRGRLVPQIGAITMDQLMIDVSEIPEVKTGEIVTLIGKDGPQCITADDWARDLGTIS 378

Query: 355 YDLL 358
           +++L
Sbjct: 379 WEIL 382


>gi|320539399|ref|ZP_08039068.1| alanine racemase 1, PLP-binding, biosynthetic [Serratia symbiotica
           str. Tucson]
 gi|320030524|gb|EFW12534.1| alanine racemase 1, PLP-binding, biosynthetic [Serratia symbiotica
           str. Tucson]
          Length = 359

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 117/366 (31%), Positives = 188/366 (51%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID +AL++N   +   +  +   A+VK NAYG G  + A  L +A    F V+ + E + 
Sbjct: 8   IDRSALRHNLQQVRRQAPQSHLIAIVKANAYGHGMLETAHTLQDADC--FGVSRISEALA 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G    ++  ++   N+  V+ S  QL     L    ++HP    ++
Sbjct: 66  LRFGGIVKPILLLEGFFSAEDLPLLVANNIETVVHSSEQL---EALEQAKLAHPLPVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++A  F         + Q   I+S  +CAD+P S     Q+  F    
Sbjct: 123 LDTGMHRLGVRPEQAEAFYQRLCACHNVAQPVNIMSQFSCADEPGSDATLKQIACFEQFA 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT--DKINKS-HPMQTVVTAEARII 243
               G + S+A+SSGILL P+ H Q  RPGI LYG +  D  N S H +Q  +T ++ +I
Sbjct: 183 RGKPG-QRSIAASSGILLWPDAHNQWVRPGIILYGVSPLDNANGSQHLLQPAMTLKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R  LAGE V YGG     RD+ + V AIGY DGYP +     +     ++L G+    
Sbjct: 242 AVRDHLAGEPVGYGGTWISQRDTRLGVVAIGYGDGYPRS-----APTCTPIWLNGR---- 292

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
              VPI+G+++MDM   D+    + +VGD   ++G  + ++ +A+ +G + Y+L+ ++  
Sbjct: 293 --EVPIVGRVSMDMISVDLGPDATDKVGDEAVLWGQALPVERIAIYAGISVYELVTKLTQ 350

Query: 364 RYAKFY 369
           R A  Y
Sbjct: 351 RVAMEY 356


>gi|258622401|ref|ZP_05717424.1| alanine racemase [Vibrio mimicus VM573]
 gi|258585315|gb|EEW10041.1| alanine racemase [Vibrio mimicus VM573]
          Length = 375

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 183/369 (49%), Gaps = 28/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   + +++  AVVK N YG G   IA   Y  G   F V  +EE ++
Sbjct: 22  INLDALQHNLQRVKQQAPHSKIMAVVKANGYGHGLRHIA--RYAIGADAFGVARIEEALQ 79

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 80  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 136

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+        Q E F +
Sbjct: 137 VDSGMHRLGVRPEQYRDFVNRLHQCAN--VAKPLRYMSHFGCADELDKSTTEEQTELFLS 194

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +    KS      Q V+T ++ 
Sbjct: 195 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFAEKSAEELGYQPVMTLKSH 253

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 254 LIAVREVKAGESVGYGGIWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 302

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+    +  VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 303 VNGRRVPIAGRVSMDMLTVDLGPEATDCVGDEAMLWGRELPVEEVAAHIGTLGYELVTKL 362

Query: 362 GTRYAKFYT 370
            +R    Y+
Sbjct: 363 TSRVEMSYS 371


>gi|229525066|ref|ZP_04414471.1| alanine racemase biosynthetic [Vibrio cholerae bv. albensis VL426]
 gi|229338647|gb|EEO03664.1| alanine racemase biosynthetic [Vibrio cholerae bv. albensis VL426]
          Length = 375

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 118/369 (31%), Positives = 182/369 (49%), Gaps = 28/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   +  ++  AVVK N YG G   IA   +  G   F V  +EE ++
Sbjct: 22  INLEALQHNLQRVKQQAPESKIMAVVKANGYGHGLRHIA--RHALGADAFGVARIEEALQ 79

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 80  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 136

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+        Q E F +
Sbjct: 137 VDSGMHRLGVRPEQYQDFVTRLHQCAN--VAKPLRYMSHFGCADELDKSTTVEQTELFLS 194

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM---QTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +  + KS      Q V+T ++ 
Sbjct: 195 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFVEKSAVQLGYQPVMTLKSH 253

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 254 LIAVREVKAGESVGYGGTWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 302

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+       VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 303 VNGRRVPIAGRVSMDMLTVDLGPDACDRVGDEAMLWGNELPVEEVAAHIGTIGYELVTKL 362

Query: 362 GTRYAKFYT 370
            +R    Y+
Sbjct: 363 TSRVEMSYS 371


>gi|260775631|ref|ZP_05884528.1| alanine racemase biosynthetic [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608812|gb|EEX34977.1| alanine racemase biosynthetic [Vibrio coralliilyticus ATCC BAA-450]
          Length = 361

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 182/367 (49%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N   + + + N++  AVVK N+YG G   +A    +A    F V  +EE ++
Sbjct: 11  IDLDALQHNLKQIKSQAPNSKIMAVVKANSYGHGLRHVAKHATDADA--FGVARIEEALQ 68

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 69  LRACGVVTPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---EALEQAELDTPVVVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++  DF       + + +    +SH  CAD+      + Q E F  L 
Sbjct: 126 IDSGMHRLGVRPEQYTDFVSRLKACRNVAKPLRYMSHFGCADELDKSTTTEQTELFLALT 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
              +G E SLA+S+G+L   N      RPGI +YG +   DK  +    Q V+T ++ +I
Sbjct: 186 DGCEG-ERSLAASAGLLAWQNSQLDWVRPGIIMYGVSPFNDKTAQQMGYQPVMTLKSHLI 244

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R   AGE V YGG     RD+ + V AIGY DGYP T        +P+   G    + 
Sbjct: 245 AVRDVKAGESVGYGGMWTSQRDTKVGVIAIGYGDGYPRT--------APN---GTPVLVN 293

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI G+++MDM   D+    + +VGD   ++G  +  ++VA   GT  Y+L+ ++ +
Sbjct: 294 GRKVPIAGRVSMDMLTVDLGPDANDKVGDEAILWGQSLPAEEVACHIGTIAYELVTKLTS 353

Query: 364 RYAKFYT 370
           R    Y+
Sbjct: 354 RVEMEYS 360


>gi|262190632|ref|ZP_06048868.1| alanine racemase biosynthetic [Vibrio cholerae CT 5369-93]
 gi|20137519|sp|Q9KUY6|ALR1_VIBCH RecName: Full=Alanine racemase 1
 gi|262033497|gb|EEY51999.1| alanine racemase biosynthetic [Vibrio cholerae CT 5369-93]
          Length = 361

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 181/368 (49%), Gaps = 28/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   +  ++  AVVK N YG G   IA   +  G   F V  +EE ++
Sbjct: 8   INLEALQHNLQRVKQQAPESKIMAVVKANGYGHGLRHIA--RHALGADAFGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 66  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+        Q E F +
Sbjct: 123 VDSGMHRLGVRPEQYQDFVARLHQCEN--VAKPLRYMSHFGCADELDKSTTVEQTELFLS 180

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM---QTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +  + KS      Q V+T ++ 
Sbjct: 181 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFVEKSAVQLGYQPVMTLKSH 239

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 240 LIAVREVKAGESVGYGGTWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 288

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+       VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 289 VNGRRVPIAGRVSMDMLTVDLGPDACDRVGDEAMLWGNELPVEEVAAHIGTIGYELVTKL 348

Query: 362 GTRYAKFY 369
            +R    Y
Sbjct: 349 TSRVEMSY 356


>gi|255747170|ref|ZP_05421113.1| alanine racemase biosynthetic [Vibrio cholera CIRS 101]
 gi|262147254|ref|ZP_06028055.1| alanine racemase biosynthetic [Vibrio cholerae INDRE 91/1]
 gi|255735219|gb|EET90621.1| alanine racemase biosynthetic [Vibrio cholera CIRS 101]
 gi|262031314|gb|EEY49927.1| alanine racemase biosynthetic [Vibrio cholerae INDRE 91/1]
 gi|327483230|gb|AEA77637.1| Alanine racemase, biosynthetic [Vibrio cholerae LMA3894-4]
          Length = 364

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 181/368 (49%), Gaps = 28/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   +  ++  AVVK N YG G   IA   +  G   F V  +EE ++
Sbjct: 11  INLEALQHNLQRVKQQAPESKIMAVVKANGYGHGLRHIA--RHALGADAFGVARIEEALQ 68

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 69  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+        Q E F +
Sbjct: 126 VDSGMHRLGVRPEQYQDFVARLHQCEN--VAKPLRYMSHFGCADELDKSTTVEQTELFLS 183

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM---QTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +  + KS      Q V+T ++ 
Sbjct: 184 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFVEKSAVQLGYQPVMTLKSH 242

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 243 LIAVREVKAGESVGYGGTWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 291

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+       VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 292 VNGRRVPIAGRVSMDMLTVDLGPDACDRVGDEAMLWGNELPVEEVAAHIGTIGYELVTKL 351

Query: 362 GTRYAKFY 369
            +R    Y
Sbjct: 352 TSRVEMSY 359


>gi|15640399|ref|NP_230026.1| alanine racemase [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121590967|ref|ZP_01678287.1| alanine racemase, biosynthetic [Vibrio cholerae 2740-80]
 gi|153216658|ref|ZP_01950565.1| alanine racemase, biosynthetic [Vibrio cholerae 1587]
 gi|153823514|ref|ZP_01976181.1| alanine racemase, biosynthetic [Vibrio cholerae B33]
 gi|153827276|ref|ZP_01979943.1| alanine racemase, biosynthetic [Vibrio cholerae MZO-2]
 gi|153830458|ref|ZP_01983125.1| alanine racemase, biosynthetic [Vibrio cholerae 623-39]
 gi|227080584|ref|YP_002809135.1| alanine racemase, biosynthetic [Vibrio cholerae M66-2]
 gi|229504955|ref|ZP_04394466.1| alanine racemase biosynthetic [Vibrio cholerae BX 330286]
 gi|229508607|ref|ZP_04398103.1| alanine racemase biosynthetic [Vibrio cholerae B33]
 gi|229516019|ref|ZP_04405470.1| alanine racemase biosynthetic [Vibrio cholerae RC9]
 gi|229526947|ref|ZP_04416344.1| alanine racemase biosynthetic [Vibrio cholerae 12129(1)]
 gi|229606347|ref|YP_002876995.1| alanine racemase [Vibrio cholerae MJ-1236]
 gi|254227117|ref|ZP_04920668.1| alanine racemase, biosynthetic [Vibrio cholerae V51]
 gi|254286204|ref|ZP_04961163.1| alanine racemase, biosynthetic [Vibrio cholerae AM-19226]
 gi|254851683|ref|ZP_05241033.1| alanine racemase [Vibrio cholerae MO10]
 gi|298501269|ref|ZP_07011067.1| alanine racemase [Vibrio cholerae MAK 757]
 gi|9654790|gb|AAF93545.1| alanine racemase, biosynthetic [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121547193|gb|EAX57320.1| alanine racemase, biosynthetic [Vibrio cholerae 2740-80]
 gi|124114169|gb|EAY32989.1| alanine racemase, biosynthetic [Vibrio cholerae 1587]
 gi|125620360|gb|EAZ48743.1| alanine racemase, biosynthetic [Vibrio cholerae V51]
 gi|126518959|gb|EAZ76182.1| alanine racemase, biosynthetic [Vibrio cholerae B33]
 gi|148874060|gb|EDL72195.1| alanine racemase, biosynthetic [Vibrio cholerae 623-39]
 gi|149738824|gb|EDM53166.1| alanine racemase, biosynthetic [Vibrio cholerae MZO-2]
 gi|150423619|gb|EDN15561.1| alanine racemase, biosynthetic [Vibrio cholerae AM-19226]
 gi|227008472|gb|ACP04684.1| alanine racemase, biosynthetic [Vibrio cholerae M66-2]
 gi|229335559|gb|EEO01039.1| alanine racemase biosynthetic [Vibrio cholerae 12129(1)]
 gi|229346922|gb|EEO11889.1| alanine racemase biosynthetic [Vibrio cholerae RC9]
 gi|229354375|gb|EEO19302.1| alanine racemase biosynthetic [Vibrio cholerae B33]
 gi|229358013|gb|EEO22929.1| alanine racemase biosynthetic [Vibrio cholerae BX 330286]
 gi|229369002|gb|ACQ59425.1| alanine racemase biosynthetic [Vibrio cholerae MJ-1236]
 gi|254847388|gb|EET25802.1| alanine racemase [Vibrio cholerae MO10]
 gi|297540023|gb|EFH76086.1| alanine racemase [Vibrio cholerae MAK 757]
          Length = 375

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 181/368 (49%), Gaps = 28/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   +  ++  AVVK N YG G   IA   +  G   F V  +EE ++
Sbjct: 22  INLEALQHNLQRVKQQAPESKIMAVVKANGYGHGLRHIA--RHALGADAFGVARIEEALQ 79

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 80  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 136

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+        Q E F +
Sbjct: 137 VDSGMHRLGVRPEQYQDFVARLHQCEN--VAKPLRYMSHFGCADELDKSTTVEQTELFLS 194

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM---QTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +  + KS      Q V+T ++ 
Sbjct: 195 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFVEKSAVQLGYQPVMTLKSH 253

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 254 LIAVREVKAGESVGYGGTWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 302

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+       VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 303 VNGRRVPIAGRVSMDMLTVDLGPDACDRVGDEAMLWGNELPVEEVAAHIGTIGYELVTKL 362

Query: 362 GTRYAKFY 369
            +R    Y
Sbjct: 363 TSRVEMSY 370


>gi|229512608|ref|ZP_04402078.1| alanine racemase biosynthetic [Vibrio cholerae TMA 21]
 gi|229350390|gb|EEO15340.1| alanine racemase biosynthetic [Vibrio cholerae TMA 21]
          Length = 375

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 181/368 (49%), Gaps = 28/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   +  ++  AVVK N YG G   IA   +  G   F V  +EE ++
Sbjct: 22  INLEALQHNLQRVKQQAPESKIMAVVKANGYGHGLHHIA--RHALGADAFGVARIEEALQ 79

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 80  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 136

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+        Q E F +
Sbjct: 137 VDSGMHRLGVRPEQYQDFVARLHQCEN--VAKPLRYMSHFGCADELDKSTTVEQTELFLS 194

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM---QTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +  + KS      Q V+T ++ 
Sbjct: 195 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFVEKSAVQLGYQPVMTLKSH 253

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 254 LIAVREVKAGESVGYGGTWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 302

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+       VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 303 VNGRRVPIAGRVSMDMLTVDLGPDACDRVGDEAMLWGNELPVEEVAAHIGTIGYELVTKL 362

Query: 362 GTRYAKFY 369
            +R    Y
Sbjct: 363 TSRVEMSY 370


>gi|311281403|ref|YP_003943634.1| alanine racemase [Enterobacter cloacae SCF1]
 gi|308750598|gb|ADO50350.1| alanine racemase [Enterobacter cloacae SCF1]
          Length = 359

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 120/372 (32%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         F+   +PVIS+      V  L     L    +  P 
Sbjct: 66  LREGGITQPILLLEGF--------FNAGDLPVISAQRLHTAVHNLEQLEALEQATLPEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  +EA  F    S  + + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEEAEAFYQRLSQCQNVRQPVNIVSHFARADEPECGATERQLDV 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVT 237
           F T      G+  S+A+S GILL P  HF   RPGI LYG +    K       +Q V++
Sbjct: 178 FNTFCDGKPGMR-SIAASGGILLWPQSHFDWVRPGIILYGVSPLEGKPWGPDFGLQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG  +  RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWESARDTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+        GD + ++G  + ++ +A  S  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDRAGDPVVLWGEGLPVERIAELSKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|256821804|ref|YP_003145767.1| alanine racemase [Kangiella koreensis DSM 16069]
 gi|256795343|gb|ACV25999.1| alanine racemase [Kangiella koreensis DSM 16069]
          Length = 364

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 111/365 (30%), Positives = 192/365 (52%), Gaps = 22/365 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N +++  ++  +R  AVVK +AYG G  ++A AL + G   F V +V+E + 
Sbjct: 8   IDLAALRHNLNTIKTIANGSRVMAVVKADAYGHGLVQVAKALTD-GADMFAVATVQEALS 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR    +  I +L GI   ++ +++ + +L  V+   PQ+       +      + +++D
Sbjct: 67  LRKAEIKTPILLLEGIFNAKDLELVVEHDLQVVLHHWPQIEALQNFNTDKKIQVW-VKLD 125

Query: 130 TGFNRLGLSLQEALDFTHNSFNK--KLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           +G NRLG +LQ+ L    ++ +K   L     ++SH A ADDP    +S QLE F     
Sbjct: 126 SGMNRLGFALQD-LALIESTLSKIPSLANPIRLMSHFASADDPEDEFSSTQLEAFDQATK 184

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS---HPMQTVVTAEARIIL 244
           +    E S+A+S+GIL     H+   RPG+ LYG +  +      + ++ V++ E++++ 
Sbjct: 185 NIT-TEKSMANSAGILTQKGAHYDWVRPGLLLYGCSPLVGSEASDYDLKPVMSLESQVLA 243

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           I+    GE   YG      RD+ + + AIGY DGYP       + +S  V+L G+     
Sbjct: 244 IKPIKKGESTGYGRHWFADRDTNLGLVAIGYGDGYPR-----HARNSTPVWLNGR----- 293

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
            +VP++G+++MDM   D+       VGD + ++G ++  + VA  + T  Y L   + TR
Sbjct: 294 -IVPLVGRVSMDMMAVDLGPDCQDAVGDRVVLWGKELPAESVAPFADTIPYTLFCGV-TR 351

Query: 365 YAKFY 369
             +FY
Sbjct: 352 RVRFY 356


>gi|121729738|ref|ZP_01682178.1| alanine racemase, biosynthetic [Vibrio cholerae V52]
 gi|147674692|ref|YP_001218641.1| alanine racemase [Vibrio cholerae O395]
 gi|121628523|gb|EAX61007.1| alanine racemase, biosynthetic [Vibrio cholerae V52]
 gi|146316575|gb|ABQ21114.1| alanine racemase, biosynthetic [Vibrio cholerae O395]
 gi|227012228|gb|ACP08438.1| alanine racemase, biosynthetic [Vibrio cholerae O395]
          Length = 375

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 181/368 (49%), Gaps = 28/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   +  ++  AVVK N YG G   IA   +  G   F V  +EE ++
Sbjct: 22  INLEALQHNLQRVKQQAPESKIMAVVKANGYGHGLRHIA--RHALGADAFGVARIEEALQ 79

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 80  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 136

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+        Q E F +
Sbjct: 137 VDSGMHRLGVRPEQYQDFVARLHQCDN--VAKPLRYMSHFGCADELDKSTTVEQTELFLS 194

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM---QTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +  + KS      Q V+T ++ 
Sbjct: 195 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFVEKSAVQLGYQPVMTLKSH 253

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 254 LIAVREVKAGESVGYGGTWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 302

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+       VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 303 VNGRRVPIAGRVSMDMLTVDLGPDACDRVGDEAMLWGNELPVEEVAAHIGTIGYELVTKL 362

Query: 362 GTRYAKFY 369
            +R    Y
Sbjct: 363 TSRVEMSY 370


>gi|212710295|ref|ZP_03318423.1| hypothetical protein PROVALCAL_01354 [Providencia alcalifaciens DSM
           30120]
 gi|212687102|gb|EEB46630.1| hypothetical protein PROVALCAL_01354 [Providencia alcalifaciens DSM
           30120]
          Length = 360

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 117/369 (31%), Positives = 187/369 (50%), Gaps = 29/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+ N+R  AVVK NAYG G   +   +    V  F V  + E + 
Sbjct: 8   INRRALRHNLQRVRELAPNSRLIAVVKANAYGHGLIGVGTEI-QGSVDGFGVARLNEALL 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR       I +L G     + +++ + ++  VI  V QL              + +++D
Sbjct: 67  LRHQGVTKPIVLLEGFFEQSDLQLMVEYHIDTVIHCVEQLEMLESAQLAKKIKVW-MKLD 125

Query: 130 TGFNRLGLSLQEALDFTHNSFNKKLGQLSL------IISHLACADDPSSHVNSVQLERFR 183
           TG +RLG+  Q A      SF ++L   S       I+SH   AD P       Q+E F+
Sbjct: 126 TGMHRLGILPQHA-----ESFYQRLQSCSNVDLPINIVSHFCQADAPELPTTQKQIECFQ 180

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEA 240
             +S   G E S+A+S+GILL P  H+   RPGI +YG + +  KS     +  V+T ++
Sbjct: 181 QFVSDKPG-EKSIAASAGILLWPEAHYDWVRPGIMMYGASPQEGKSAASFGLLPVMTLKS 239

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
            +I +R+  AG+ V YG      R++ + V AIGY DGYP  +        PS   G   
Sbjct: 240 TLIAVREHSAGQCVGYGETWCSERNTRLGVVAIGYGDGYPRNV--------PS---GTPV 288

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
            + G  VPI+G+I+MDMT+ D+    + +VGD + ++G  + ++++A  +G  NY+LL +
Sbjct: 289 LVNGRKVPIIGRISMDMTVVDLGPDATDKVGDDVILWGNALPVEEIATQTGIINYELLTK 348

Query: 361 IGTRYAKFY 369
           + +R A  Y
Sbjct: 349 LTSRVAMEY 357


>gi|90581360|ref|ZP_01237156.1| alanine racemase [Vibrio angustum S14]
 gi|90437470|gb|EAS62665.1| alanine racemase [Vibrio angustum S14]
          Length = 359

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 118/369 (31%), Positives = 187/369 (50%), Gaps = 26/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL +N   +   + N++  AVVK NAYG G  ++A  L N  V  + V  +EE + 
Sbjct: 8   IDTEALAHNLGLIRQHAPNSKVLAVVKANAYGHGLLRVAQTLSN--VDAYGVARIEEALI 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL--Q 127
           LR       I +L G + P    ++   N+  V+ S+ QL     L    + +P  +  +
Sbjct: 66  LRAGGIVKPILLLEGFYAPSDLPVLVTNNIHTVVHSIEQL---EALEQTELDNPVQVWVK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++  DF    +  + + +    ISH   ADD SS +   QL+ F  L 
Sbjct: 123 IDTGMHRLGVRPEDLTDFMARLNACENVAKPLRFISHFGNADDLSSDITLKQLDTFLDLT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG-----GTDKINKSHPMQTVVTAEAR 241
             Y+G E SLA+S+GIL  P+   +  RPGI +YG      +++   ++ ++ V+T  + 
Sbjct: 183 QDYQG-ERSLAASAGILAWPDSQLEWIRPGIIMYGVSPFNESERFASAYDLKPVMTLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    GE V YGG     RD+ + V AIGY DGYP T        +P+   G    
Sbjct: 242 LIAVRDVKKGEQVGYGGIWTSERDTKVGVIAIGYGDGYPRT--------APN---GTPVL 290

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G +VP+ G+++MDM   D+      +VGD   ++G  +  + VA   GT  Y+L+ ++
Sbjct: 291 VNGRIVPMAGRVSMDMLTVDLGPDAQDKVGDTATLWGEGLPSEIVAEHIGTIAYELVTKL 350

Query: 362 GTRYAKFYT 370
             R A  YT
Sbjct: 351 TPRVAMAYT 359


>gi|262166870|ref|ZP_06034592.1| alanine racemase biosynthetic [Vibrio cholerae RC27]
 gi|262024700|gb|EEY43379.1| alanine racemase biosynthetic [Vibrio cholerae RC27]
          Length = 364

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 181/368 (49%), Gaps = 28/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   +  ++  AVVK N YG G   IA   +  G   F V  +EE ++
Sbjct: 11  INLEALQHNLQRVKQQAPESKIMAVVKANGYGHGLRHIA--RHALGADAFGVARIEEALQ 68

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 69  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+        Q E F +
Sbjct: 126 VDSGMHRLGVRPEQYQDFVARLHQCDN--VAKPLRYMSHFGCADELDKSTTVEQTELFLS 183

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM---QTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +  + KS      Q V+T ++ 
Sbjct: 184 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFVEKSAVQLGYQPVMTLKSH 242

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 243 LIAVREVKAGESVGYGGTWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 291

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+       VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 292 VNGRRVPIAGRVSMDMLTVDLGPDACDRVGDEAMLWGNELPVEEVAAHIGTIGYELVTKL 351

Query: 362 GTRYAKFY 369
            +R    Y
Sbjct: 352 TSRVEMSY 359


>gi|148981621|ref|ZP_01816478.1| alanine racemase [Vibrionales bacterium SWAT-3]
 gi|145960806|gb|EDK26141.1| alanine racemase [Vibrionales bacterium SWAT-3]
          Length = 358

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 184/368 (50%), Gaps = 28/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL+AL++N   + + +   +  +VVK N YG G   IA    N+    F V  +EE ++
Sbjct: 8   IDLSALEHNLRQIKSKAPQCKVMSVVKANGYGHGLLHIAKHSKNSDA--FGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       + +L G + PG   I+   N+  V+    QL   S L +  +  P    L+
Sbjct: 66  LRAGGIVQPVLLLEGFYSPGDLPILVTNNIQTVVHCEEQL---SALENSVLESPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+        Q E F +
Sbjct: 123 VDSGMHRLGVRSEQYKDFVERLHQCPN--VAKPLRYMSHFGCADELDRTTTVEQTELFLS 180

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEAR 241
           L    +G E SLA+S+G+L  P+ H    RPGI  YG +  ++KS        V+T  + 
Sbjct: 181 LTDGCEG-ERSLAASAGLLAWPDSHLDWVRPGIISYGVSPFVDKSAQELGFMPVMTLTSH 239

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R   AGE V YGG     RD+ + V AIGY DGYP T        +P+   G   F
Sbjct: 240 LIAVRDVKAGESVGYGGNWTSERDTKVGVIAIGYGDGYPRT--------APN---GTPVF 288

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+      +VGD   ++G ++  ++VA   GT  Y+L+ ++
Sbjct: 289 VNGRKVPIAGRVSMDMLTVDLGPDAQDKVGDEATLWGKELPSEEVAEHIGTIAYELVTKL 348

Query: 362 GTRYAKFY 369
            +R A  Y
Sbjct: 349 TSRVAMEY 356


>gi|258625986|ref|ZP_05720851.1| alanine racemase [Vibrio mimicus VM603]
 gi|258581734|gb|EEW06618.1| alanine racemase [Vibrio mimicus VM603]
          Length = 375

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 118/369 (31%), Positives = 183/369 (49%), Gaps = 28/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   + +++  A VK N YG G   IA   Y  G   F V  +EE ++
Sbjct: 22  INLDALQHNLQRVKQQAPHSKIMAAVKANGYGHGLRHIA--RYALGADAFGVARIEEALQ 79

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 80  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 136

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+      + Q E F +
Sbjct: 137 VDSGMHRLGVRPEQYRDFVNRLHQCAN--VAKPLRYMSHFGCADELDKSTTAEQTELFLS 194

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +    KS      Q V+T ++ 
Sbjct: 195 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFAEKSAEELGYQPVMTLKSH 253

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 254 LIAVREVKAGESVGYGGIWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 302

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+    +  VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 303 VSGRRVPIAGRVSMDMLTVDLGPEATDCVGDEAMLWGRELPVEEVAAHIGTLGYELVTKL 362

Query: 362 GTRYAKFYT 370
            +R    Y+
Sbjct: 363 TSRVEMSYS 371


>gi|297582256|ref|ZP_06944171.1| alanine racemase [Vibrio cholerae RC385]
 gi|297533514|gb|EFH72360.1| alanine racemase [Vibrio cholerae RC385]
          Length = 375

 Score =  162 bits (411), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 117/368 (31%), Positives = 181/368 (49%), Gaps = 28/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   +  ++  AVVK N YG G   IA   +  G   F V  +EE ++
Sbjct: 22  INLEALQHNLQRVKQQAPESKIMAVVKANGYGHGLRHIA--RHALGADAFGVARIEEALQ 79

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 80  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 136

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           +D+G +RLG+  ++  DF    H   N  + +    +SH  CAD+        Q E F +
Sbjct: 137 IDSGMHRLGVRPEQYQDFVARLHQCEN--VAKPLRYMSHFGCADELDKSTTVEQTELFLS 194

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM---QTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +  + KS      Q V+T ++ 
Sbjct: 195 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFVEKSAVQLGYQPVMTLKSH 253

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 254 LIAVREVKAGESVGYGGTWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 302

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+       VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 303 VNGRRVPIAGRVSMDMLTVDLGPDACDRVGDEAMLWGNELPVEEVAAHIGTIGYELVTKL 362

Query: 362 GTRYAKFY 369
            +R    Y
Sbjct: 363 TSRVEMSY 370


>gi|254481208|ref|ZP_05094453.1| alanine racemase [marine gamma proteobacterium HTCC2148]
 gi|214038371|gb|EEB79033.1| alanine racemase [marine gamma proteobacterium HTCC2148]
          Length = 360

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 110/367 (29%), Positives = 175/367 (47%), Gaps = 21/367 (5%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           ++DL AL++N      L+   +   VVK N YG G   +A  ++        V  +EE +
Sbjct: 8   RLDLAALRHNLAHARQLAPECKVMCVVKANGYGHGALNVA-RVFAPMADALAVACIEEAI 66

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           +LR    +  I +L G+   QE II       V+    Q  ++ +           L++D
Sbjct: 67  ELRDGGIETPILLLQGVFEAQELIIASQQNFWVMVDNRQHLYWLEQARLPAPVTCWLKID 126

Query: 130 TGFNRLGLSLQEALDFTH--NSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           TG +RLG+  +EA +F    +S   + G+L +  +H A AD+      + QL  F ++ +
Sbjct: 127 TGMHRLGVQPEEAAEFHQRLSSCENRTGEL-VTCTHFASADELDKPQTTEQLALFESITA 185

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVTAEARII 243
              G   S A+SSG+L  PN H+   RPG  LYG +     +HP    +  V+T  + +I
Sbjct: 186 DLPGPR-SAANSSGLLGWPNSHYDWIRPGYMLYGNS-PFTATHPNTDTLHPVMTLCSAVI 243

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            IR   +GE V Y       R S IA  +IGY DGYP   +            G    I 
Sbjct: 244 SIRNVASGESVGYAANWTAQRPSRIATVSIGYGDGYPRLAAN-----------GTPVLIN 292

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G   P+ G+++MDM   DITD   +++GD + ++G ++ + +VA  +GT  Y+L  R+  
Sbjct: 293 GQRAPLAGRVSMDMITVDITDLDDVKLGDQVILWGEELPVSEVAAHAGTIGYELTTRMPA 352

Query: 364 RYAKFYT 370
           R  +  T
Sbjct: 353 RTPRVVT 359


>gi|311693521|gb|ADP96394.1| alanine racemase [marine bacterium HP15]
          Length = 358

 Score =  162 bits (410), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 109/366 (29%), Positives = 181/366 (49%), Gaps = 22/366 (6%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +IDL AL+ N+ +    +G AR  AVVK + YG G   +A AL ++    + V  +EE  
Sbjct: 8   RIDLDALRRNFQTAQRRAGGARVMAVVKADGYGHGIGPVASAL-DSLAPKYAVACLEEAR 66

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQV 128
            +R       + +L G+H   +      +   PV  S  QL +  +L +      + L+V
Sbjct: 67  AIRETGLIQSVVLLQGVHAEADIDECARSGFEPVFHSFQQLAWLERLDTWPA---FWLKV 123

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI--ISHLACADDPSSHVNSVQLERFRTLI 186
           ++G NRLG    E L    +          L+  ++H ACADDP S + + Q   F    
Sbjct: 124 NSGMNRLGFHPDE-LAGVMSRLQAMSADTELLGFVTHFACADDPDSAMTAQQTAVFEKAT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
           S +  +  S+A+S+         F  +RPGI LYGG+  +  + P   ++ V++ EA +I
Sbjct: 183 SSFPDLMKSVANSAAHFRPGQPMFDWSRPGIMLYGGSPMVGTTGPELGLEPVMSLEAPLI 242

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
             R   AGE V YG      RD+ + + AIGY DGYP         ++P+        I 
Sbjct: 243 STRMVPAGESVGYGASWVADRDTRMGMVAIGYGDGYPRHAG----TNTPAA-------IN 291

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  + ++G+++MDM   D+T++   + GD ++++G  + +D+VA  +GT +Y+L+  I  
Sbjct: 292 GQRIRLIGRVSMDMLAVDLTNAPDAKEGDSVELWGRTVGVDEVAACAGTISYELMTGITG 351

Query: 364 RYAKFY 369
           R  + Y
Sbjct: 352 RVPRQY 357


>gi|289548107|ref|YP_003473095.1| alanine racemase [Thermocrinis albus DSM 14484]
 gi|289181724|gb|ADC88968.1| alanine racemase [Thermocrinis albus DSM 14484]
          Length = 337

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 125/366 (34%), Positives = 192/366 (52%), Gaps = 37/366 (10%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYN-AGVQDFFVTSVEE 67
           L+I+  AL  N   +N  +G  +  AVVK NAYG+G   IA  L     V  F V  VEE
Sbjct: 5   LEINRDALLQNVKRINTFTGK-KLIAVVKANAYGVGATLIASLLEPLEEVAAFAVACVEE 63

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           GV+LR    +  I VL G+ P + + +   NL PV+S    L         G    + ++
Sbjct: 64  GVELREAGVKKPILVLGGVLPEELEELVRWNLTPVVSHPSHLKALE-----GSFVKFHVK 118

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
            DTG  RLG  L+E +            ++  +++HL+   D S  +   Q+E FR ++S
Sbjct: 119 YDTGMGRLGF-LEEIIQDR---------RVEGVMTHLSHPADRSFTLK--QIETFRKIVS 166

Query: 188 HYKGIE-ASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQ--TVVTAEARIIL 244
           HY+G++   L SS+G++   +Y   + R G++LYG  +K   S+P++    ++ +ARII 
Sbjct: 167 HYRGVKWVHLESSAGLIYRVDYATHV-RVGLALYG--EKPLSSYPIELSPALSLKARIIS 223

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           ++   AG  VSYG    L RD+ + V AIGYADG   +LSG             + + +G
Sbjct: 224 VKVLPAGHRVSYGDSCVLKRDTRVGVVAIGYADGLLKSLSG-----------KARFYYRG 272

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
             VP+LG ITMDMTM D++ S+  EVGD+++I GP      +A  +GT  Y+L+  +  R
Sbjct: 273 VPVPLLGNITMDMTMVDLS-SVEAEVGDWVEIVGPHQSFTQLAKEAGTIPYELMSLLSRR 331

Query: 365 YAKFYT 370
             + + 
Sbjct: 332 VHRVFA 337


>gi|153840096|ref|ZP_01992763.1| alanine racemase [Vibrio parahaemolyticus AQ3810]
 gi|149746306|gb|EDM57372.1| alanine racemase [Vibrio parahaemolyticus AQ3810]
          Length = 361

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 186/367 (50%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL+AL++N   + A +  ++  AVVK N YG G   +A    +A    F V  +EE ++
Sbjct: 11  IDLSALQHNLQRVKAQAPESKVMAVVKANGYGHGLRHVAKHANHADA--FGVARIEEALQ 68

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 69  LRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQLI---ALEQADLETPVVVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++  +F         + +    +SH  CAD+  S +   Q+E F +L 
Sbjct: 126 IDSGMHRLGVRPEQYDEFISRLKTCPNVAKPLRYMSHFGCADELDSSITPQQIELFMSLT 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           S  +G E SLA+S+G+L  P    +  RPGI +YG +   DK  +    Q V+T ++ +I
Sbjct: 186 SGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFSDKTAQDLGYQPVMTLKSHLI 244

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YGG     RD+ + V A+GY DGYP +        +P+   G   ++ 
Sbjct: 245 AVREVKKGESVGYGGIWTSERDTKVGVIAVGYGDGYPRS--------APN---GTPVWVN 293

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI G+++MDM   D+    + +V D   ++G ++ +++VA   GT  Y+L+ ++  
Sbjct: 294 GRTVPIAGRVSMDMLTVDLGPDATDKVSDEAILWGKELPVEEVANHIGTIAYELVTKLTP 353

Query: 364 RYAKFYT 370
           R    YT
Sbjct: 354 RVEMEYT 360


>gi|308094758|ref|ZP_05891769.2| alanine racemase [Vibrio parahaemolyticus AN-5034]
 gi|308095056|ref|ZP_07663149.1| alanine racemase [Vibrio parahaemolyticus Peru-466]
 gi|308125857|ref|ZP_07663541.1| alanine racemase [Vibrio parahaemolyticus K5030]
 gi|308126480|ref|ZP_05910422.2| alanine racemase [Vibrio parahaemolyticus AQ4037]
 gi|308087451|gb|EFO37146.1| alanine racemase [Vibrio parahaemolyticus Peru-466]
 gi|308089684|gb|EFO39379.1| alanine racemase [Vibrio parahaemolyticus AN-5034]
 gi|308109426|gb|EFO46966.1| alanine racemase [Vibrio parahaemolyticus AQ4037]
 gi|308113312|gb|EFO50852.1| alanine racemase [Vibrio parahaemolyticus K5030]
          Length = 361

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 186/367 (50%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL+AL++N   + A +  ++  AVVK N YG G   +A    +A    F V  +EE ++
Sbjct: 11  IDLSALQHNLQRVKAQAPESKVMAVVKANGYGHGLRHVAKHANHADA--FGVARIEEALQ 68

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 69  LRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQLI---ALEQADLETPVVVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++  +F         + +    +SH  CAD+  S +   Q+E F +L 
Sbjct: 126 IDSGMHRLGVRPEQYDEFISRLKTCPNVAKPLRYMSHFGCADELDSSITPQQIELFMSLT 185

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           S  +G E SLA+S+G+L  P    +  RPGI +YG +   DK  +    Q V+T ++ +I
Sbjct: 186 SGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFSDKTAQDLGYQPVMTLKSHLI 244

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YGG     RD+ + V A+GY DGYP +        +P+   G   ++ 
Sbjct: 245 AVREVKQGESVGYGGIWTSERDTKVGVIAVGYGDGYPRS--------APN---GTPVWVN 293

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI G+++MDM   D+    + +V D   ++G ++ +++VA   GT  Y+L+ ++  
Sbjct: 294 GRTVPIAGRVSMDMLTVDLGPDATDKVSDEAILWGKELPVEEVANHIGTIAYELVTKLTP 353

Query: 364 RYAKFYT 370
           R    YT
Sbjct: 354 RVEMEYT 360


>gi|89075968|ref|ZP_01162340.1| alanine racemase [Photobacterium sp. SKA34]
 gi|89048317|gb|EAR53896.1| alanine racemase [Photobacterium sp. SKA34]
          Length = 359

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 186/369 (50%), Gaps = 26/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL +N   +   + N++  AVVK NAYG G  ++A  L N  V  + V  +EE + 
Sbjct: 8   IDTEALAHNLGLIRQHAPNSKVLAVVKANAYGHGLLRVAQTLSN--VDAYGVARIEEALI 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL--Q 127
           LR       I +L G + P    ++   N+  V+ S+ QL     L    + +P  +  +
Sbjct: 66  LRAGGIVKPILLLEGFYAPSDLPVLVTNNIHTVVHSIEQL---EALEQTELDNPVQVWVK 122

Query: 128 VDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++  DF    +  + + +    ISH   ADD SS +   QL+ F  L 
Sbjct: 123 IDTGMHRLGVRPEDLTDFMVRLNACENVAKPLRFISHFGNADDLSSDITLKQLDTFLDLT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD-----KINKSHPMQTVVTAEAR 241
             Y+G E SLA+S+GIL  P+   +  RPGI +YG +      +   S+ ++ V+T  + 
Sbjct: 183 QDYQG-ERSLAASAGILAWPDSQLEWIRPGIIMYGVSPFNESVRFAASYDLKPVMTLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    GE V YGG     RD+ + V AIGY DGYP T        +P+   G    
Sbjct: 242 LIAVRDVKQGEQVGYGGIWTSERDTKVGVIAIGYGDGYPRT--------APN---GTPVL 290

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G +VP+ G+++MDM   D+      +VGD   ++G  +  + VA   GT  Y+L+ ++
Sbjct: 291 VNGRIVPMAGRVSMDMLTVDLGPDAQDKVGDTATLWGEGLPAEVVAEHIGTIAYELVTKL 350

Query: 362 GTRYAKFYT 370
             R A  YT
Sbjct: 351 TPRVAMAYT 359


>gi|119776189|ref|YP_928929.1| alanine racemase [Shewanella amazonensis SB2B]
 gi|254802373|sp|A1SA53|ALR_SHEAM RecName: Full=Alanine racemase
 gi|119768689|gb|ABM01260.1| alanine racemase [Shewanella amazonensis SB2B]
          Length = 364

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 109/372 (29%), Positives = 187/372 (50%), Gaps = 26/372 (6%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALY----NAGVQDFF 61
           F R +I   ALK N   +  ++  ++  AVVK N YG G   +A  L     NA    F 
Sbjct: 4   FPRAEISSRALKANLKRLRQIAPGSKVMAVVKANGYGHGLLNVAEVLTDAHSNADADGFG 63

Query: 62  VTSVEEGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGV 120
           +  +EE +++R     AR+ +L G    ++  ++ + ++  V+  V QL     L S  +
Sbjct: 64  LARLEEALEVRAGGVSARLLLLEGFFRSEDLPLLVEHDIDTVVHHVSQLDM---LESVSL 120

Query: 121 SHPYA--LQVDTGFNRLGLSLQEALD-FTHNSFNKKLGQLSLIISHLACADDPSSHVNSV 177
           S P    L++D+G +RLG    E  D +     N  + +   +++H +CAD+P     + 
Sbjct: 121 SKPVTVWLKIDSGMHRLGFHASEFKDVYQRLQQNPNVAKPVHLMTHFSCADEPQKDFTAT 180

Query: 178 QLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQT 234
           Q+  F  L     G + +LA+S+G+L  P       RPGI+LYG +     +  +H ++ 
Sbjct: 181 QMAHFNALTQGLPG-DRTLANSAGVLYWPQSQADWIRPGIALYGVSPVAGDLGSNHGLEP 239

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
            +   +++I +R+  AGE V YG     +RD+ + V AIGY DGYP         ++P  
Sbjct: 240 AMELVSQLIAVREHSAGESVGYGAYWTASRDTRLGVVAIGYGDGYP--------RNAPE- 290

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTN 354
             G    + G  VPI+G+++MDM   D+    + +VGD   ++G ++ +++VA   GT  
Sbjct: 291 --GTPVLVNGRRVPIVGRVSMDMLTVDLGPDAADKVGDRALLWGKELPVEEVAERIGTIA 348

Query: 355 YDLLVRIGTRYA 366
           Y+L+ ++  R A
Sbjct: 349 YELVTKLTPRVA 360


>gi|297624657|ref|YP_003706091.1| alanine racemase [Truepera radiovictrix DSM 17093]
 gi|297165837|gb|ADI15548.1| alanine racemase [Truepera radiovictrix DSM 17093]
          Length = 374

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 120/372 (32%), Positives = 184/372 (49%), Gaps = 27/372 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +I L AL  N  S+ A +  A+    VK NAYG G  ++A  L   GV  F V + +E +
Sbjct: 11  EISLRALARNLASLRART-RAQLLVPVKANAYGHGAPEVARQLERLGVPWFGVATADEAL 69

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA---L 126
           +LR     A I +   ++ G E +I     + V+ +         ++    S P A   L
Sbjct: 70  ELRGAGISADILIFGPVYEGLEALIAQGVALSVVDA----RSAEAVVRAAGSVPGARVHL 125

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           + DTG  RLG  L   L         +   L  + +HLA AD+P S    VQL RF   +
Sbjct: 126 KTDTGMGRLGEPLAATLKTAERLSRARGVTLEGLWTHLAAADEPDSSFTQVQLARFSDTL 185

Query: 187 SHY--KGIEASL---ASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHP-MQTVVTA 238
           +     GI   L   A+S+ +   P  HF L RPGI++YG   +  I    P +  V+T 
Sbjct: 186 AALGRAGITVPLKHAANSAALFAHPASHFDLVRPGIAVYGYHASPFIAALAPELTPVMTL 245

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            A +  +++  AG  +SYGG  +  RD+ +A    GYADGYP  LS   + H+       
Sbjct: 246 SAPVTFVKRVAAGTPISYGGLWRAPRDTTVATVRFGYADGYPRGLSA--TPHA------- 296

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD-IKLDDVALASGTTNYDL 357
           +  ++G + PI+G++ MD  M D+ D L++ VG+   +FGP+    +D+A   GT +Y+L
Sbjct: 297 RVRLQGRLCPIVGRVCMDQLMVDVGD-LTVTVGERAVLFGPEGPTAEDLAGGVGTISYEL 355

Query: 358 LVRIGTRYAKFY 369
           L ++G R A+ Y
Sbjct: 356 LTQLGRRVARSY 367


>gi|330004917|ref|ZP_08305062.1| alanine racemase [Klebsiella sp. MS 92-3]
 gi|328536477|gb|EGF62821.1| alanine racemase [Klebsiella sp. MS 92-3]
          Length = 359

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 117/367 (31%), Positives = 181/367 (49%), Gaps = 25/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLTDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G    ++  +I    L   + S  QL   + L    +  P    ++
Sbjct: 66  LRAGGIAQPILLLEGFFAAEDLAVIAAQRLHTAVHSPEQL---AALEQADLPEPVTVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  +EA  F    S  K + Q   ++SH A AD+P+      QL+ F T  
Sbjct: 123 LDTGMHRLGVRPEEAEAFYQRLSQCKNVRQPVNVVSHFARADEPTCGATERQLDIFTTFT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD----KINKSHPMQTVVTAEARI 242
               G+  S+A+S GILL P  H+   RPGI LYG +        K    Q V+T  + +
Sbjct: 183 EGKPGLR-SIAASGGILLWPQSHYDWVRPGIILYGVSPLDDRSTGKDFGCQPVMTLTSSL 241

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G    +
Sbjct: 242 IAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGDGYP--------RAAPS---GTPVLV 290

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L+ R+ 
Sbjct: 291 NGREVPIVGRVAMDMICVDLGPQAQDKAGDAVVLWGEGLPVERIAEITKVSAYELITRLT 350

Query: 363 TRYAKFY 369
           +R A  Y
Sbjct: 351 SRVAMKY 357


>gi|269961478|ref|ZP_06175842.1| alanine racemase [Vibrio harveyi 1DA3]
 gi|269833855|gb|EEZ87950.1| alanine racemase [Vibrio harveyi 1DA3]
          Length = 369

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 115/382 (30%), Positives = 193/382 (50%), Gaps = 29/382 (7%)

Query: 1   MHSNEFLRLK-----IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNA 55
           M SN    +K     IDL+AL++N   +   +  ++  AVVK N YG G   +A    +A
Sbjct: 4   MMSNAMSYMKAAMACIDLSALQHNLQRVKEQAPESKVMAVVKANGYGHGLRHVAKHATHA 63

Query: 56  GVQDFFVTSVEEGVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSK 114
               F V  +EE ++LR       I +L G + PG   ++   N+  V+    QL   + 
Sbjct: 64  DA--FGVARIEEALQLRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---AA 118

Query: 115 LMSCGVSHPYA--LQVDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPS 171
           L    +  P    L++D+G +RLG+  ++  +F T       + +    +SH  CAD+  
Sbjct: 119 LEQADLETPVVVWLKIDSGMHRLGVRPEQYDEFITRLKECPNVAKPLRYMSHFGCADELD 178

Query: 172 SHVNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINK 228
           + + + Q++ F +L +  +G E SLA+S+G+L  P       RPGI +YG +   DK  +
Sbjct: 179 NSITTEQIDLFMSLTAGCQG-ERSLAASAGLLAWPQSQLDWVRPGIIMYGVSPFDDKTAQ 237

Query: 229 SHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDS 288
               + V+T ++ +I +R+   GE V YGG     RD+ + V A+GY DGYP T      
Sbjct: 238 DMGYKPVMTLKSHLIAVREVKKGESVGYGGMWTSERDTKVGVIAVGYGDGYPRT------ 291

Query: 289 EHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVAL 348
             +P+   G   F+ G  VPI G+++MDM   D+    + +V D   ++G D+ +++VA 
Sbjct: 292 --APN---GTPVFVNGRKVPIAGRVSMDMLTVDLGPDATDKVSDEAILWGKDLPVEEVAS 346

Query: 349 ASGTTNYDLLVRIGTRYAKFYT 370
             GT  Y+L+ ++ +R    Y+
Sbjct: 347 HIGTIAYELVTKLTSRVEMEYS 368


>gi|290476881|ref|YP_003469792.1| alanine racemase 1, PLP-binding, biosynthetic [Xenorhabdus bovienii
           SS-2004]
 gi|289176225|emb|CBJ83030.1| alanine racemase 1, PLP-binding, biosynthetic [Xenorhabdus bovienii
           SS-2004]
          Length = 359

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 114/366 (31%), Positives = 185/366 (50%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +   + +++  AVVK NAYG G  ++A  + +A    F V  + E + 
Sbjct: 8   IDRRALRHNLQQVRVKAPDSKLVAVVKANAYGHGFLEVAYTMEDA--DSFGVARIGEALA 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +  +   N I  V+ S+ QL     L    +SHP    ++
Sbjct: 66  LRNGGIVKPILLLEGFFEAADLPVLVVNHIETVVHSIEQL---EALEQANLSHPIKVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+ + EA +F    S    + Q   I+SH + AD+ +      Q++RF   I
Sbjct: 123 LDTGMHRLGVRIDEAEEFYQRLSCCHNVEQPVNIVSHFSRADELTVDTTPQQIDRFMAFI 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           +   G E S+A+S GILL P  H    RPGI +YG +   DK      +   +T ++ +I
Sbjct: 183 ADKSG-EKSIAASGGILLWPQAHLDWVRPGIMMYGASPIADKTAADFNLIPAMTLKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +RK  + E V YGG     RD+ + V A+GY DGYP +        +PS   G    I 
Sbjct: 242 AVRKHKSDESVGYGGTWISERDTTLGVVAVGYGDGYPRS--------APS---GTPVLIN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VP++G+++MDM   D+      +VGD + ++G  + ++ +A  +G + Y+L+ ++ +
Sbjct: 291 GRKVPLVGRVSMDMITVDLGPECYDKVGDEVTLWGNILPVEKIAEHTGISAYELITKLTS 350

Query: 364 RYAKFY 369
           R    Y
Sbjct: 351 RVVMEY 356


>gi|152972916|ref|YP_001338062.1| alanine racemase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|150957765|gb|ABR79795.1| alanine racemase [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
          Length = 359

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 117/367 (31%), Positives = 183/367 (49%), Gaps = 25/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLTDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G    ++  +I    L   + S  QL   + L    +  P    ++
Sbjct: 66  LRAGGIAQPILLLEGFFAAEDLAVIAAQRLHTAVHSPEQL---AALEQADLPEPVTVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  +EA  F    S  K + Q   ++SH A AD+P+      QL+ F T  
Sbjct: 123 LDTGMHRLGVRPEEAEAFYQRLSQCKNVRQPVNVVSHFARADEPTCGATERQLDIFTTFT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVTAEARI 242
               G+  S+A+S GILL P  H+   RPGI LYG +   ++S       Q V+T  + +
Sbjct: 183 EGKPGLR-SIAASGGILLWPQSHYDWVRPGIILYGVSPLDDRSTGRDFGCQPVMTLSSSL 241

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G    +
Sbjct: 242 IAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGDGYP--------RAAPS---GTPVLV 290

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L+ R+ 
Sbjct: 291 NGREVPIVGRVAMDMICVDLGPQAQDKAGDAVVLWGEGLPVERIAEITKVSAYELITRLT 350

Query: 363 TRYAKFY 369
           +R A  Y
Sbjct: 351 SRVAMKY 357


>gi|330501639|ref|YP_004378508.1| alanine racemase [Pseudomonas mendocina NK-01]
 gi|328915926|gb|AEB56757.1| alanine racemase [Pseudomonas mendocina NK-01]
          Length = 358

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 116/370 (31%), Positives = 182/370 (49%), Gaps = 32/370 (8%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL+A+ +N+      +   +  AVVK NAYG G  ++  AL++     F V  +EE  +
Sbjct: 8   VDLSAIAHNYAVAKRCAPGRQAFAVVKANAYGHGVREVVTALHDLA-DGFAVACLEEAAE 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YALQ 127
           +R    +AR+ +L G     E  I     L  VI    Q      L++  +  P    L+
Sbjct: 67  VRAMHGEARVLLLEGCFEASEYAIAAQLGLDLVIQGAAQ---AEALLASDLVRPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFN-KKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG        +     N +++ +L+L+ SH ACAD+    +   Q+ERF  L+
Sbjct: 124 LDSGMHRLGFDAANLRHWYARLENAEQVNELNLL-SHFACADERGHPLTEQQVERFLDLL 182

Query: 187 ----SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAE 239
               SH      SLA+S+ +L  P  H    RPGI LYG T   +   +   ++  +T  
Sbjct: 183 DLDFSHR-----SLANSAAVLTIPAAHMDWLRPGIMLYGATPFAELSARELGLKPAMTLA 237

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           AR+I +R+   GE V YG      R S IA  + GYADGYP         H+PS   G  
Sbjct: 238 ARVIAVREVAIGESVGYGASWVAQRPSRIATVSCGYADGYP--------RHAPS---GTP 286

Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
             ++G    + G+++MDM   DITD    +V   ++++G ++ LD+VA A  T  Y+LL 
Sbjct: 287 VLVEGQRAALAGRVSMDMLTVDITDLPEADVDSPVELWGANLPLDEVAAACSTIGYELLS 346

Query: 360 RIGTRYAKFY 369
           ++  R  + Y
Sbjct: 347 KVTARVPRRY 356


>gi|152979091|ref|YP_001344720.1| alanine racemase [Actinobacillus succinogenes 130Z]
 gi|171704339|sp|A6VP88|ALR_ACTSZ RecName: Full=Alanine racemase
 gi|150840814|gb|ABR74785.1| alanine racemase [Actinobacillus succinogenes 130Z]
          Length = 358

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 188/368 (51%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK+N   ++  + +++  A+VK NAYG G E +A  +    V  F V  +EE +
Sbjct: 7   KISSLALKHNLELIHQKAPDSKMIAIVKANAYGHGVEFVASTVEEQ-VDGFGVARIEEAL 65

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    ++  +I   N+  V+ +  QL     L    + +P    L
Sbjct: 66  TLRSKGIIKPILLLEGFFSAKDLPVIAVNNIQTVVHNREQL---EALKQTKLPNPIKVWL 122

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLII---SHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E  D+      KK   +  +I   SH + AD+  S    +QL RF 
Sbjct: 123 KIDTGMHRLGVALDEVEDYVEEL--KKCANVEPLIGYVSHFSRADELDSDYTRIQLNRFL 180

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
              +  KG    +A+S GIL  P+ H +  RPGI +YG   TD  +    +  V+T  + 
Sbjct: 181 QA-TEDKGGPRCIAASGGILFWPDSHLEWIRPGIIMYGVSPTDTPSSEFGLIPVMTLTSS 239

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     +D+ I V AIGY DGYP  +        PS   G   +
Sbjct: 240 LIAVRRHKAGEPVGYGGTWISKKDTKIGVIAIGYGDGYPRNI--------PS---GTPVY 288

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           I G +VPI+G+++MDM   D+ +  + +VGD + ++G ++ ++ VA   G  +Y+L+ ++
Sbjct: 289 INGRIVPIVGRVSMDMITVDLGEDCTDKVGDEVILWGKELPIETVAKHMGILSYELMTKL 348

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 349 TPRVLTEY 356


>gi|28899508|ref|NP_799113.1| alanine racemase [Vibrio parahaemolyticus RIMD 2210633]
 gi|34098474|sp|Q87L78|ALR1_VIBPA RecName: Full=Alanine racemase 1
 gi|28807744|dbj|BAC60997.1| alanine racemase, biosynthetic [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 358

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 186/367 (50%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL+AL++N   + A +  ++  AVVK N YG G   +A    +A    F V  +EE ++
Sbjct: 8   IDLSALQHNLQRVKAQAPESKVMAVVKANGYGHGLRHVAKHANHADA--FGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 66  LRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQLI---ALEQADLETPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++  +F         + +    +SH  CAD+  S +   Q+E F +L 
Sbjct: 123 IDSGMHRLGVRPEQYDEFISRLKTCPNVAKPLRYMSHFGCADELDSSITPQQIELFMSLT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           S  +G E SLA+S+G+L  P    +  RPGI +YG +   DK  +    Q V+T ++ +I
Sbjct: 183 SGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFSDKTAQDLGYQPVMTLKSHLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YGG     RD+ + V A+GY DGYP +        +P+   G   ++ 
Sbjct: 242 AVREVKQGESVGYGGIWTSERDTKVGVIAVGYGDGYPRS--------APN---GTPVWVN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI G+++MDM   D+    + +V D   ++G ++ +++VA   GT  Y+L+ ++  
Sbjct: 291 GRTVPIAGRVSMDMLTVDLGPDATDKVSDEAILWGKELPVEEVANHIGTIAYELVTKLTP 350

Query: 364 RYAKFYT 370
           R    YT
Sbjct: 351 RVEMEYT 357


>gi|328472359|gb|EGF43229.1| alanine racemase [Vibrio parahaemolyticus 10329]
          Length = 358

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 186/367 (50%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL+AL++N   + A +  ++  AVVK N YG G   +A    +A    F V  +EE ++
Sbjct: 8   IDLSALQHNLQRVKAQAPESKVMAVVKANGYGHGLRHVAKHANHADA--FGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 66  LRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQLI---ALEQADLETPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++  +F         + +    +SH  CAD+  S +   Q+E F +L 
Sbjct: 123 IDSGMHRLGVRPEQYDEFISRLKTCPNVAKPLRYMSHFGCADELDSSITPQQIELFMSLT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           S  +G E SLA+S+G+L  P    +  RPGI +YG +   DK  +    Q V+T ++ +I
Sbjct: 183 SGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFSDKTAQDLGYQPVMTLKSHLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YGG     RD+ + V A+GY DGYP +        +P+   G   ++ 
Sbjct: 242 AVREVKKGESVGYGGIWTSERDTKVGVIAVGYGDGYPRS--------APN---GTPVWVN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI G+++MDM   D+    + +V D   ++G ++ +++VA   GT  Y+L+ ++  
Sbjct: 291 GRTVPIAGRVSMDMLTVDLGPDATDKVSDEAILWGKELPVEEVANHIGTIAYELVTKLTP 350

Query: 364 RYAKFYT 370
           R    YT
Sbjct: 351 RVEMEYT 357


>gi|218556610|ref|YP_002389524.1| alanine racemase [Escherichia coli IAI1]
 gi|218363379|emb|CAR01032.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           IAI1]
          Length = 359

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 182/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSIGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|159029814|emb|CAO90868.1| alr [Microcystis aeruginosa PCC 7806]
          Length = 378

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 111/364 (30%), Positives = 181/364 (49%), Gaps = 25/364 (6%)

Query: 9   LKIDLTALKNNWHSMNAL-SGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           ++ID +AL+ N   + AL +      AV+K +AYG G  K+A ++  AG Q   + ++ E
Sbjct: 11  VEIDRSALQQNVRKVKALLAPKTELMAVIKADAYGHGAVKVANSVLEAGAQSLAIATIGE 70

Query: 68  GVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYA 125
           G++LR     A I +L  ++ P +   +    L P +  + Q+  ++ +M       P  
Sbjct: 71  GIELREAGIVAPIMILGAVNTPEEVAALAHWQLQPTLVQIEQVRIFAAVMRRLEQRLPVH 130

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           +++DTG +RLG        F          +++ I SH A ADDP+  +  +Q +RF+  
Sbjct: 131 IKLDTGMSRLGTPWHNGTKFVEQVLEAPNLKIASIYSHFATADDPNPEIMQLQRQRFQQA 190

Query: 186 ISHYK--GIEAS---LASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTA 238
           I+  K  G       LA+S+  L   + H+   R G++LYG    D +    P+Q V+  
Sbjct: 191 IAELKSKGYHPPCLHLANSAATLSDRSLHYDRVRVGLALYGLYPADHLTDKVPLQPVLQV 250

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           +ARI  ++   AG  VSYG Q    +D+ IAV  IGYADG P  LS              
Sbjct: 251 KARIAQVKTIAAGSGVSYGHQYIAAKDTRIAVVGIGYADGIPRNLSN-----------RL 299

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALASGTTN 354
           K  ++G +VP +G ITMD  M D+++   ++ G+ + + G D    I  DD A   GT +
Sbjct: 300 KVSLRGRLVPQIGAITMDQLMIDVSEIPEVKTGEIVTLIGKDGLQCITADDWARDLGTIS 359

Query: 355 YDLL 358
           +++L
Sbjct: 360 WEIL 363


>gi|238892526|ref|YP_002917260.1| alanine racemase [Klebsiella pneumoniae NTUH-K2044]
 gi|238544842|dbj|BAH61193.1| alanine racemase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
          Length = 359

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 117/367 (31%), Positives = 183/367 (49%), Gaps = 25/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLTDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G    ++  +I    L   + S  QL   + L    +  P    ++
Sbjct: 66  LRAGGIAQPILLLEGFFAAEDLAVIAAQRLHTAVHSPEQL---AALEQADLPEPVTVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  +EA  F    S  K + Q   ++SH A AD+P+      QL+ F T  
Sbjct: 123 LDTGMHRLGVRPEEAEAFYQRLSQCKNVRQPVNVVSHFARADEPTCGATERQLDIFTTFT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVTAEARI 242
               G+  S+A+S GILL P  H+   RPGI LYG +   ++S       Q V+T  + +
Sbjct: 183 EGKPGLR-SIAASGGILLWPQSHYDWVRPGIILYGVSPLDDRSTGRDFGCQPVMTLTSSL 241

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G    +
Sbjct: 242 IAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGDGYP--------RAAPS---GTPVLV 290

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L+ R+ 
Sbjct: 291 NGREVPIVGRVAMDMICVDLGPQAQDKAGDAVVLWGEGLPVERIAEITKVSAYELITRLT 350

Query: 363 TRYAKFY 369
           +R A  Y
Sbjct: 351 SRVAMKY 357


>gi|206581084|ref|YP_002241006.1| alanine racemase [Klebsiella pneumoniae 342]
 gi|290512391|ref|ZP_06551758.1| alanine racemase [Klebsiella sp. 1_1_55]
 gi|206570142|gb|ACI11918.1| alanine racemase [Klebsiella pneumoniae 342]
 gi|289775386|gb|EFD83387.1| alanine racemase [Klebsiella sp. 1_1_55]
          Length = 359

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 117/367 (31%), Positives = 181/367 (49%), Gaps = 25/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRDLAPASKLVAVVKANAYGHGLLETARTLTDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G    ++  +I    L   + S  QL   + L    +  P    ++
Sbjct: 66  LRAGGIAQPILLLEGFFAAEDLAVIAAQRLHTAVHSPEQL---AALEQADLPEPVTVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  +EA  F    S  K + Q   ++SH A AD+P+      QL+ F T  
Sbjct: 123 LDTGMHRLGVRPEEAEAFYQRLSQCKNVRQPVNVVSHFARADEPTCGATERQLDIFTTFT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD----KINKSHPMQTVVTAEARI 242
               G+  S+A+S GILL P  H+   RPGI LYG +        K    Q V+T  + +
Sbjct: 183 EGKPGLR-SIAASGGILLWPQSHYDWVRPGIILYGVSPLDDRSTGKDFGCQPVMTLTSSL 241

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G    +
Sbjct: 242 IAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGDGYP--------RAAPS---GTPVLV 290

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L+ R+ 
Sbjct: 291 NGREVPIVGRVAMDMICVDLGPQAQDKAGDAVVLWGEGLPVERIAEITKVSAYELITRLT 350

Query: 363 TRYAKFY 369
           +R A  Y
Sbjct: 351 SRVAMKY 357


>gi|262163859|ref|ZP_06031599.1| alanine racemase biosynthetic [Vibrio mimicus VM223]
 gi|262027839|gb|EEY46504.1| alanine racemase biosynthetic [Vibrio mimicus VM223]
          Length = 364

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 118/369 (31%), Positives = 183/369 (49%), Gaps = 28/369 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   + +++  AVVK N YG G   IA   Y  G   F V  +EE ++
Sbjct: 11  INLDALQHNLQRVKQQAPHSKIMAVVKANGYGHGLRHIA--RYAIGADAFGVARIEEALQ 68

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +  G   ++   N+  V+    QL     L    +  P    L+
Sbjct: 69  LRASGVVKPILLLEGFYSQGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+      + Q E F +
Sbjct: 126 VDSGMHRLGVRPEQYRDFVNRLHQCVN--VAKPLRYMSHFGCADELDKSTTAEQTELFLS 183

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEAR 241
           L    +G E SLA+S+G+L  P    +  RPGI +YG +    KS      Q V+T ++ 
Sbjct: 184 LTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFAEKSAEELGYQPVMTLKSH 242

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 243 LIAVREVKAGESVGYGGIWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 291

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+    +  VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 292 VNGRRVPIAGRVSMDMLTVDLGPEAADCVGDEAMLWGRELPVEEVAAHIGTLGYELVTKL 351

Query: 362 GTRYAKFYT 370
            +R    Y+
Sbjct: 352 TSRVEMSYS 360


>gi|288937652|ref|YP_003441711.1| alanine racemase [Klebsiella variicola At-22]
 gi|288892361|gb|ADC60679.1| alanine racemase [Klebsiella variicola At-22]
          Length = 359

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 117/367 (31%), Positives = 181/367 (49%), Gaps = 25/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRDLAPASKLVAVVKANAYGHGLLETARTLTDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G    ++  +I    L   + S  QL   + L    +  P    ++
Sbjct: 66  LRAGGIAQPILLLEGFFAAEDLAVIAAQRLHTAVHSPEQL---AALEQADLPEPVTVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  +EA  F    S  K + Q   ++SH A AD+P+      QL+ F T  
Sbjct: 123 LDTGMHRLGVRPEEAEAFYQRLSQCKNVRQPVNVVSHFARADEPTCGATERQLDIFTTFT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD----KINKSHPMQTVVTAEARI 242
               G+  S+A+S GILL P  H+   RPGI LYG +        K    Q V+T  + +
Sbjct: 183 EGKPGLR-SIAASGGILLWPQSHYDWVRPGIILYGVSPLDDRSTGKDFGCQPVMTLTSSL 241

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G    +
Sbjct: 242 IAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGDGYP--------RAAPS---GTPVLV 290

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L+ R+ 
Sbjct: 291 NGREVPIVGRVAMDMICVDLGPQAQDKAGDAVVLWGEGLAVERIAEITKVSAYELITRLT 350

Query: 363 TRYAKFY 369
           +R A  Y
Sbjct: 351 SRVAMKY 357


>gi|301021579|ref|ZP_07185579.1| alanine racemase [Escherichia coli MS 69-1]
 gi|300397977|gb|EFJ81515.1| alanine racemase [Escherichia coli MS 69-1]
          Length = 359

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAETFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWGSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|193067831|ref|ZP_03048797.1| alanine racemase [Escherichia coli E110019]
 gi|192958806|gb|EDV89243.1| alanine racemase [Escherichia coli E110019]
          Length = 359

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 182/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P+IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPMISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|218707674|ref|YP_002415193.1| alanine racemase [Escherichia coli UMN026]
 gi|293402691|ref|ZP_06646788.1| alanine racemase [Escherichia coli FVEC1412]
 gi|293407785|ref|ZP_06651625.1| alanine racemase [Escherichia coli B354]
 gi|298378219|ref|ZP_06988103.1| alanine racemase [Escherichia coli FVEC1302]
 gi|300899831|ref|ZP_07118045.1| alanine racemase [Escherichia coli MS 198-1]
 gi|218434771|emb|CAR15704.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           UMN026]
 gi|284924146|emb|CBG37245.1| alanine racemase [Escherichia coli 042]
 gi|291429606|gb|EFF02620.1| alanine racemase [Escherichia coli FVEC1412]
 gi|291472036|gb|EFF14518.1| alanine racemase [Escherichia coli B354]
 gi|298280553|gb|EFI22054.1| alanine racemase [Escherichia coli FVEC1302]
 gi|300356602|gb|EFJ72472.1| alanine racemase [Escherichia coli MS 198-1]
          Length = 359

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCDATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|153803236|ref|ZP_01957822.1| alanine racemase, biosynthetic [Vibrio cholerae MZO-3]
 gi|124121216|gb|EAY39959.1| alanine racemase, biosynthetic [Vibrio cholerae MZO-3]
          Length = 376

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 180/371 (48%), Gaps = 33/371 (8%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   +  ++  AVVK N YG G   IA   +  G   F V  +EE ++
Sbjct: 22  INLEALQHNLQRVKQQAPESKIMAVVKANGYGHGLRHIA--RHALGADAFGVARIEEALQ 79

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 80  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 136

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLER 181
           VD+G +RLG+   E     +  F  +L Q   +      +SH  CAD+        Q E 
Sbjct: 137 VDSGMHRLGVVRPE----QYQDFVARLHQCENVAKPLRYMSHFGCADELDKSTTVEQTEL 192

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM---QTVVTA 238
           F +L    +G E SLA+S+G+L  P    +  RPGI +YG +  + KS      Q V+T 
Sbjct: 193 FLSLTQGCQG-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFVEKSAVQLGYQPVMTL 251

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           ++ +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G 
Sbjct: 252 KSHLIAVREVKAGESVGYGGTWTSQRDTKIGVIAIGYGDGYPRT--------APN---GT 300

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
              + G  VPI G+++MDM   D+       VGD   ++G ++ +++VA   GT  Y+L+
Sbjct: 301 PVVVNGRRVPIAGRVSMDMLTVDLGPDACDRVGDEAMLWGNELPVEEVAAHIGTIGYELV 360

Query: 359 VRIGTRYAKFY 369
            ++ +R    Y
Sbjct: 361 TKLTSRVEMSY 371


>gi|218692336|ref|YP_002400548.1| alanine racemase [Escherichia coli ED1a]
 gi|331660619|ref|ZP_08361551.1| alanine racemase [Escherichia coli TA206]
 gi|218429900|emb|CAR10727.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           ED1a]
 gi|331051661|gb|EGI23700.1| alanine racemase [Escherichia coli TA206]
          Length = 359

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 182/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    ++ P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLNEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|319897248|ref|YP_004135443.1| alanine racemase 1, plp-binding, biosynthetic [Haemophilus
           influenzae F3031]
 gi|317432752|emb|CBY81117.1| alanine racemase 1, PLP-binding, biosynthetic [Haemophilus
           influenzae F3031]
          Length = 360

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 183/367 (49%), Gaps = 24/367 (6%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L  + V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTLEQS-VDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
            LR       I +L G    Q+  I   N I  I  V        L    +  P    L+
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETI--VHNREQLEALKRANLPSPIKVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFRT 184
           +DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF +
Sbjct: 126 IDTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTKLQINRFLS 183

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEARI 242
                +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + +
Sbjct: 184 ATKDKQG-ERTIAASGGILFWPKSHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSSL 242

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R    G+ V YGG    +RD+ I V A+GY DGYP      D      V+L G+   
Sbjct: 243 IAVRHHKQGDPVGYGGIWTSSRDTKIGVVAMGYGDGYPR-----DVPEGTPVYLNGR--- 294

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
              +VPI+G+++MDM   D++     +VGD + ++G ++ ++ VA  +G  +Y+L+ ++ 
Sbjct: 295 ---LVPIVGRVSMDMLTVDLSTDSQDQVGDEVILWGKELPIETVAKFTGILSYELITKLT 351

Query: 363 TRYAKFY 369
            R    Y
Sbjct: 352 PRVITEY 358


>gi|260858163|ref|YP_003232054.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           O26:H11 str. 11368]
 gi|257756812|dbj|BAI28314.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           O26:H11 str. 11368]
 gi|323155607|gb|EFZ41782.1| alanine racemase [Escherichia coli EPECa14]
          Length = 365

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|229519921|ref|ZP_04409352.1| alanine racemase biosynthetic [Vibrio cholerae TM 11079-80]
 gi|229343049|gb|EEO08036.1| alanine racemase biosynthetic [Vibrio cholerae TM 11079-80]
          Length = 375

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/368 (31%), Positives = 180/368 (48%), Gaps = 28/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   +  ++  AVVK N YG G   IA   +  G   F V  +EE ++
Sbjct: 22  INLEALQHNLQRVKQQAPESKIMAVVKANGYGHGLRHIA--RHALGADAFGVARIEEALQ 79

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL     L    +  P    L+
Sbjct: 80  LRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---QALEQAQLETPVMVWLK 136

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           VD+G +RLG+  ++  DF    H   N  + +    +SH  CAD+        Q E F +
Sbjct: 137 VDSGMHRLGVRPEQYQDFVARLHQCEN--VAKPLRYMSHFGCADELDKSTTVEQTELFLS 194

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM---QTVVTAEAR 241
           L    +  E SLA+S+G+L  P    +  RPGI +YG +  + KS      Q V+T ++ 
Sbjct: 195 LTQGCQD-ERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFVEKSAVQLGYQPVMTLKSH 253

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ I V AIGY DGYP T        +P+   G    
Sbjct: 254 LIAVREVKAGESVGYGGTWTSQRDTKIGVIAIGYGDGYPRT--------APN---GTPVV 302

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G  VPI G+++MDM   D+       VGD   ++G ++ +++VA   GT  Y+L+ ++
Sbjct: 303 VNGRRVPIAGRVSMDMLTVDLGPDACDRVGDEAMLWGNELPVEEVAAHIGTIGYELVTKL 362

Query: 362 GTRYAKFY 369
            +R    Y
Sbjct: 363 TSRVEMSY 370


>gi|86148219|ref|ZP_01066516.1| alanine racemase [Vibrio sp. MED222]
 gi|85833989|gb|EAQ52150.1| alanine racemase [Vibrio sp. MED222]
          Length = 358

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 119/371 (32%), Positives = 187/371 (50%), Gaps = 34/371 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N + + + + + +  +VVK N YG G + IA   ++     F V  +EE ++
Sbjct: 8   IDLNALEHNLNQIKSKAPHCKVMSVVKANGYGHGLQHIAK--HSKSSDAFGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +  G   I+   N+  V+    QL   S L +  +  P    L+
Sbjct: 66  LRAGGIVKPILLLEGFYSSGDLPILVTNNIQTVVHCEEQL---SALENAELETPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLER 181
           VD+G +RLG   ++     + +F ++L Q + +      +SH  CAD+        Q E 
Sbjct: 123 VDSGMHRLGARPEQ-----YQNFVERLHQCANVAKPLRYMSHFGCADELDRATTVEQTEL 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTA 238
           F +L    +G E SLA+S+G+L  P+ H    RPGI  YG +   DK  +      V+T 
Sbjct: 178 FLSLTDGCEG-ERSLAASAGLLAWPDSHLDWVRPGIISYGVSPFADKSAQDLGFYPVMTL 236

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            + +I +R   AGE V YGG     RD+ + V AIGY DGYP T        +P+   G 
Sbjct: 237 TSHLIAVRDVKAGESVGYGGNWTSERDTKVGVIAIGYGDGYPRT--------APN---GT 285

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             F+ G  VPI G+++MDM   D+    + +VGD   ++G D+  ++VA   GT  Y+L+
Sbjct: 286 PVFVNGRKVPIAGRVSMDMLTVDLGPDAADKVGDEATLWGKDLPSEEVAEHIGTIAYELV 345

Query: 359 VRIGTRYAKFY 369
            ++ +R A  Y
Sbjct: 346 TKLTSRVAMEY 356


>gi|157157084|ref|YP_001465553.1| alanine racemase [Escherichia coli E24377A]
 gi|157079114|gb|ABV18822.1| alanine racemase [Escherichia coli E24377A]
          Length = 359

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKSG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|120555293|ref|YP_959644.1| alanine racemase [Marinobacter aquaeolei VT8]
 gi|166969416|sp|A1U388|ALR_MARAV RecName: Full=Alanine racemase
 gi|120325142|gb|ABM19457.1| alanine racemase [Marinobacter aquaeolei VT8]
          Length = 357

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 104/365 (28%), Positives = 180/365 (49%), Gaps = 21/365 (5%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +IDL ALK+N+     L+G A   AVVK + YG G   +A AL       F V  +EE +
Sbjct: 8   RIDLDALKHNFRRARELAGTAYAMAVVKADGYGHGIRSVADALAPE-TSRFAVACIEEAI 66

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFD-TNLIPVISSVPQLTFYSKLMSCGVSHPYALQV 128
            +R    +  + +L G H   +    + +   PV+    QL++    +  G S  + ++V
Sbjct: 67  AIRGAGHRHSVVLLQGTHQKDDLAECERSGFEPVLHCQQQLSW----LGAGRSPRFWIKV 122

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTLIS 187
           +TG NRLG   +E  +         L  L++  ++H ACADD  S +  +Q   F   ++
Sbjct: 123 NTGMNRLGFRPEELPEVMAGLEEAGLKHLAIGFVTHFACADDSDSEMTGLQTRIFERAVA 182

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARIIL 244
            +  +  S+ +S+         ++ +RPGI LYG +    K+     +   +T +A +I 
Sbjct: 183 PWPDLMRSVGNSAAHFRPNQPLYEWSRPGIMLYGASPMEGKTGAELGLCPAMTLQAPLIT 242

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
            R   AGE V YG     ++D+ + + AIGYADGYP         H+ +   G    ++G
Sbjct: 243 TRVVRAGESVGYGASWTASQDTRMGMVAIGYADGYP--------RHAGT---GTPAAVRG 291

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
             + +LG+++MDM   D++       GD ++++G  + +D+VA  +GT  Y+LL  + +R
Sbjct: 292 QRIRLLGRVSMDMLAVDLSAVPEAREGDMVELWGKTVSVDEVATCAGTIGYELLTGVTSR 351

Query: 365 YAKFY 369
             + +
Sbjct: 352 VPRVH 356


>gi|301330573|ref|ZP_07223182.1| alanine racemase [Escherichia coli MS 78-1]
 gi|300843491|gb|EFK71251.1| alanine racemase [Escherichia coli MS 78-1]
          Length = 359

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 IARLTSRVAMKY 357


>gi|262045542|ref|ZP_06018563.1| alanine racemase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259037101|gb|EEW38351.1| alanine racemase [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 359

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 116/367 (31%), Positives = 183/367 (49%), Gaps = 25/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLTDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G    ++  +I    L   + S  QL   + L    +  P    ++
Sbjct: 66  LRAGGIAQPILLLEGFFAAEDLAVIAAQRLHTAVHSPEQL---AALEQADLPEPVTVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  +EA  F    S  K + Q   ++SH A AD+P+      QL+ F T  
Sbjct: 123 LDTGMHRLGVRPEEAEAFYQRLSQCKNVRQPVNVVSHFARADEPTCGATERQLDIFTTFT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVTAEARI 242
               G+  S+A+S GILL P  H+   RPGI LYG +   ++S       Q V+T  + +
Sbjct: 183 EGKPGLR-SIAASGGILLWPQSHYDWVRPGIILYGVSPLDDRSTGNDFGCQPVMTLTSSL 241

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G    +
Sbjct: 242 IAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGDGYP--------RATPS---GTPVLV 290

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  +PI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L+ R+ 
Sbjct: 291 NGREMPIVGRVAMDMICVDLGPQAQDKAGDAVVLWGEGLPVERIAEITKVSAYELITRLT 350

Query: 363 TRYAKFY 369
           +R A  Y
Sbjct: 351 SRVAMKY 357


>gi|58257634|dbj|BAD88778.1| alanine racemase [synthetic construct]
          Length = 359

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 118/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEGQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ VA  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERVAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|331650063|ref|ZP_08351136.1| alanine racemase [Escherichia coli M605]
 gi|330908377|gb|EGH36896.1| alanine racemase, biosynthetic [Escherichia coli AA86]
 gi|331041008|gb|EGI13165.1| alanine racemase [Escherichia coli M605]
          Length = 359

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEANLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|74314547|ref|YP_312966.1| alanine racemase [Shigella sonnei Ss046]
 gi|20137404|sp|Q93HP9|ALR1_SHISO RecName: Full=Alanine racemase, biosynthetic
 gi|16610221|dbj|BAB71773.1| alanine racemase [Shigella sonnei]
 gi|73858024|gb|AAZ90731.1| alanine racemase 1 [Shigella sonnei Ss046]
 gi|323164550|gb|EFZ50351.1| alanine racemase [Shigella sonnei 53G]
          Length = 359

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSIGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|170769516|ref|ZP_02903969.1| alanine racemase [Escherichia albertii TW07627]
 gi|170121573|gb|EDS90504.1| alanine racemase [Escherichia albertii TW07627]
          Length = 359

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 183/372 (49%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEADLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P+      QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAGAFYHRLTQCKNVRQPVNIVSHFARADEPTCGATEKQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQSQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|16131879|ref|NP_418477.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           str. K-12 substr. MG1655]
 gi|24115357|ref|NP_709867.1| alanine racemase [Shigella flexneri 2a str. 301]
 gi|30064642|ref|NP_838813.1| alanine racemase [Shigella flexneri 2a str. 2457T]
 gi|89110774|ref|AP_004554.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           str. K-12 substr. W3110]
 gi|91213579|ref|YP_543565.1| alanine racemase [Escherichia coli UTI89]
 gi|110807930|ref|YP_691450.1| alanine racemase [Shigella flexneri 5 str. 8401]
 gi|117626323|ref|YP_859646.1| alanine racemase [Escherichia coli APEC O1]
 gi|157163522|ref|YP_001460840.1| alanine racemase [Escherichia coli HS]
 gi|170021949|ref|YP_001726903.1| alanine racemase [Escherichia coli ATCC 8739]
 gi|170083510|ref|YP_001732830.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170680683|ref|YP_001746442.1| alanine racemase [Escherichia coli SMS-3-5]
 gi|188492399|ref|ZP_02999669.1| alanine racemase [Escherichia coli 53638]
 gi|191168796|ref|ZP_03030572.1| alanine racemase [Escherichia coli B7A]
 gi|194437323|ref|ZP_03069421.1| alanine racemase [Escherichia coli 101-1]
 gi|209921537|ref|YP_002295621.1| alanine racemase [Escherichia coli SE11]
 gi|215489388|ref|YP_002331819.1| alanine racemase [Escherichia coli O127:H6 str. E2348/69]
 gi|218561126|ref|YP_002394039.1| alanine racemase [Escherichia coli S88]
 gi|218697761|ref|YP_002405428.1| alanine racemase [Escherichia coli 55989]
 gi|218702717|ref|YP_002410346.1| alanine racemase [Escherichia coli IAI39]
 gi|237703613|ref|ZP_04534094.1| alanine racemase 1 [Escherichia sp. 3_2_53FAA]
 gi|238903162|ref|YP_002928958.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           BW2952]
 gi|253775319|ref|YP_003038150.1| alanine racemase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254037050|ref|ZP_04871127.1| alanine racemase 1 [Escherichia sp. 1_1_43]
 gi|254163989|ref|YP_003047097.1| alanine racemase [Escherichia coli B str. REL606]
 gi|256024926|ref|ZP_05438791.1| alanine racemase [Escherichia sp. 4_1_40B]
 gi|260870812|ref|YP_003237214.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           O111:H- str. 11128]
 gi|293476357|ref|ZP_06664765.1| alanine racemase [Escherichia coli B088]
 gi|300817971|ref|ZP_07098184.1| alanine racemase [Escherichia coli MS 107-1]
 gi|300823594|ref|ZP_07103722.1| alanine racemase [Escherichia coli MS 119-7]
 gi|300906364|ref|ZP_07124062.1| alanine racemase [Escherichia coli MS 84-1]
 gi|300917299|ref|ZP_07133972.1| alanine racemase [Escherichia coli MS 115-1]
 gi|300924316|ref|ZP_07140295.1| alanine racemase [Escherichia coli MS 182-1]
 gi|300929792|ref|ZP_07145244.1| alanine racemase [Escherichia coli MS 187-1]
 gi|300938190|ref|ZP_07152960.1| alanine racemase [Escherichia coli MS 21-1]
 gi|300946625|ref|ZP_07160884.1| alanine racemase [Escherichia coli MS 116-1]
 gi|300957537|ref|ZP_07169744.1| alanine racemase [Escherichia coli MS 175-1]
 gi|301019191|ref|ZP_07183389.1| alanine racemase [Escherichia coli MS 196-1]
 gi|301302732|ref|ZP_07208861.1| alanine racemase [Escherichia coli MS 124-1]
 gi|301645041|ref|ZP_07245004.1| alanine racemase [Escherichia coli MS 146-1]
 gi|306815836|ref|ZP_07449981.1| alanine racemase [Escherichia coli NC101]
 gi|307140743|ref|ZP_07500099.1| alanine racemase [Escherichia coli H736]
 gi|307312105|ref|ZP_07591742.1| alanine racemase [Escherichia coli W]
 gi|309795859|ref|ZP_07690273.1| alanine racemase [Escherichia coli MS 145-7]
 gi|312965646|ref|ZP_07779875.1| alanine racemase [Escherichia coli 2362-75]
 gi|312974153|ref|ZP_07788324.1| alanine racemase [Escherichia coli 1827-70]
 gi|331644794|ref|ZP_08345911.1| alanine racemase [Escherichia coli H736]
 gi|331670916|ref|ZP_08371750.1| alanine racemase [Escherichia coli TA271]
 gi|331680183|ref|ZP_08380842.1| alanine racemase [Escherichia coli H591]
 gi|331680983|ref|ZP_08381620.1| alanine racemase [Escherichia coli H299]
 gi|67462106|sp|P0A6B4|ALR1_ECOLI RecName: Full=Alanine racemase, biosynthetic
 gi|67462107|sp|P0A6B5|ALR1_SHIFL RecName: Full=Alanine racemase, biosynthetic
 gi|67462108|sp|P0A6B6|ALR1_SHIBO RecName: Full=Alanine racemase, biosynthetic
 gi|1790487|gb|AAC77023.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           str. K-12 substr. MG1655]
 gi|16610217|dbj|BAB71771.1| alanine racemase [Shigella boydii]
 gi|24054663|gb|AAN45574.1| alanine racemase 1 [Shigella flexneri 2a str. 301]
 gi|30042901|gb|AAP18624.1| alanine racemase 1 [Shigella flexneri 2a str. 2457T]
 gi|85676805|dbj|BAE78055.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           str. K12 substr. W3110]
 gi|91075153|gb|ABE10034.1| alanine racemase 1 [Escherichia coli UTI89]
 gi|110617478|gb|ABF06145.1| alanine racemase 1 [Shigella flexneri 5 str. 8401]
 gi|115515447|gb|ABJ03522.1| alanine racemase 1 [Escherichia coli APEC O1]
 gi|157069202|gb|ABV08457.1| alanine racemase [Escherichia coli HS]
 gi|169756877|gb|ACA79576.1| alanine racemase [Escherichia coli ATCC 8739]
 gi|169891345|gb|ACB05052.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170518401|gb|ACB16579.1| alanine racemase [Escherichia coli SMS-3-5]
 gi|188487598|gb|EDU62701.1| alanine racemase [Escherichia coli 53638]
 gi|190901174|gb|EDV60947.1| alanine racemase [Escherichia coli B7A]
 gi|194423879|gb|EDX39868.1| alanine racemase [Escherichia coli 101-1]
 gi|209914796|dbj|BAG79870.1| alanine racemase [Escherichia coli SE11]
 gi|215267460|emb|CAS11914.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           O127:H6 str. E2348/69]
 gi|218354493|emb|CAV01345.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           55989]
 gi|218367895|emb|CAR05690.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           S88]
 gi|218372703|emb|CAR20579.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           IAI39]
 gi|222035765|emb|CAP78510.1| alanine racemase, biosynthetic [Escherichia coli LF82]
 gi|226840156|gb|EEH72158.1| alanine racemase 1 [Escherichia sp. 1_1_43]
 gi|226901525|gb|EEH87784.1| alanine racemase 1 [Escherichia sp. 3_2_53FAA]
 gi|238859949|gb|ACR61947.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           BW2952]
 gi|242379581|emb|CAQ34402.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           BL21(DE3)]
 gi|253326363|gb|ACT30965.1| alanine racemase [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975890|gb|ACT41561.1| alanine racemase [Escherichia coli B str. REL606]
 gi|253980046|gb|ACT45716.1| alanine racemase [Escherichia coli BL21(DE3)]
 gi|257767168|dbj|BAI38663.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           O111:H- str. 11128]
 gi|260451118|gb|ACX41540.1| alanine racemase [Escherichia coli DH1]
 gi|281603462|gb|ADA76446.1| Alanine racemase, biosynthetic [Shigella flexneri 2002017]
 gi|291320810|gb|EFE60252.1| alanine racemase [Escherichia coli B088]
 gi|299882348|gb|EFI90559.1| alanine racemase [Escherichia coli MS 196-1]
 gi|300315711|gb|EFJ65495.1| alanine racemase [Escherichia coli MS 175-1]
 gi|300401812|gb|EFJ85350.1| alanine racemase [Escherichia coli MS 84-1]
 gi|300415443|gb|EFJ98753.1| alanine racemase [Escherichia coli MS 115-1]
 gi|300419481|gb|EFK02792.1| alanine racemase [Escherichia coli MS 182-1]
 gi|300453724|gb|EFK17344.1| alanine racemase [Escherichia coli MS 116-1]
 gi|300456848|gb|EFK20341.1| alanine racemase [Escherichia coli MS 21-1]
 gi|300462298|gb|EFK25791.1| alanine racemase [Escherichia coli MS 187-1]
 gi|300523926|gb|EFK44995.1| alanine racemase [Escherichia coli MS 119-7]
 gi|300529381|gb|EFK50443.1| alanine racemase [Escherichia coli MS 107-1]
 gi|300841952|gb|EFK69712.1| alanine racemase [Escherichia coli MS 124-1]
 gi|301076663|gb|EFK91469.1| alanine racemase [Escherichia coli MS 146-1]
 gi|305850811|gb|EFM51267.1| alanine racemase [Escherichia coli NC101]
 gi|306907912|gb|EFN38413.1| alanine racemase [Escherichia coli W]
 gi|307629105|gb|ADN73409.1| alanine racemase [Escherichia coli UM146]
 gi|308120520|gb|EFO57782.1| alanine racemase [Escherichia coli MS 145-7]
 gi|309704520|emb|CBJ03869.1| alanine racemase [Escherichia coli ETEC H10407]
 gi|310331687|gb|EFP98943.1| alanine racemase [Escherichia coli 1827-70]
 gi|312289620|gb|EFR17511.1| alanine racemase [Escherichia coli 2362-75]
 gi|312948630|gb|ADR29457.1| alanine racemase [Escherichia coli O83:H1 str. NRG 857C]
 gi|313648749|gb|EFS13189.1| alanine racemase [Shigella flexneri 2a str. 2457T]
 gi|315063377|gb|ADT77704.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli W]
 gi|315138607|dbj|BAJ45766.1| alanine racemase [Escherichia coli DH1]
 gi|315254725|gb|EFU34693.1| alanine racemase [Escherichia coli MS 85-1]
 gi|315297524|gb|EFU56803.1| alanine racemase [Escherichia coli MS 16-3]
 gi|315617421|gb|EFU98027.1| alanine racemase [Escherichia coli 3431]
 gi|320193412|gb|EFW68049.1| Alanine racemase, biosynthetic [Escherichia coli WV_060327]
 gi|320200816|gb|EFW75402.1| Alanine racemase, biosynthetic [Escherichia coli EC4100B]
 gi|323171196|gb|EFZ56844.1| alanine racemase [Escherichia coli LT-68]
 gi|323175939|gb|EFZ61531.1| alanine racemase [Escherichia coli 1180]
 gi|323182156|gb|EFZ67566.1| alanine racemase [Escherichia coli 1357]
 gi|323380559|gb|ADX52827.1| alanine racemase [Escherichia coli KO11]
 gi|323935542|gb|EGB31873.1| alanine racemase [Escherichia coli E1520]
 gi|323940236|gb|EGB36429.1| alanine racemase [Escherichia coli E482]
 gi|323946186|gb|EGB42220.1| alanine racemase [Escherichia coli H120]
 gi|323950400|gb|EGB46281.1| alanine racemase [Escherichia coli H252]
 gi|323954482|gb|EGB50266.1| alanine racemase [Escherichia coli H263]
 gi|323960459|gb|EGB56092.1| alanine racemase [Escherichia coli H489]
 gi|323969813|gb|EGB65094.1| alanine racemase [Escherichia coli TA007]
 gi|324007777|gb|EGB76996.1| alanine racemase [Escherichia coli MS 57-2]
 gi|324017104|gb|EGB86323.1| alanine racemase [Escherichia coli MS 117-3]
 gi|324118625|gb|EGC12517.1| alanine racemase [Escherichia coli E1167]
 gi|331035769|gb|EGI08007.1| alanine racemase [Escherichia coli H736]
 gi|331061830|gb|EGI33755.1| alanine racemase [Escherichia coli TA271]
 gi|331071646|gb|EGI42982.1| alanine racemase [Escherichia coli H591]
 gi|331081204|gb|EGI52365.1| alanine racemase [Escherichia coli H299]
 gi|332346052|gb|AEE59386.1| alanine racemase [Escherichia coli UMNK88]
 gi|332751997|gb|EGJ82390.1| alanine racemase [Shigella flexneri 4343-70]
 gi|332752167|gb|EGJ82559.1| alanine racemase [Shigella flexneri K-671]
 gi|332753294|gb|EGJ83675.1| alanine racemase [Shigella flexneri 2747-71]
 gi|332764759|gb|EGJ94988.1| alanine racemase [Shigella flexneri 2930-71]
 gi|332998121|gb|EGK17725.1| alanine racemase [Shigella flexneri VA-6]
 gi|332999051|gb|EGK18640.1| alanine racemase [Shigella flexneri K-272]
 gi|332999100|gb|EGK18687.1| alanine racemase [Shigella flexneri K-218]
 gi|333014184|gb|EGK33540.1| alanine racemase [Shigella flexneri K-304]
 gi|333014415|gb|EGK33766.1| alanine racemase [Shigella flexneri K-227]
          Length = 359

 Score =  160 bits (404), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|293417557|ref|ZP_06660179.1| alanine racemase [Escherichia coli B185]
 gi|291430275|gb|EFF03273.1| alanine racemase [Escherichia coli B185]
          Length = 359

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPRCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|269103593|ref|ZP_06156290.1| alanine racemase biosynthetic [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268163491|gb|EEZ41987.1| alanine racemase biosynthetic [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 359

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 183/371 (49%), Gaps = 30/371 (8%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL +N   +   + N++  AVVK NAYG G   +A +L    V  +    +EE + 
Sbjct: 8   IDTEALTHNLRQLRTQAPNSKILAVVKANAYGHGLLHVAKSLPT--VDAYGAARIEEALT 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + P    ++   N+  V+ S+ QL     L    +  P    L+
Sbjct: 66  LRAGGIVKPILLLEGFYSPSDLPVLVTNNIHTVVHSIEQL---EALEQAKLDGPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           +DTG +RLG+  ++  +F    H   N  + +    ISH  CADD  S V + QLE F  
Sbjct: 123 IDTGMHRLGVRPEQIDEFITRLHACHN--VAKPLRYISHFGCADDLQSDVTNQQLETFLA 180

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG-----GTDKINKSHPMQTVVTAE 239
           L     G E SLA+S+G+L  P+ H +  RPGI +YG       +    ++ ++ V+T  
Sbjct: 181 LTEGCTG-ERSLAASAGVLAWPDSHLEWIRPGIVMYGISPFAEPEMSASAYNLKPVMTLT 239

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           + +I +R    GE V YGG     RD+ + V AIGY DGYP +        +P+   G  
Sbjct: 240 SSLIAVRDVKKGEQVGYGGNWTSERDTKVGVIAIGYGDGYPRS--------APN---GTP 288

Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
             + G +VP+ G+++MDM   D+      +VGD   ++G  +  + VA   GT  Y+L+ 
Sbjct: 289 ILVNGRIVPMAGRVSMDMLTVDLGPDAQDKVGDEAILWGNGLPAEVVAEHIGTIAYELVT 348

Query: 360 RIGTRYAKFYT 370
           ++ +R A  YT
Sbjct: 349 KLTSRVAMTYT 359


>gi|331665722|ref|ZP_08366616.1| alanine racemase [Escherichia coli TA143]
 gi|331056773|gb|EGI28767.1| alanine racemase [Escherichia coli TA143]
          Length = 359

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCDATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKLG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|163749309|ref|ZP_02156558.1| alanine racemase [Shewanella benthica KT99]
 gi|161331028|gb|EDQ01954.1| alanine racemase [Shewanella benthica KT99]
          Length = 358

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 115/377 (30%), Positives = 186/377 (49%), Gaps = 38/377 (10%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSV 65
           F R +I   ALK+N   +  ++ +++  AVVK N YG G   +A  + +A    F V  +
Sbjct: 4   FPRAEISCKALKHNLARLRQIAPSSKIMAVVKANGYGHGLLNVAQCIEDA--DGFGVARL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY- 124
           EE + LR     A++ +L G     + I    N I  +  V   T    L    +S P  
Sbjct: 62  EEAIALRDGGVTAKLILLEGCFRPVDLITLVMNDIETV--VHNETQLEMLEQASLSKPVN 119

Query: 125 -ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---------IISHLACADDPSSHV 174
             L++DTG +RLG        FT   F +   +L           ++SH ACAD+P +  
Sbjct: 120 VWLKLDTGMHRLG--------FTPEQFEQIYARLQACPQVVKPIKLMSHFACADEPDNPY 171

Query: 175 NSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGG---TDKINKSHP 231
              QL +F  L+ +  G + +LA+S+G L  P+ H    RPGI+LYG    T  + K+H 
Sbjct: 172 TQEQLNKFNKLVRNLPG-DTTLANSAGTLYWPDSHKDWVRPGIALYGVSPVTGDLGKNHG 230

Query: 232 MQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHS 291
           +Q  +   +++I +R+  AGE V YG   +   D+ + + AIGY DGYP         ++
Sbjct: 231 LQPAMELISQLIAVREHKAGEPVGYGCYWRAKADTKLGIVAIGYGDGYP--------RNA 282

Query: 292 PSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASG 351
           P    G   ++ G +VPI+G+++MDM   D+    S  +GD   ++G  + ++ VA   G
Sbjct: 283 PE---GTPVWVNGRLVPIVGRVSMDMLTVDLGSDSSDSIGDEAILWGSALPVEVVAEHIG 339

Query: 352 TTNYDLLVRIGTRYAKF 368
           T  Y+L+ ++  R A +
Sbjct: 340 TIAYELVTKLTPRVAVY 356


>gi|193885277|pdb|3B8U|A Chain A, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221a
 gi|193885278|pdb|3B8U|B Chain B, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221a
 gi|193885279|pdb|3B8U|C Chain C, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221a
 gi|193885280|pdb|3B8U|D Chain D, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221a
          Length = 379

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 28  INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 85

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 86  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 137

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              + +DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 138 TVWMXLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 197

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 198 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLADRSTGADFGCQPVMS 256

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 257 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 305

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 306 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 365

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 366 ITRLTSRVAMKY 377


>gi|315287851|gb|EFU47253.1| alanine racemase [Escherichia coli MS 110-3]
          Length = 359

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INHRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|161505290|ref|YP_001572402.1| alanine racemase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160866637|gb|ABX23260.1| hypothetical protein SARI_03431 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 359

 Score =  159 bits (403), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 119/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         FD   +P IS+      V      + L +  ++ P 
Sbjct: 66  LREGGITQPILLLEGF--------FDAADLPTISAQRLHTAVHNQEQLTALEAVELAEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  +EA  F    +  K + Q   I+SH A AD+P       QLE 
Sbjct: 118 TVWMKLDTGMHRLGVRPEEAEAFYQRLTHCKNVRQPVNIVSHFARADEPECGATEHQLEI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVT 237
           F        G + S+A+S GILL P  HF   RPGI LYG +   +K        Q V++
Sbjct: 178 FNAFCQDKAG-KRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I  R   AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAARDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+  +   + GD + ++G D+ ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPNAQDKAGDPVVLWGEDLPVERIAEITKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMEY 357


>gi|323965715|gb|EGB61167.1| alanine racemase [Escherichia coli M863]
 gi|327250397|gb|EGE62110.1| alanine racemase [Escherichia coli STEC_7v]
          Length = 359

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 182/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTRCKNVRQPVNIVSHFARADEPKCGATEKQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     R++ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERNTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|84393171|ref|ZP_00991935.1| alanine racemase [Vibrio splendidus 12B01]
 gi|84376223|gb|EAP93107.1| alanine racemase [Vibrio splendidus 12B01]
          Length = 358

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 119/371 (32%), Positives = 185/371 (49%), Gaps = 34/371 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N + + + +   +  +VVK N YG G   IA    N+    F V  +EE ++
Sbjct: 8   IDLNALEHNLNQIKSKAPQCKVMSVVKANGYGHGLLHIAKHSKNSDA--FGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +  G   I+   N+  V+    QL   S L +  +  P    L+
Sbjct: 66  LRAGGIVKPILLLEGFYSSGDLPILVTNNIQTVVHCEEQL---SALENADLETPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLER 181
           VD+G +RLG+  ++     + +F ++L Q + +      +SH  CAD+        Q E 
Sbjct: 123 VDSGMHRLGVRPEQ-----YQNFVERLHQCANVAKPLRYMSHFGCADELDRATTVEQTEL 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTA 238
           F +L    +G E SLA+S+G+L  PN H    RPGI  YG +   DK  +    + V+T 
Sbjct: 178 FLSLTDGCEG-ERSLAASAGLLAWPNSHLDWVRPGIISYGVSPFADKSAQELGFKPVMTL 236

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            + +I +R   AGE V YG      RD+ + V AIGY DGYP          +P+   G 
Sbjct: 237 TSHLIAVRDVKAGESVGYGANWTSERDTKVGVIAIGYGDGYP--------RMAPN---GT 285

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             F+ G  VPI G+++MDM   D+    + +VGD   ++G D+  ++VA   GT  Y+L+
Sbjct: 286 PVFVNGRKVPIAGRVSMDMLTVDLGPDAADKVGDEATLWGKDLPSEEVAEHIGTIAYELV 345

Query: 359 VRIGTRYAKFY 369
            ++ +R A  Y
Sbjct: 346 TKLTSRVAMEY 356


>gi|82546378|ref|YP_410325.1| alanine racemase [Shigella boydii Sb227]
 gi|187732519|ref|YP_001882723.1| alanine racemase [Shigella boydii CDC 3083-94]
 gi|20137402|sp|Q932V0|ALR1_SHIDY RecName: Full=Alanine racemase, biosynthetic
 gi|123558063|sp|Q31TW1|ALR_SHIBS RecName: Full=Alanine racemase
 gi|226711059|sp|B2TX62|ALR_SHIB3 RecName: Full=Alanine racemase
 gi|16610215|dbj|BAB71770.1| alanine racemase [Shigella dysenteriae]
 gi|16610219|dbj|BAB71772.1| alanine racemase [Shigella flexneri]
 gi|81247789|gb|ABB68497.1| alanine racemase 1 [Shigella boydii Sb227]
 gi|187429511|gb|ACD08785.1| alanine racemase [Shigella boydii CDC 3083-94]
 gi|320174482|gb|EFW49622.1| Alanine racemase, biosynthetic [Shigella dysenteriae CDC 74-1112]
 gi|320185265|gb|EFW60041.1| Alanine racemase, biosynthetic [Shigella flexneri CDC 796-83]
 gi|332087804|gb|EGI92930.1| alanine racemase [Shigella boydii 3594-74]
          Length = 359

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAGAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|323975315|gb|EGB70418.1| alanine racemase [Escherichia coli TW10509]
          Length = 359

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 182/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAETFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     R++ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERNTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|205354317|ref|YP_002228118.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205274098|emb|CAR39107.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|326629441|gb|EGE35784.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
          Length = 358

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 109/362 (30%), Positives = 174/362 (48%), Gaps = 25/362 (6%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L +DL A+ +N+ ++      A+  AV+K N YGLG E IAPALY A  + FFV  + EG
Sbjct: 14  LCVDLAAVVDNYQTLARHVAPAQCGAVLKANGYGLGAEAIAPALYAANCRIFFVAQLSEG 73

Query: 69  VKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYAL 126
           V LR + +  A + +L G+ P    +     + P+++SV Q+  +  L        P  +
Sbjct: 74  VALRKILSADAMVVLLNGVMPQAMPLCCAQQITPLLNSVDQVMAWLALQEARSQRRPVLI 133

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           Q+D+G +RL    ++          +       IISHLA AD P   +N  Q    +   
Sbjct: 134 QLDSGMSRLAAIFRQ----------RGWAAPDYIISHLANADRPDHALNVYQHTLLQQAK 183

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
             +     SLA+S G+ L P +   L RPG++L+ G  +   S P++   T    I+ ++
Sbjct: 184 EAFPTSRYSLANSCGMFLHPAWREDLCRPGVALF-GVAQPWFSTPLKPAFTLTLSILRVQ 242

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               G  + YG     TR   IA  + GYADG P  L        P+    G  + +G  
Sbjct: 243 DVPVGTPIGYGSTVTTTRPLRIATVSAGYADGIPRNL------RPPA----GVCW-RGVR 291

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
           +P+LG++ MD  M D   ++    GD ++  G    L++VA A  T  Y+++ R+G R+ 
Sbjct: 292 LPVLGRVCMDSFMVD-ARAIMPTPGDVVEFIGVSQTLEEVAAACDTIPYEIMTRLGGRFR 350

Query: 367 KF 368
           + 
Sbjct: 351 RI 352


>gi|294493177|gb|ADE91933.1| alanine racemase [Escherichia coli IHE3034]
          Length = 359

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L       P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASPDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|193885285|pdb|3B8W|A Chain A, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221p
 gi|193885286|pdb|3B8W|B Chain B, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221p
 gi|193885287|pdb|3B8W|C Chain C, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221p
 gi|193885288|pdb|3B8W|D Chain D, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221p
          Length = 379

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 28  INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 85

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 86  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 137

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              + +DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 138 TVWMXLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 197

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 198 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLPDRSTGADFGCQPVMS 256

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 257 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 305

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 306 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 365

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 366 ITRLTSRVAMKY 377


>gi|301156142|emb|CBW15613.1| alanine racemase 1, PLP-binding, biosynthetic [Haemophilus
           parainfluenzae T3T1]
          Length = 360

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 121/369 (32%), Positives = 188/369 (50%), Gaps = 26/369 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK+N   +   + +++  AVVK NAYG G   ++ AL  + V  F V  +EE +
Sbjct: 9   KISSLALKHNLQVIKEKAPHSKIIAVVKANAYGHGVVFVSSAL-ESMVDCFAVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    ++  II   N+  V+ +  QL     L    V  P    L
Sbjct: 68  SLRSNGIIKPILLLEGFFDEKDLPIIAVNNIETVVHNREQL---EALKRAVVPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG+SL E +D+ +    KKL Q+      +SH + AD+  S    VQL+RF 
Sbjct: 125 KIDTGMHRLGVSLDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELDSDYTQVQLDRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
               + +G E ++A+S GIL  P  H    RPGI +YG   TD +     +  V+   + 
Sbjct: 183 QATKNKEG-ERTIAASGGILFWPEAHLDCIRPGIIMYGISPTDTVGAEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           ++ +R+   GE V YGG     +D+ I V AIGY DGYP      D      V+L G+  
Sbjct: 242 LLAVREHKKGEPVGYGGIWTSPKDTKIGVVAIGYGDGYPR-----DVPEGTPVYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+ +    +VGD + ++G ++ ++ VA  SG  +Y+L+ ++
Sbjct: 295 ----IVPIVGRVSMDMLTVDLGEDSQDKVGDEVILWGKELPIETVAKYSGILSYELITKL 350

Query: 362 GTRYAKFYT 370
             R    Y 
Sbjct: 351 TPRVITEYV 359


>gi|269137597|ref|YP_003294297.1| alanine racemase [Edwardsiella tarda EIB202]
 gi|267983257|gb|ACY83086.1| alanine racemase [Edwardsiella tarda EIB202]
 gi|304557668|gb|ADM40332.1| alanine racemase [Edwardsiella tarda FL6-60]
          Length = 363

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 114/368 (30%), Positives = 184/368 (50%), Gaps = 26/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N+  +   + ++R  AVVK NAYG G  + A  L+ A    + V  + E + 
Sbjct: 8   IDRRALRHNFQQIRKFAPHSRLIAVVKANAYGHGLLETAKILHQADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +  ++   N+   + S  QL     L +  +  P    ++
Sbjct: 66  LRSGGIVKPILLLEGFFSASDLPVLVANNIETAVHSEEQL---QALENARLERPIKVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++A  F         + Q    +SH + AD+P       QL  F   +
Sbjct: 123 LDTGMHRLGVRPEQAEAFYRRLCTCPNVAQPVNFMSHFSRADEPECGRTEQQLACFDDFV 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS-----HPMQTVVTAEAR 241
               G E S+A+S GILL P  H  + RPGI +YG + + + S     + +Q  +T ++ 
Sbjct: 183 QGKAG-EQSIAASGGILLWPQSHRDMVRPGIIMYGVSPQADLSLAADHYGLQPAMTLQSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG     RD+ + V AIGY DGYP +        +PS   G    
Sbjct: 242 LIAVREHKAGEPVGYGGAWVAQRDTRLGVVAIGYGDGYPRS--------APS---GTPVL 290

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           I G  VPI+G+++MDM   D+    +  VGD + ++GP + ++ VA  +G + Y+L+ ++
Sbjct: 291 INGREVPIVGRVSMDMISVDLGPQAADRVGDNVIMWGPGLPVEKVAACTGISAYELITKL 350

Query: 362 GTRYAKFY 369
            +R A  Y
Sbjct: 351 TSRVAMEY 358


>gi|193885281|pdb|3B8V|A Chain A, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221k
 gi|193885282|pdb|3B8V|B Chain B, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221k
 gi|193885283|pdb|3B8V|C Chain C, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221k
 gi|193885284|pdb|3B8V|D Chain D, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant E221k
          Length = 379

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 28  INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 85

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 86  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 137

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              + +DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 138 TVWMXLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 197

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 198 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLKDRSTGADFGCQPVMS 256

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 257 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 305

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 306 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 365

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 366 ITRLTSRVAMKY 377


>gi|58257636|dbj|BAD88779.1| alanine racemase [synthetic construct]
          Length = 359

 Score =  159 bits (403), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEGQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+  +     GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|331655873|ref|ZP_08356861.1| alanine racemase [Escherichia coli M718]
 gi|331046227|gb|EGI18317.1| alanine racemase [Escherichia coli M718]
          Length = 359

 Score =  159 bits (403), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGSTEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|193885202|pdb|2RJG|A Chain A, Crystal Structure Of Biosynthetic Alaine Racemase From
           Escherichia Coli
 gi|193885203|pdb|2RJG|B Chain B, Crystal Structure Of Biosynthetic Alaine Racemase From
           Escherichia Coli
 gi|193885204|pdb|2RJG|C Chain C, Crystal Structure Of Biosynthetic Alaine Racemase From
           Escherichia Coli
 gi|193885205|pdb|2RJG|D Chain D, Crystal Structure Of Biosynthetic Alaine Racemase From
           Escherichia Coli
 gi|193885206|pdb|2RJH|A Chain A, Crystal Structure Of Biosynthetic Alaine Racemase In D-
           Cycloserine-Bound Form From Escherichia Coli
 gi|193885207|pdb|2RJH|B Chain B, Crystal Structure Of Biosynthetic Alaine Racemase In D-
           Cycloserine-Bound Form From Escherichia Coli
 gi|193885208|pdb|2RJH|C Chain C, Crystal Structure Of Biosynthetic Alaine Racemase In D-
           Cycloserine-Bound Form From Escherichia Coli
 gi|193885209|pdb|2RJH|D Chain D, Crystal Structure Of Biosynthetic Alaine Racemase In D-
           Cycloserine-Bound Form From Escherichia Coli
          Length = 379

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 28  INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 85

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 86  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 137

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              + +DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 138 TVWMXLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 197

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 198 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 256

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 257 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 305

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 306 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 365

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 366 ITRLTSRVAMKY 377


>gi|330445019|ref|ZP_08308673.1| alanine racemase [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328493137|dbj|GAA03170.1| alanine racemase [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 359

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 185/367 (50%), Gaps = 22/367 (5%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL +N   +   + N++  AVVK NAYG G  ++A +L N  V  + V  +EE + 
Sbjct: 8   IDTDALAHNLGLIRQQAPNSKILAVVKANAYGHGLLRVAQSLTN--VDAYGVARIEEALM 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR       I +L G + P    ++   N+  V+ S+ QL    +           +++D
Sbjct: 66  LRAGGVVKPILLLEGFYAPSDLPVLVTNNIHTVVHSIEQLEALEQ-AELDSQVKVWVKID 124

Query: 130 TGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           TG +RLG+  ++  DF    +  + + +    ISH   ADD SS +   QL+ F  L   
Sbjct: 125 TGMHRLGVRPEDLTDFMARLNACENVAKPLRFISHFGNADDLSSDITLQQLDTFLNLTQD 184

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT-----DKINKSHPMQTVVTAEARII 243
           Y+G E SLA+S+G+L  P+   +  RPGI +YG +     ++   ++ ++ V+T  + II
Sbjct: 185 YQG-ERSLAASAGVLAWPDSQLEWIRPGIIMYGVSPFNEPERYASAYDLKPVMTLTSSII 243

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R    GE V YGG     RD+ + V AIGY DGYP +        +P+   G    + 
Sbjct: 244 AVRDVKKGEKVGYGGIWTSERDTKMGVIAIGYGDGYPRS--------APN---GTPVLVN 292

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G +VP+ G+++MDM   D+      +VGD   ++G  +  + VA   GT  Y+L+ ++  
Sbjct: 293 GRIVPMAGRVSMDMLTVDLGPDAQDKVGDTAILWGEGLPAEIVAEHIGTIAYELITKLTP 352

Query: 364 RYAKFYT 370
           R A  YT
Sbjct: 353 RVAMAYT 359


>gi|194432311|ref|ZP_03064599.1| alanine racemase [Shigella dysenteriae 1012]
 gi|194419514|gb|EDX35595.1| alanine racemase [Shigella dysenteriae 1012]
 gi|320179049|gb|EFW54008.1| Alanine racemase, biosynthetic [Shigella boydii ATCC 9905]
 gi|332084266|gb|EGI89469.1| alanine racemase [Shigella dysenteriae 155-74]
          Length = 359

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEKAETFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+        GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDNAGDSVILWGEGLPVERIAEITKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|193063073|ref|ZP_03044165.1| alanine racemase [Escherichia coli E22]
 gi|194426899|ref|ZP_03059452.1| alanine racemase [Escherichia coli B171]
 gi|260846847|ref|YP_003224625.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           O103:H2 str. 12009]
 gi|192931332|gb|EDV83934.1| alanine racemase [Escherichia coli E22]
 gi|194415235|gb|EDX31504.1| alanine racemase [Escherichia coli B171]
 gi|195183272|dbj|BAG66813.1| alanine racemase 1 [Escherichia coli O111:H-]
 gi|257761994|dbj|BAI33491.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           O103:H2 str. 12009]
 gi|323162193|gb|EFZ48056.1| alanine racemase [Escherichia coli E128010]
          Length = 359

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGIIKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|156972397|ref|YP_001443304.1| alanine racemase [Vibrio harveyi ATCC BAA-1116]
 gi|156523991|gb|ABU69077.1| hypothetical protein VIBHAR_00017 [Vibrio harveyi ATCC BAA-1116]
          Length = 366

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 114/382 (29%), Positives = 192/382 (50%), Gaps = 29/382 (7%)

Query: 1   MHSNEFLRLK-----IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNA 55
           M SN    +K     IDL+AL++N   +   + +++  AVVK N YG G   +A    +A
Sbjct: 1   MMSNAMSYMKAAMACIDLSALQHNLQRVKQQAPDSKVMAVVKANGYGHGLRHVAKHATHA 60

Query: 56  GVQDFFVTSVEEGVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSK 114
               F V  +EE ++LR       I +L G + PG   ++   N+  V+    QL     
Sbjct: 61  DA--FGVARIEEALQLRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQLV---A 115

Query: 115 LMSCGVSHPYA--LQVDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPS 171
           L    +  P    L++D+G +RLG+  ++  +F T       + +    +SH  CAD+  
Sbjct: 116 LEQAELETPVVVWLKIDSGMHRLGVRPEQYDEFITRLKECPNVAKPLRYMSHFGCADELD 175

Query: 172 SHVNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINK 228
           + + + Q++ F +L +  +G E SLA+S+G+L  P       RPGI +YG +   DK  +
Sbjct: 176 NSITTEQIDLFMSLTAGCQG-ERSLAASAGLLAWPQSQLDWVRPGIIMYGVSPFNDKTAQ 234

Query: 229 SHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDS 288
               + V+T ++ +I +R+   GE V YGG     RD+ + V A+GY DGYP T      
Sbjct: 235 DMGYKPVMTLKSHLIAVREVKKGESVGYGGMWTSERDTKVGVIAVGYGDGYPRT------ 288

Query: 289 EHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVAL 348
             +P+   G    + G  VPI G+++MDM   D+    + +V D   ++G D+ +++VA 
Sbjct: 289 --APN---GTPVLVNGRKVPIAGRVSMDMLTVDLGPDATDKVSDEAILWGKDLPVEEVAS 343

Query: 349 ASGTTNYDLLVRIGTRYAKFYT 370
             GT  Y+L+ ++ +R    Y+
Sbjct: 344 HIGTIAYELVTKLTSRVEMEYS 365


>gi|123444026|ref|YP_001007996.1| alanine racemase [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122090987|emb|CAL13870.1| alanine racemase (biosynthetic) [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 359

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 115/364 (31%), Positives = 188/364 (51%), Gaps = 20/364 (5%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +  ++  +R  AVVK NAYG G  + A  L +A    + V  + E + 
Sbjct: 8   IDRRALRHNLQQVRRIAPQSRLIAVVKANAYGHGLLETAHTLQDADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR       I +L G    ++  I   N I   + S+ QL            H + +++D
Sbjct: 66  LRSGGIVKPILLLEGFFAAEDLPILAANCIETAVHSIEQLEALEVAELSAPIHVW-MKLD 124

Query: 130 TGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           TG +RLG+  ++A  F    S  K + Q   I+SH + AD+P       QL+ F T ++ 
Sbjct: 125 TGMHRLGVRPEQAEAFYQRLSACKNVIQPVNIMSHFSRADEPQVDTTRQQLDCFDTFVAD 184

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT--DKINKSH-PMQTVVTAEARIILI 245
             G + S+A+S GILL P  H    RPGI LYG +  D+   SH  ++  +  ++ +I +
Sbjct: 185 KPG-KQSIAASGGILLWPEAHRDWVRPGIILYGVSPMDEPYASHFELKPAMALKSSLIAV 243

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+  AGE V YGG     RD+ + V AIGY DGYP +        +PS   G   ++ G 
Sbjct: 244 REHKAGEPVGYGGTWVSERDTRLGVVAIGYGDGYPRS--------APS---GTPMWLNGR 292

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
            V I+G+++MDM   D+  + + +VGD + ++G ++ ++ +A  +G + Y+L+ ++ +R 
Sbjct: 293 EVGIVGRVSMDMISVDLGPNATDKVGDEVLLWGAELPVEKIAACTGISAYELITKLTSRV 352

Query: 366 AKFY 369
           A  Y
Sbjct: 353 AMEY 356


>gi|283836658|ref|ZP_06356399.1| alanine racemase [Citrobacter youngae ATCC 29220]
 gi|291067398|gb|EFE05507.1| alanine racemase [Citrobacter youngae ATCC 29220]
          Length = 359

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 115/372 (30%), Positives = 182/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V  L     L +  ++ P 
Sbjct: 66  LRAGGITQPVLLLEGF--------FDATDLPTISAQRLHTAVHNLEQLEALEAAKLAEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F    +  + + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYQRLTQCENVRQPVNIVSHFARADEPECGATEKQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F        G + S+A+S GILL P  HF   RPG+ LYG +   N S       Q V++
Sbjct: 178 FNRFCEGKPG-QRSIAASGGILLWPQSHFDWARPGLILYGVSPLENHSIGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG  +  RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWQSERDTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPEAQDKAGDSVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|193885273|pdb|3B8T|A Chain A, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant P219a
 gi|193885274|pdb|3B8T|B Chain B, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant P219a
 gi|193885275|pdb|3B8T|C Chain C, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant P219a
 gi|193885276|pdb|3B8T|D Chain D, Crystal Structure Of Escherichia Coli Alaine Racemase
           Mutant P219a
          Length = 379

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 28  INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 85

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 86  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 137

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              + +DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 138 TVWMXLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 197

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 198 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSALEDRSTGADFGCQPVMS 256

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 257 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 305

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 306 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 365

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 366 ITRLTSRVAMKY 377


>gi|331675585|ref|ZP_08376332.1| alanine racemase [Escherichia coli TA280]
 gi|331067193|gb|EGI38601.1| alanine racemase [Escherichia coli TA280]
          Length = 359

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 181/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  + + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCQNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|323496058|ref|ZP_08101118.1| alanine racemase [Vibrio sinaloensis DSM 21326]
 gi|323318802|gb|EGA71753.1| alanine racemase [Vibrio sinaloensis DSM 21326]
          Length = 359

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 185/372 (49%), Gaps = 36/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   + N++  AVVK N+YG G   IA  ++  G   F V  +EE ++
Sbjct: 8   INLDALEHNLEQIKRQAPNSKVMAVVKANSYGHGLRHIA--VHAHGADAFGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G + PG   ++   N+  V+    QL   + L    +  P    L+
Sbjct: 66  LRACGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQL---AALEQAELETPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLER 181
           VD+G +RLG+  ++     +N+F  +L     +      +SH  CAD+ +    + Q E 
Sbjct: 123 VDSGMHRLGVRPEQ-----YNAFVSRLKACRNVAKPLRYMSHFGCADELNKPTTNEQTEL 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQT----VVT 237
           F +L    +G E SLA+S+G+L  P       RPGI +YG     N    +Q     V+T
Sbjct: 178 FLSLTQGCEG-ERSLAASAGLLAWPESQLDWVRPGIIMYG-VSPFNDKTALQMGYLPVMT 235

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
            ++ +I +R   AGE V YGG     +D+ I V AIGY DGYP T        +P+   G
Sbjct: 236 LKSHLIAVRDVKAGESVGYGGTWTCEQDTKIGVIAIGYGDGYPRT--------APN---G 284

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
              ++ G   PI G+++MDM   D+    +  VGD   ++G D+ +++VA   GT  Y+L
Sbjct: 285 TPVWVNGRKAPIAGRVSMDMLTVDLGPGATDRVGDEAILWGNDLPVEEVAGHIGTIAYEL 344

Query: 358 LVRIGTRYAKFY 369
           + ++ +R    Y
Sbjct: 345 VTKLTSRVEMEY 356


>gi|309787539|ref|ZP_07682151.1| alanine racemase [Shigella dysenteriae 1617]
 gi|308925117|gb|EFP70612.1| alanine racemase [Shigella dysenteriae 1617]
          Length = 353

 Score =  159 bits (401), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 2   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 59

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 60  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 111

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 112 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 171

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 172 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 230

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+   GE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 231 LTSSLIAVREHKVGEPVGYGGTWISERDTRLGVVAMGYGDGYPRA--------APS---G 279

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 280 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 339

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 340 IARLTSRVAMKY 351


>gi|283787218|ref|YP_003367083.1| alanine racemase [Citrobacter rodentium ICC168]
 gi|282950672|emb|CBG90346.1| alanine racemase [Citrobacter rodentium ICC168]
          Length = 359

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 118/372 (31%), Positives = 183/372 (49%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRQLAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         F+ + +P IS+      V      + L S  +  P 
Sbjct: 66  LRAGGITQPVLLLEGF--------FEASDLPTISAQHLHTAVHNEEQLAALESASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F    +  K + Q   IISH A AD+P S     QL  
Sbjct: 118 TVWMKLDTGMHRLGVLPEQAEAFYQRLTKCKNVRQPVNIISHFARADEPESGATEKQLNI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL    HF   RPGI LYG +   N+S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWSQSHFNWARPGIILYGVSPLENRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG  +  RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWQSERDTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPEAQDKAGDPVILWGEGLPVERIAEITKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|218708338|ref|YP_002415959.1| alanine racemase [Vibrio splendidus LGP32]
 gi|254802395|sp|B7VI70|ALR_VIBSL RecName: Full=Alanine racemase
 gi|218321357|emb|CAV17307.1| Alanine racemase 1 [Vibrio splendidus LGP32]
          Length = 358

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 119/371 (32%), Positives = 186/371 (50%), Gaps = 34/371 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N + + + + + +  +VVK N YG G   IA   ++     F V  +EE ++
Sbjct: 8   IDLNALEHNLNQIKSKAPHCKVMSVVKANGYGHGLLHIAK--HSKSSDAFGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +  G   I+   N+  V+    QL   S L +  +  P    L+
Sbjct: 66  LRAGGIVKPILLLEGFYSSGDLPILVTNNIQTVVHCEEQL---SALENAELETPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLER 181
           VD+G +RLG   ++     + +F ++L Q + +      +SH  CAD+        Q E 
Sbjct: 123 VDSGMHRLGARPEQ-----YQNFVERLHQCANVAKPLRYMSHFGCADELDRATTVEQTEL 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTA 238
           F +L    +G E SLA+S+G+L  P+ H    RPGI  YG +   DK  +      V+T 
Sbjct: 178 FLSLTDGCEG-ERSLAASAGLLAWPDSHLDWVRPGIISYGVSPFADKSAQDLGFYPVMTL 236

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            + +I +R   AGE V YGG     RD+ + V AIGY DGYP T        +P+   G 
Sbjct: 237 TSHLIAVRDVKAGESVGYGGNWTSERDTKVGVIAIGYGDGYPRT--------APN---GT 285

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             F+ G  VPI G+++MDM   D+    + +VGD   ++G D+  ++VA   GT  Y+L+
Sbjct: 286 PVFVNGRKVPIAGRVSMDMLTVDLGPDAADKVGDEATLWGKDLPSEEVAEHIGTIAYELV 345

Query: 359 VRIGTRYAKFY 369
            ++ +R A  Y
Sbjct: 346 TKLTSRVAMEY 356


>gi|24375404|ref|NP_719447.1| alanine racemase [Shewanella oneidensis MR-1]
 gi|81845755|sp|Q8EAI6|ALR_SHEON RecName: Full=Alanine racemase
 gi|24350242|gb|AAN56891.1|AE015824_2 alanine racemase, biosynthetic [Shewanella oneidensis MR-1]
          Length = 358

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 108/368 (29%), Positives = 191/368 (51%), Gaps = 24/368 (6%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSV 65
           F R +I  +AL+NN   +   + +++  AVVK N YG G   +A  L NA    F +  +
Sbjct: 4   FPRAEISSSALQNNLAVLRQQASSSQVMAVVKANGYGHGLLNVAKCLNNA--DGFGLARL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE ++LR  + +AR+ +L G     +  ++ + ++  V+    Q+     L    +S P 
Sbjct: 62  EEALELRAGSVKARLLLLEGFFRSTDLPLLVEHDIDTVVHHESQIEM---LEQATLSKPV 118

Query: 125 A--LQVDTGFNRLGLSLQE-ALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+VD+G +RLG++ ++ +  +   +  K + +   +++H ACAD+P +H   VQ++ 
Sbjct: 119 TVWLKVDSGMHRLGVTPEQFSAVYARLTACKNVAKPIHLMTHFACADEPDNHYTQVQMQT 178

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGG---TDKINKSHPMQTVVTA 238
           F  L +   G   +LA+S+G L  P       RPGI++YG    T     +H +   +  
Sbjct: 179 FNQLTADLPGFR-TLANSAGALYWPKSQGDWIRPGIAMYGVSPVTGDCGANHGLIPAMNL 237

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            +R+I +R+  A + V YG      +D+ + V AIGY DGYP         ++P    G 
Sbjct: 238 VSRLIAVREHKANQPVGYGCYWTAKQDTRLGVVAIGYGDGYP--------RNAPE---GT 286

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             +I G  VPI+G+++MDM   D+    + +VGD + ++G  + +++VA   GT  Y+L+
Sbjct: 287 PVWINGRRVPIVGRVSMDMLTVDLGHDATDQVGDDVLLWGQALPVEEVAEHIGTIAYELV 346

Query: 359 VRIGTRYA 366
            ++  R A
Sbjct: 347 TKLTPRVA 354


>gi|15804645|ref|NP_290686.1| alanine racemase [Escherichia coli O157:H7 EDL933]
 gi|15834289|ref|NP_313062.1| alanine racemase [Escherichia coli O157:H7 str. Sakai]
 gi|168748102|ref|ZP_02773124.1| alanine racemase [Escherichia coli O157:H7 str. EC4113]
 gi|168755220|ref|ZP_02780227.1| alanine racemase [Escherichia coli O157:H7 str. EC4401]
 gi|168760899|ref|ZP_02785906.1| alanine racemase [Escherichia coli O157:H7 str. EC4501]
 gi|168766310|ref|ZP_02791317.1| alanine racemase [Escherichia coli O157:H7 str. EC4486]
 gi|168774408|ref|ZP_02799415.1| alanine racemase [Escherichia coli O157:H7 str. EC4196]
 gi|168780463|ref|ZP_02805470.1| alanine racemase [Escherichia coli O157:H7 str. EC4076]
 gi|168784666|ref|ZP_02809673.1| alanine racemase [Escherichia coli O157:H7 str. EC869]
 gi|168798287|ref|ZP_02823294.1| alanine racemase [Escherichia coli O157:H7 str. EC508]
 gi|195935836|ref|ZP_03081218.1| alanine racemase [Escherichia coli O157:H7 str. EC4024]
 gi|208806109|ref|ZP_03248446.1| alanine racemase [Escherichia coli O157:H7 str. EC4206]
 gi|208812590|ref|ZP_03253919.1| alanine racemase [Escherichia coli O157:H7 str. EC4045]
 gi|208819299|ref|ZP_03259619.1| alanine racemase [Escherichia coli O157:H7 str. EC4042]
 gi|209397944|ref|YP_002273593.1| alanine racemase [Escherichia coli O157:H7 str. EC4115]
 gi|217325461|ref|ZP_03441545.1| alanine racemase [Escherichia coli O157:H7 str. TW14588]
 gi|254796072|ref|YP_003080909.1| alanine racemase [Escherichia coli O157:H7 str. TW14359]
 gi|261225171|ref|ZP_05939452.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261255577|ref|ZP_05948110.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291285469|ref|YP_003502287.1| Alanine racemase, biosynthetic [Escherichia coli O55:H7 str.
           CB9615]
 gi|20137342|sp|Q8X5V2|ALR1_ECO57 RecName: Full=Alanine racemase, biosynthetic
 gi|12519004|gb|AAG59251.1|AE005638_5 alanine racemase 1 [Escherichia coli O157:H7 str. EDL933]
 gi|13364512|dbj|BAB38458.1| alanine racemase 1 [Escherichia coli O157:H7 str. Sakai]
 gi|187769867|gb|EDU33711.1| alanine racemase [Escherichia coli O157:H7 str. EC4196]
 gi|188017506|gb|EDU55628.1| alanine racemase [Escherichia coli O157:H7 str. EC4113]
 gi|189001846|gb|EDU70832.1| alanine racemase [Escherichia coli O157:H7 str. EC4076]
 gi|189357442|gb|EDU75861.1| alanine racemase [Escherichia coli O157:H7 str. EC4401]
 gi|189364060|gb|EDU82479.1| alanine racemase [Escherichia coli O157:H7 str. EC4486]
 gi|189368602|gb|EDU87018.1| alanine racemase [Escherichia coli O157:H7 str. EC4501]
 gi|189374890|gb|EDU93306.1| alanine racemase [Escherichia coli O157:H7 str. EC869]
 gi|189379189|gb|EDU97605.1| alanine racemase [Escherichia coli O157:H7 str. EC508]
 gi|208725910|gb|EDZ75511.1| alanine racemase [Escherichia coli O157:H7 str. EC4206]
 gi|208733867|gb|EDZ82554.1| alanine racemase [Escherichia coli O157:H7 str. EC4045]
 gi|208739422|gb|EDZ87104.1| alanine racemase [Escherichia coli O157:H7 str. EC4042]
 gi|209159344|gb|ACI36777.1| alanine racemase [Escherichia coli O157:H7 str. EC4115]
 gi|209751260|gb|ACI73937.1| alanine racemase 1 [Escherichia coli]
 gi|209751262|gb|ACI73938.1| alanine racemase 1 [Escherichia coli]
 gi|209751264|gb|ACI73939.1| alanine racemase 1 [Escherichia coli]
 gi|209751266|gb|ACI73940.1| alanine racemase 1 [Escherichia coli]
 gi|217321682|gb|EEC30106.1| alanine racemase [Escherichia coli O157:H7 str. TW14588]
 gi|254595472|gb|ACT74833.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia coli
           O157:H7 str. TW14359]
 gi|290765342|gb|ADD59303.1| Alanine racemase, biosynthetic [Escherichia coli O55:H7 str.
           CB9615]
 gi|320190822|gb|EFW65472.1| Alanine racemase, biosynthetic [Escherichia coli O157:H7 str.
           EC1212]
 gi|320638809|gb|EFX08455.1| alanine racemase [Escherichia coli O157:H7 str. G5101]
 gi|320654892|gb|EFX22853.1| alanine racemase [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320660740|gb|EFX28197.1| alanine racemase [Escherichia coli O55:H7 str. USDA 5905]
 gi|320665669|gb|EFX32706.1| alanine racemase [Escherichia coli O157:H7 str. LSU-61]
 gi|326341902|gb|EGD65685.1| Alanine racemase, biosynthetic [Escherichia coli O157:H7 str. 1125]
 gi|326346524|gb|EGD70258.1| Alanine racemase, biosynthetic [Escherichia coli O157:H7 str. 1044]
          Length = 359

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+   GE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKVGEPVGYGGTWISERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|237728136|ref|ZP_04558617.1| alanine racemase 1 [Citrobacter sp. 30_2]
 gi|226910147|gb|EEH96065.1| alanine racemase 1 [Citrobacter sp. 30_2]
          Length = 359

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 115/372 (30%), Positives = 183/372 (49%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         FD + +P IS+      V        L +  ++ P 
Sbjct: 66  LRAGGITQPILLLEGF--------FDASDLPTISAQRLHTAVHNQEQLEALEAAKLAEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F    +  + + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYQRLTQCENVRQPVNIVSHFARADEPECGATEKQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F +      G + S+A+S GILL P  HF   RPG+ LYG +   N S       Q V++
Sbjct: 178 FNSFCEGKPG-QRSIAASGGILLWPQSHFDWARPGLILYGVSPLENHSIGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG  +  RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWQSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPEAQDKAGDSVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|82779537|ref|YP_405886.1| alanine racemase [Shigella dysenteriae Sd197]
 gi|123560897|sp|Q327W0|ALR_SHIDS RecName: Full=Alanine racemase
 gi|81243685|gb|ABB64395.1| alanine racemase 1 [Shigella dysenteriae Sd197]
          Length = 359

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+   GE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKVGEPVGYGGTWISERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 IARLTSRVAMKY 357


>gi|157148050|ref|YP_001455368.1| alanine racemase [Citrobacter koseri ATCC BAA-895]
 gi|157085255|gb|ABV14933.1| hypothetical protein CKO_03857 [Citrobacter koseri ATCC BAA-895]
          Length = 359

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 118/372 (31%), Positives = 183/372 (49%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         F+   +PVIS+      V      + L + G+  P 
Sbjct: 66  LRAGGITQPILLLEGF--------FEATDLPVISAQHLHTAVHNEEQLAALEAAGLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F    +  K + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEKAEAFYQRLTQCKNVRQPVNIVSHFARADEPECGATEQQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   N+S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWARPGIILYGVSPLENQSTGEDFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LISSLIAVREHKAGEPVGYGGTWISERDTCLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  V I+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVTIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|332140005|ref|YP_004425743.1| alanine racemase [Alteromonas macleodii str. 'Deep ecotype']
 gi|254802359|sp|B4S1A6|ALR_ALTMD RecName: Full=Alanine racemase
 gi|327550027|gb|AEA96745.1| alanine racemase [Alteromonas macleodii str. 'Deep ecotype']
          Length = 358

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 106/361 (29%), Positives = 184/361 (50%), Gaps = 18/361 (4%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I   AL +N+ ++ A++ ++++ AVVK +AYG G   +A  L +   Q F V  +EE + 
Sbjct: 9   IHADALLHNFKALAAIAPSSQSMAVVKADAYGHGAVNVARILQHVSSQ-FAVAIIEEAIA 67

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR     A + VL G H  +E ++ F  N I V+    QL + +        H + L+VD
Sbjct: 68  LRDAGISAPVVVLEGAHQAKECQMAFQHNCILVMHCEEQLQWLNNCPENQRPHIW-LKVD 126

Query: 130 TGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHY 189
           +G +RLG ++ +  D T   +   L + ++I +H ACADD  +   + QL  F+  ++  
Sbjct: 127 SGMHRLGFAISDIEDMT-KKYRHLLSEQTVIATHFACADDVDNGFTASQLSAFKR-VADA 184

Query: 190 KGIEASLASSSGILLGPNYHFQLTRPGISLYGG--TDKINKSHPMQTVVTAEARIILIRK 247
            G+  S+A+S   +  P       R G+ +YGG  +   N    +   +T  + I+ +R 
Sbjct: 185 IGLPTSVANSPATVNWPASRNAWNRLGVGVYGGAVSTANNVGVEIYPAMTLRSSILAVRT 244

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
             AGE V YG +   ++ S IA   IGYADGYP          +P +  G + F+ G   
Sbjct: 245 IAAGEGVGYGQRWVASKPSKIATVGIGYADGYPRHCK----NKTPVMVRGKRAFLAG--- 297

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
               +++MDM   D+T   ++ VGD ++++G ++ + +VA  + T +Y+L+ R+  R  +
Sbjct: 298 ----RVSMDMITIDVTHIDNVSVGDEVELWGQNVPIQEVAACADTIDYELMTRVSQRVPR 353

Query: 368 F 368
            
Sbjct: 354 I 354


>gi|296100680|ref|YP_003610826.1| alanine racemase [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295055139|gb|ADF59877.1| alanine racemase [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 359

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 117/367 (31%), Positives = 181/367 (49%), Gaps = 25/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +   I D +L   + +  QL   S L +  +S P    ++
Sbjct: 66  LRAGGITQPILLLEGFFEAADLPTIADQHLHTAVHNEEQL---SALETAELSEPVTVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHNSFN-KKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  + A  F       K + Q   I+SH A AD+P       QL+ F T  
Sbjct: 123 LDTGMHRLGVRPEHAQAFYQRLCQCKNVRQPVNIVSHFARADEPDCGATEQQLDIFNTFC 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVTAEARI 242
               G+  S+A+S GILL P  HF   RPGI LYG +   N+        Q V++  +++
Sbjct: 183 EGKPGMR-SIAASGGILLWPQSHFDWARPGIILYGVSPLENRPWGPDFGFQPVMSLVSKL 241

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G    +
Sbjct: 242 IAVREHKAGEPVGYGGTWTSARDTRLGVVAMGYGDGYP--------RAAPS---GTPVLV 290

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  V I+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L+ R+ 
Sbjct: 291 NGREVKIVGRVAMDMICVDLGPDAQDKAGDDVVMWGDGLPVERIAEITKVSAYELITRLT 350

Query: 363 TRYAKFY 369
           +R A  Y
Sbjct: 351 SRVAMKY 357


>gi|237809465|ref|YP_002893905.1| alanine racemase [Tolumonas auensis DSM 9187]
 gi|237501726|gb|ACQ94319.1| alanine racemase [Tolumonas auensis DSM 9187]
          Length = 358

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 116/368 (31%), Positives = 189/368 (51%), Gaps = 25/368 (6%)

Query: 10  KIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           +ID  AL++N   + + +  N +  AVVK NAYG G  ++A  L +A    + V  +EE 
Sbjct: 7   QIDTQALQHNLAVVRSQIPANTKVVAVVKANAYGHGLIQVAKTLASADA--YAVARLEEA 64

Query: 69  VKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA-- 125
           + LR       I +L G     +  ++   N+   + SV QL    ++    + +P    
Sbjct: 65  LILRSSGIVKPIIMLEGFFSADDLPVLAANNIQTAVHSVEQLDALEQMQ---LPNPVTVW 121

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFN-KKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           L++DTG +RLG+  +EA +F     N + + Q    I+H + AD+  +   + Q+E F  
Sbjct: 122 LKLDTGMHRLGVRPEEAEEFCERLANCRNVVQPFNFITHFSRADELDNLATTKQIELFNQ 181

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS---HPMQTVVTAEAR 241
           L   Y G E SLASS+GI+   + H    RPGI LYG +  + K+   H +Q V+T +  
Sbjct: 182 LTQKYAG-ECSLASSAGIMEWHDAHADWIRPGIMLYGASPFLGKTGYDHGLQPVMTLKTS 240

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    GE V YG +    +D+ + V AIGY DGYP          +PS   G    
Sbjct: 241 LIAVRLVKQGEPVGYGAKWVAQQDTKVGVVAIGYGDGYP--------RMAPS---GVPVR 289

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G +VP++G+++MDM   D+    + +VGD + ++G  + ++ VA A GT  Y+L+ ++
Sbjct: 290 VNGRIVPLVGRVSMDMLTVDLGPDATDKVGDDVTLWGEGLPVETVAEAIGTIPYELITKL 349

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 350 TPRVIMEY 357


>gi|260582214|ref|ZP_05850008.1| alanine racemase [Haemophilus influenzae NT127]
 gi|260094846|gb|EEW78740.1| alanine racemase [Haemophilus influenzae NT127]
          Length = 360

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 121/368 (32%), Positives = 183/368 (49%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L    V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTL-EQNVDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I   N I  V+ +  QL     L    +  P    L
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQL---DALKRANLPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF 
Sbjct: 125 KIDTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQINRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
           ++    +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + 
Sbjct: 183 SVTKDKQG-ERTIAASGGILFWPKSHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    G+ V YGG     RD+ I V AIGY DGYP      D      V+L G+  
Sbjct: 242 LIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAIGYGDGYP-----RDVPEGTPVYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++
Sbjct: 295 ----LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|332083545|gb|EGI88765.1| alanine racemase [Shigella boydii 5216-82]
          Length = 359

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEKAETFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     R++ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERNTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+        GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDNAGDSVILWGEGLPVERIAEITKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|293394140|ref|ZP_06638440.1| alanine racemase [Serratia odorifera DSM 4582]
 gi|291423118|gb|EFE96347.1| alanine racemase [Serratia odorifera DSM 4582]
          Length = 359

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 111/365 (30%), Positives = 184/365 (50%), Gaps = 22/365 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +   +  +R  AVVK NAYG G  + A  L +A    + V  + E + 
Sbjct: 8   IDRRALRHNLQQVRRQAPQSRLIAVVKANAYGHGLLETAHTLQDADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR       I +L G    ++  ++   N+   + S+ QL    +        P  +++D
Sbjct: 66  LRSGGIVKPILLLEGFFAAEDLPVLVANNIETAVHSIEQLEALEQ-AELARPVPVWMKID 124

Query: 130 TGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           TG +RLG+  ++A  F       + + Q   I+SH + AD+P+S     Q+  F +  +H
Sbjct: 125 TGMHRLGVRPEQAEAFYQRLCACRNVAQPVNIMSHFSRADEPNSDATQQQIACF-SAFAH 183

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSH----PMQTVVTAEARIIL 244
            K  + S+A+S G LL P+ H +  RPGI LYG    I + H     +Q  +T ++ +I 
Sbjct: 184 GKPGQRSIAASGGTLLWPDAHNEWVRPGIILYG-VSPIEQRHGGQFDLQPAMTLKSCLIA 242

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R+  AGE V YGG     RD+ + V A+GY DGYP +        +P+   G   ++ G
Sbjct: 243 VREHKAGEAVGYGGTWVSPRDTRLGVVAMGYGDGYPRS--------APT---GTPIWLNG 291

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
             VPI+G+++MDM   D+    S  VGD + ++G  + ++ +A  +G   Y+L+ ++  R
Sbjct: 292 REVPIVGRVSMDMISVDLGPDASDRVGDEVVLWGAPLPVERIAEVTGIGAYELITKLTQR 351

Query: 365 YAKFY 369
            A  Y
Sbjct: 352 VAMEY 356


>gi|117620242|ref|YP_857049.1| alanine racemase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117561649|gb|ABK38597.1| alanine racemase [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 369

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 110/359 (30%), Positives = 180/359 (50%), Gaps = 20/359 (5%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID+ AL++N+  +   + +++  AV+K NAYG G   +A AL  A    + V  VEE + 
Sbjct: 8   IDIDALQHNFAVVRRHAPHSKIIAVLKANAYGHGLLPVAHALAQADA--YAVARVEEALV 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR       I VL G    +   ++    L   + +  QL    +  S        L++D
Sbjct: 66  LRANAITKPILVLGGFFSAEALPLLAKHELQTTLHTWEQLALLEQ-ASLPAPIKVWLKLD 124

Query: 130 TGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           TG NRLGL  +E   F    S  + + Q   +++H + +D+  +    +Q+E F  L +H
Sbjct: 125 TGMNRLGLRAEELPAFIERLSHCRNVVQPFHLMTHFSQSDEQDTQATRLQIEEFNRLSAH 184

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQTVVTAEARIILI 245
             G E ++A+S+GIL  P       RPG+ LYG +    ++   H ++ V+T ++++I  
Sbjct: 185 LPG-ERAMANSAGILAWPASRSDWIRPGLMLYGASPFAGQLAADHDLRPVMTLKSQLIAT 243

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R    GE V YGG     R++ + V A GY DGYP     +  E +P         I G 
Sbjct: 244 RACAQGEAVGYGGHWVADRNTTLGVVAAGYGDGYPR----MAPEGTPM-------LINGR 292

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
            VPI+G+++MDM   D+  +   +VGD + ++G  + ++ VA   GT  Y+LL R+ +R
Sbjct: 293 QVPIVGRVSMDMITVDLGPAARDKVGDEVTLWGEGLPVEQVAEKIGTIPYELLTRLTSR 351


>gi|119503311|ref|ZP_01625395.1| alanine racemase [marine gamma proteobacterium HTCC2080]
 gi|119460957|gb|EAW42048.1| alanine racemase [marine gamma proteobacterium HTCC2080]
          Length = 355

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 193/370 (52%), Gaps = 32/370 (8%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL NN  +   L GN++  A VK NAYG G  + + AL N  V  F V   EE 
Sbjct: 7   LSIDLNALSNNAATTRRLVGNSKILASVKANAYGHGLTRCSEAL-NQKVDGFAVAFCEEA 65

Query: 69  VKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQ 127
           V LR       + +L G    ++   I + +L+ V+ S  Q+    K  +C ++ P  ++
Sbjct: 66  VLLRQQGITLPLLLLEGPFDREDVDAIKEYDLMMVVHSHHQIELLQK-SACPLTSPVWIK 124

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQL----SLIISHLACADDPSSHVNSVQLERFR 183
           +DTG +RLG S  EA      S  ++L ++    +++++H    ++P+S +   Q   ++
Sbjct: 125 IDTGMHRLGFSPAEA-----PSVAQRLHEMGASSTILMTHYGEGEEPASALTQEQQRAWQ 179

Query: 184 TLISHYKGIEASLASSSGIL--LGPNYHFQLTRPGISLYGG--TDKINKSHPMQTVVTAE 239
           T  +H      S A+S+ I+  L PN  +   RPGI LYG   +D I  S  ++ V++  
Sbjct: 180 T-STHSITSATSAANSAAIINTLAPNTDWM--RPGIMLYGAAHSDPIGAS--LEAVMSFR 234

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           + ++ +R  LAG+ V YGG+ +  RDS IA   +GY DGYP       +E    V+L   
Sbjct: 235 SEVMAMRHILAGDTVGYGGRWRAQRDSTIATIPVGYGDGYP-----RGAEDGTPVWL--- 286

Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
              +   VP++G+++MDM   D+TD     +G  ++++G  + +++VA  SGT  Y+LL 
Sbjct: 287 ---QHQCVPLVGRVSMDMITVDVTDFAGCHIGTSVELWGKHLSVNEVAKHSGTIGYELLT 343

Query: 360 RIGTRYAKFY 369
           R+  R    Y
Sbjct: 344 RLTGRVPVNY 353


>gi|317050883|ref|YP_004111999.1| alanine racemase [Desulfurispirillum indicum S5]
 gi|316945967|gb|ADU65443.1| alanine racemase [Desulfurispirillum indicum S5]
          Length = 358

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 183/367 (49%), Gaps = 23/367 (6%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +I L  +++N+  +   +G+ R   VVK +AYG G   +A  L + G   F V  V EG+
Sbjct: 7   EIHLPHIRHNFRLLQQRAGHTRIVGVVKADAYGHGDVPVALCLQSEGCTHFAVARVHEGI 66

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           KLR       I ++ G  P +   + + NL  V+     +    +++  G+S P  ++++
Sbjct: 67  KLRKAGIHGDILIMSGSFPNEFAALREFNLTTVVYCEENI---EEMVREGISVPVHIKIN 123

Query: 130 TGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERF-RTLISH 188
           TG NRLG    + L + + +  +    +  I++H+ACAD+P S     Q   F R+L  +
Sbjct: 124 TGMNRLGFR-PDRLPWVYRTLTEAGFAVRGIMTHMACADEPGSPTIGAQENLFYRSLEPY 182

Query: 189 YK-GIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRK 247
           ++ G+   L++S+GI    N    L RPGI LYGG    +K+  ++  +T + +I+ +++
Sbjct: 183 FQEGMLGHLSNSAGIFTLDNLG-SLARPGIMLYGGNPFADKTVDLRPAMTFKTKILQVKR 241

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
              GE +SYG      R+ L+A  A GYADGY   LS              +  + G   
Sbjct: 242 VFPGEGISYGHSFVADREMLVATVAAGYADGYSRLLSN-----------KARVLVNGQYA 290

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALASGTTNYDLLVRIGT 363
           P +G++ MDM+M D+T  +    GD + +FG      I   ++A   GT +Y++   I  
Sbjct: 291 PQVGRVCMDMSMVDVT-HIQPARGDEVVLFGEQRGQCIYASELAELMGTIDYEVFCGISP 349

Query: 364 RYAKFYT 370
           R  + YT
Sbjct: 350 RVKRIYT 356


>gi|322834774|ref|YP_004214801.1| alanine racemase [Rahnella sp. Y9602]
 gi|321169975|gb|ADW75674.1| alanine racemase [Rahnella sp. Y9602]
          Length = 359

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 116/367 (31%), Positives = 184/367 (50%), Gaps = 26/367 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFF-VTSVEEGV 69
           ID  AL++N   +  L+  +R  AVVK NAYG G  +   +L +A   D++ V+ + E +
Sbjct: 8   IDRRALRHNLQRVRHLAPQSRLVAVVKANAYGHGLLETVHSLQDA---DYYGVSRLSEAL 64

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YAL 126
            LR       I +L G     E  ++ +  L   + S+ QL     L S  ++ P    L
Sbjct: 65  MLRKAGVVKPILLLEGFFSASELPLLIEHQLDTAVHSLEQL---DALESADLARPLNVWL 121

Query: 127 QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           ++DTG +RLG+   +A  F    S  K + Q   ++SH   AD+P S     QL  F   
Sbjct: 122 KIDTGMHRLGVHPAQADAFYQRLSACKNVVQPVNMMSHFCRADEPESDATPKQLNCFNEF 181

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARI 242
                G + S+A+S GILL P  H  L RPGI LYG +     +     +Q V+T  + +
Sbjct: 182 AEGKPG-QKSIAASGGILLWPESHMNLVRPGIILYGVSPMETGTASDFGLQPVMTLTSSL 240

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R+  AGE V YG      RD+ + V A+GY DGYP +        +P+   G    +
Sbjct: 241 IAVREHAAGEPVGYGSTWVSNRDTRLGVVAMGYGDGYPRS--------APN---GTPVLV 289

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  VP+ G+++MDM   D+    + +VGD +  +G  + ++ +A A+G + Y+L+ ++ 
Sbjct: 290 NGREVPVAGRVSMDMITVDLGPDATDKVGDEVIFWGGKLPVERIAQATGISAYELITQLS 349

Query: 363 TRYAKFY 369
            R A+ Y
Sbjct: 350 ERVARVY 356


>gi|58257632|dbj|BAD88777.1| alanine racemase [synthetic construct]
          Length = 359

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 178/372 (47%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEGQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   +K        Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEHKPWGPDFGFQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R   AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G    ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGFPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|209693985|ref|YP_002261913.1| alanine racemase [Aliivibrio salmonicida LFI1238]
 gi|259710062|sp|B6ELK6|ALR_ALISL RecName: Full=Alanine racemase
 gi|208007936|emb|CAQ78068.1| alanine racemase [Aliivibrio salmonicida LFI1238]
          Length = 358

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 182/369 (49%), Gaps = 28/369 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +ID++AL +N   +   + N++  AVVK N YG G   IA   +  GV  F V  +EE +
Sbjct: 7   QIDMSALAHNLQKIKQQAPNSKLLAVVKANGYGHGLLNIAKGAH--GVDAFGVARIEEAL 64

Query: 70  KLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
           +LR      ++ +L G +  G   I+   N+   +    QL     L +  +  P    L
Sbjct: 65  QLRAGGIVKQVLLLEGFYSAGDLPILVANNIQTAVHCKEQL---EALENADLEGPVVVWL 121

Query: 127 QVDTGFNRLGL---SLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR 183
           +VD+G +RLG+     QE +D  H    K + Q    +SH  CAD+  +   + Q+E F 
Sbjct: 122 KVDSGMHRLGIRPEEYQEYVDRLHAC--KNVAQPLRYMSHFGCADELDNPTTNEQIETFM 179

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEA 240
           +L    +G E SLA+S+G+L  P+      RPGI +YG +   +K  +       +T  +
Sbjct: 180 SLTDGCQG-ERSLAASAGLLAWPDSQLDWVRPGIIMYGVSPFSEKTAQDLGYLPTMTLTS 238

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
            +I +R+  AGE V YG      RD+ I V AIGY DGYP+         +P+   G   
Sbjct: 239 HLIAVREVKAGESVGYGAMWTSERDTKIGVIAIGYGDGYPIA--------APN---GTPV 287

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
            + G  VP+ G+++MDM   D+       VGD   ++G D+  ++VA   GT  Y+L+ +
Sbjct: 288 LVNGRKVPVAGRVSMDMLTVDLGPDAEDNVGDEAILWGRDLPAEEVAEHIGTIAYELVTK 347

Query: 361 IGTRYAKFY 369
           + +R    Y
Sbjct: 348 LTSRVQMQY 356


>gi|261254033|ref|ZP_05946606.1| alanine racemase biosynthetic [Vibrio orientalis CIP 102891]
 gi|260937424|gb|EEX93413.1| alanine racemase biosynthetic [Vibrio orientalis CIP 102891]
          Length = 358

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 183/367 (49%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   + N++  AVVK N+YG G   IA   +  G   F V  +EE ++
Sbjct: 8   INLEALQHNLELIKQQAPNSKVMAVVKANSYGHGLRHIAK--HAQGADAFGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +  G   ++   N+  V+    QL     L    +  P    L+
Sbjct: 66  LRACGVVKPILLLEGFYSQGDLPVLVTNNIQTVVHCEEQL---QALEQAELETPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++  +F T     + + +    +SH  CAD+      + Q E F +L 
Sbjct: 123 IDSGMHRLGVRPEQYSEFVTRLKACRNVAKPLRYMSHFGCADELDKSTTNQQTELFLSLT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
              +G E SLA+S+G+L  P+   +  RPGI +YG +   D+  +    Q V+T ++ +I
Sbjct: 183 EGCEG-ERSLAASAGLLAWPDSQLEWVRPGIIMYGVSPFNDRSAQELGYQPVMTLKSHLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R   AGE V YGG     RD+ + V AIGY DGYP T        +P+   G    + 
Sbjct: 242 AVRDVKAGESVGYGGMWTSQRDTKVGVIAIGYGDGYPRT--------APN---GTPVLVN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G   PI G+++MDM   D+    S +VGD   ++G  +  ++VA   GT  Y+L+ ++ +
Sbjct: 291 GRKAPIAGRVSMDMLTVDLGPDASDKVGDEAILWGNQLPAEEVASHIGTIAYELVTKLTS 350

Query: 364 RYAKFYT 370
           R    Y+
Sbjct: 351 RVDMEYS 357


>gi|95930765|ref|ZP_01313498.1| alanine racemase [Desulfuromonas acetoxidans DSM 684]
 gi|95133245|gb|EAT14911.1| alanine racemase [Desulfuromonas acetoxidans DSM 684]
          Length = 371

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 114/376 (30%), Positives = 178/376 (47%), Gaps = 30/376 (7%)

Query: 9   LKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           + IDL AL++N+H +   +  + R  AVVK +AYG G   +A  L  AG   F V  VEE
Sbjct: 9   VAIDLDALRHNYHVLRETMRPDWRMLAVVKADAYGHGAVPVARTLEEAGADLFGVAIVEE 68

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLT-FYSKLMSCGVSHPYAL 126
           G++LR       I +L G  PGQE ++ + +L   +  + QL          G S    L
Sbjct: 69  GLELRAAGITRPILMLGGPWPGQEPVVIEHDLHVAVFEIEQLQRLEHAARQAGKSCFCHL 128

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT-- 184
           ++D+G  RLG+  ++  +        +  QL  I++H A AD P   + + Q   F+   
Sbjct: 129 KIDSGMGRLGVRDEQLDEVLRFFLASEALQLVGIMTHFALADCPDHPLTAQQQAHFKRAL 188

Query: 185 -------LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVT 237
                  LI  Y     S A+ S +  G N    L RPGI+LYGG    +++ P++ V+ 
Sbjct: 189 AKVRDAGLIPEYIHSSNSAATFSDVNGGCN----LVRPGIALYGGQPFEDRTLPLEPVMA 244

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
               I  +++   G  VSYG +    R +LIA   +GYADGY   LS             
Sbjct: 245 LRTEIAHLKQLPTGSGVSYGHRFIAQRPTLIAAIPVGYADGYNRLLSNC----------- 293

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALASGTT 353
           G   ++G  V + G + MD T+ D+TD  +++ GD + + G D    +  +  A   GT 
Sbjct: 294 GTALVRGQKVAVAGTVCMDWTLLDVTDVANVQCGDRVTLLGCDGDECVLAEQWAEKVGTI 353

Query: 354 NYDLLVRIGTRYAKFY 369
           +Y++  +I  R  + Y
Sbjct: 354 SYEVFCQISKRVPRHY 369


>gi|281181122|dbj|BAI57452.1| alanine racemase [Escherichia coli SE15]
          Length = 359

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEANLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + G  + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGAPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|158425840|ref|YP_001527132.1| alanine racemase [Azorhizobium caulinodans ORS 571]
 gi|158332729|dbj|BAF90214.1| alanine racemase [Azorhizobium caulinodans ORS 571]
          Length = 374

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 100/364 (27%), Positives = 163/364 (44%), Gaps = 15/364 (4%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L+IDL A++ NW ++ A        AVVK NAYG G  +I P L + G +DF+V  +EE 
Sbjct: 11  LEIDLGAVRQNWRTVRAQYRGPTLGAVVKQNAYGFGLSRIVPLLSSLGCRDFWVVCIEEA 70

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQV 128
           + +R   P AR+FVL+G+            +IPV+    +L       +       A+Q 
Sbjct: 71  LAVRTLAPDARVFVLHGLAGAAPADFRAHRIIPVLMDASELPRVQAEAAARGPLDVAIQF 130

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           DTG +RLGLS  +      +       +++  ++HLA   +P +  N  Q  RFR     
Sbjct: 131 DTGLSRLGLSRTDVKRLRDDPSPLAGLRIAAYVTHLAHFSNPVARHNDWQWRRFRAWTQA 190

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKA 248
                 S  +S+G+   P  H    R G +LYG     +   P+       A I+ +   
Sbjct: 191 LPPAPLSFCASAGVFGPPERHAHHARVGSALYGVETTPSSRQPILPAARLTAPILRVMDV 250

Query: 249 LAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVP 308
            AG  V YGG  +  + + +A   +GY  G P +                 G++ G   P
Sbjct: 251 PAGTEVGYGGVYRTPQPARLAHVGVGYGGGLPFSFQ-----------RQAYGYVGGLPAP 299

Query: 309 ILGKITMDMTMFDIT---DSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
           I+  + M +   D++   + L++  G  +++FGP   +D +A A+G     ++V  G R 
Sbjct: 300 IVSGLAMSLMTLDVSGLPEGLAVP-GAQVELFGPAQPVDILAAAAGVAPNVVMVSAGART 358

Query: 366 AKFY 369
            + Y
Sbjct: 359 RRVY 362


>gi|256019701|ref|ZP_05433566.1| alanine racemase [Shigella sp. D9]
 gi|332280832|ref|ZP_08393245.1| alanine racemase 1 [Shigella sp. D9]
 gi|332103184|gb|EGJ06530.1| alanine racemase 1 [Shigella sp. D9]
          Length = 359

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 116/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG      D+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSECDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|239996484|ref|ZP_04717008.1| alanine racemase [Alteromonas macleodii ATCC 27126]
          Length = 358

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 106/361 (29%), Positives = 186/361 (51%), Gaps = 18/361 (4%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I   AL +N+ ++ AL+ ++++ AVVK +AYG G   +A  L +   + F V  +EE + 
Sbjct: 9   IHADALLHNFKALAALAPSSQSMAVVKADAYGHGAVNVARILQHVSSR-FAVAIIEEAIA 67

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR     A I VL G H  +E ++ F  N I V+    QLT+          H + L+VD
Sbjct: 68  LRDAGISAPIVVLEGAHQAKECQMAFQHNCILVMHCEEQLTWLESCPEQQRPHIW-LKVD 126

Query: 130 TGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHY 189
           +G +RLG +L +    T   +N  L + ++I +H ACADD  ++  + Q++ F  + S  
Sbjct: 127 SGMHRLGFALSDIEGIT-AKYNHLLSEQTVIATHFACADDVDNNFTNTQIDAFNQVASKL 185

Query: 190 KGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQT--VVTAEARIILIRK 247
             +  S+A+S   +  P       R G+ +YGG    +++  ++    +T  + ++ +R 
Sbjct: 186 D-LPTSVANSPATVNWPASRNAWNRLGVGVYGGAVSTSQNLDIEIYPAMTLRSSVLAVRT 244

Query: 248 ALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMV 307
             AGE + YG     ++ S IA   IGYADGYP         H  +   G    I+G   
Sbjct: 245 IPAGEGIGYGQTWVASKPSKIATVGIGYADGYP--------RHCKN---GTPVLIRGKRA 293

Query: 308 PILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAK 367
            ++G+++MDM   D+T   ++ VGD ++++G ++ + +VA  + T +Y+L+ R+  R  +
Sbjct: 294 YLVGRVSMDMITIDVTHIDNVAVGDEVELWGQNVPIQEVAANADTIDYELMTRVSQRVPR 353

Query: 368 F 368
            
Sbjct: 354 I 354


>gi|145627697|ref|ZP_01783498.1| alanine racemase [Haemophilus influenzae 22.1-21]
 gi|144979472|gb|EDJ89131.1| alanine racemase [Haemophilus influenzae 22.1-21]
          Length = 360

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 188/368 (51%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L  + V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTLEQS-VDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I   N I  V+ +  QL     L    +  P    L
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQL---DALKRANLPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF 
Sbjct: 125 KIDTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQINRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
           ++    +G E ++A+S GIL  P+ H +  RPGI +YG   TD I K   +  V+   + 
Sbjct: 183 SVTKDKQG-ERTIAASGGILFWPDSHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    G+ V YGG     RD+ I V A+GY DGYP  +     E +P ++L G+  
Sbjct: 242 LIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPSNVP----EGTP-IYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++
Sbjct: 295 ----LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|16762928|ref|NP_458545.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|16767497|ref|NP_463112.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|29144415|ref|NP_807757.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|56416047|ref|YP_153122.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|161617376|ref|YP_001591341.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|167552528|ref|ZP_02346281.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|167991437|ref|ZP_02572536.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168236939|ref|ZP_02661997.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168243645|ref|ZP_02668577.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168821308|ref|ZP_02833308.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|194448214|ref|YP_002048237.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194735891|ref|YP_002117180.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197262039|ref|ZP_03162113.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197364974|ref|YP_002144611.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|198244007|ref|YP_002218141.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|204927044|ref|ZP_03218246.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205355019|ref|YP_002228820.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207859401|ref|YP_002246052.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|213051931|ref|ZP_03344809.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
 gi|213424514|ref|ZP_03357311.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213647520|ref|ZP_03377573.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|238913004|ref|ZP_04656841.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
 gi|289824655|ref|ZP_06544182.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-3139]
 gi|60391222|sp|P0A1A3|ALR1_SALTY RecName: Full=Alanine racemase, biosynthetic
 gi|60391223|sp|P0A1A4|ALR1_SALTI RecName: Full=Alanine racemase, biosynthetic
 gi|25291655|pir||AF1016 alanine racemase (EC 5.1.1.1) [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|153865|gb|AAA27022.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium]
 gi|16422805|gb|AAL23071.1| biosynthetic alanine racemase 1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16505235|emb|CAD09231.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29140053|gb|AAO71617.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|56130304|gb|AAV79810.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|161366740|gb|ABX70508.1| hypothetical protein SPAB_05231 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194406518|gb|ACF66737.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194711393|gb|ACF90614.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197096451|emb|CAR62057.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|197240294|gb|EDY22914.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197290054|gb|EDY29413.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197938523|gb|ACH75856.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|204323709|gb|EDZ08904.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|205274800|emb|CAR39859.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205322805|gb|EDZ10644.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205330206|gb|EDZ16970.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205337286|gb|EDZ24050.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205342080|gb|EDZ28844.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|206711204|emb|CAR35580.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|261249345|emb|CBG27208.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267996559|gb|ACY91444.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301160739|emb|CBW20270.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312915352|dbj|BAJ39326.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|320088655|emb|CBY98413.1| alanine racemase 1 [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321223115|gb|EFX48185.1| Alanine racemase, biosynthetic [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322615403|gb|EFY12323.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322618463|gb|EFY15352.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322622125|gb|EFY18975.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322627196|gb|EFY23988.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322631156|gb|EFY27920.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322637626|gb|EFY34327.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322642511|gb|EFY39111.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322643608|gb|EFY40163.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322648343|gb|EFY44802.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322654652|gb|EFY50972.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322659612|gb|EFY55855.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662179|gb|EFY58395.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322666075|gb|EFY62253.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322672495|gb|EFY68606.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675924|gb|EFY71995.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322680409|gb|EFY76447.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322684697|gb|EFY80701.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323132586|gb|ADX20016.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323195961|gb|EFZ81127.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323197109|gb|EFZ82250.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323201773|gb|EFZ86837.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323206287|gb|EFZ91249.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323213298|gb|EFZ98100.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323215668|gb|EGA00412.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323222091|gb|EGA06477.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323226502|gb|EGA10708.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323229127|gb|EGA13256.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323236263|gb|EGA20339.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323237617|gb|EGA21678.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323241717|gb|EGA25746.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323248136|gb|EGA32073.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323254534|gb|EGA38345.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323258406|gb|EGA42083.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323259686|gb|EGA43320.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323265959|gb|EGA49455.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323270401|gb|EGA53849.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
 gi|326625939|gb|EGE32284.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326630171|gb|EGE36514.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 9]
 gi|332991063|gb|AEF10046.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 359

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         FD   +P IS+      V      + L +  ++ P 
Sbjct: 66  LRAGGITQPILLLEGF--------FDAADLPTISAQCLHTAVHNQEQLAALEAVELAEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  +EA  F    +  K + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEEAEAFYQRLTHCKNVRQPVNIVSHFARADEPECGATEHQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVT 237
           F        G + S+A+S GILL P  HF   RPGI LYG +   +K        Q V++
Sbjct: 178 FNAFCQGKPG-QRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R   AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+  +     GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|209751258|gb|ACI73936.1| alanine racemase 1 [Escherichia coli]
 gi|320644177|gb|EFX13242.1| alanine racemase [Escherichia coli O157:H- str. 493-89]
 gi|320649496|gb|EFX18020.1| alanine racemase [Escherichia coli O157:H- str. H 2687]
          Length = 359

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 115/372 (30%), Positives = 179/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINK----SHPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++        Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRPTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+   GE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVREHKVGEPVGYGGTWISERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|16273470|ref|NP_439721.1| alanine racemase [Haemophilus influenzae Rd KW20]
 gi|260580354|ref|ZP_05848183.1| alanine racemase [Haemophilus influenzae RdAW]
 gi|1168421|sp|P45257|ALR_HAEIN RecName: Full=Alanine racemase
 gi|1574412|gb|AAC23218.1| alanine racemase, biosynthetic (alr) [Haemophilus influenzae Rd
           KW20]
 gi|260093031|gb|EEW76965.1| alanine racemase [Haemophilus influenzae RdAW]
          Length = 360

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 183/368 (49%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L    V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTL-EQNVDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I   N I  V+ +  QL     L    +  P    L
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQL---DALKRANLPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF 
Sbjct: 125 KIDTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQINRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
           ++    +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + 
Sbjct: 183 SVTKDKQG-ERTIAASGGILFWPKSHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    G+ V YGG     RD+ I V A+GY DGYP      D      V+L G+  
Sbjct: 242 LIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPR-----DVPEGTPVYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++
Sbjct: 295 ----LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|62182696|ref|YP_219113.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224586012|ref|YP_002639811.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|62130329|gb|AAX68032.1| alanine racemase 1, biosynthetic [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224470540|gb|ACN48370.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|322717195|gb|EFZ08766.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 359

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         FD   +P IS+      V      + L +  ++ P 
Sbjct: 66  LRAGGITQPILLLEGF--------FDAADLPTISAQCLHTAVHNQEQLAALEAVELAEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  +EA  F    +  K + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEEAEAFYQRLTHCKNVRQPVNIVSHFARADEPECGATEHQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVT 237
           F        G + S+A+S GILL P  HF   RPGI LYG +   +K        Q V++
Sbjct: 178 FSAFCQGKPG-QRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R   AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+  +     GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|37681162|ref|NP_935771.1| alanine racemase [Vibrio vulnificus YJ016]
 gi|81859828|sp|Q7MH94|ALR_VIBVY RecName: Full=Alanine racemase
 gi|37199913|dbj|BAC95742.1| alanine racemase [Vibrio vulnificus YJ016]
          Length = 372

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 114/372 (30%), Positives = 185/372 (49%), Gaps = 34/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N   +   + +++  AVVK N YG G   +A   +  G   F V  +EE ++
Sbjct: 22  IDLVALQHNLQLIKQQAPHSKLMAVVKANGYGHGLRHVAK--HAVGADAFGVARIEEALQ 79

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +  G   ++   N+  V+    QL     L +  +  P    L+
Sbjct: 80  LRACGVVKPILLLEGFYSSGDLPVLVTNNIQTVVHCEEQL---RDLENAELETPVVVWLK 136

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLER 181
           +D+G +RLG+  ++     + +F ++L Q   +      +SH  CAD+ ++ +   Q+E 
Sbjct: 137 IDSGMHRLGVRPEQ-----YQAFVERLHQCPNVAKPLRYMSHFGCADEMNNEMTPKQIEL 191

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTA 238
           F +L    KG E SLA+S+G+L       +  RPGI +YG +   DK       + V+T 
Sbjct: 192 FLSLTRGCKG-ERSLAASAGLLAWQESQLEWVRPGIIMYGVSPFGDKTASELGYKPVMTL 250

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           ++ +I +R   AGE V YG      RD+ + V AIGY DGYP T        +P+   G 
Sbjct: 251 KSHLIAVRDVKAGESVGYGATWISERDTKVGVIAIGYGDGYPRT--------APN---GT 299

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
              + G  VPI G+++MDM   D+    +  VGD   ++G D+  +DVA   GT  Y+L+
Sbjct: 300 PVLVNGRKVPIAGRVSMDMLTVDLGPDATDHVGDEAILWGADLPAEDVAQHIGTIAYELV 359

Query: 359 VRIGTRYAKFYT 370
            ++ +R    Y+
Sbjct: 360 TKLTSRVEMSYS 371


>gi|78211897|ref|YP_380676.1| alanine racemase [Synechococcus sp. CC9605]
 gi|78196356|gb|ABB34121.1| alanine racemase [Synechococcus sp. CC9605]
          Length = 376

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 163/322 (50%), Gaps = 25/322 (7%)

Query: 34  AVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLRLYTPQARIFVLYGIH-PGQEK 92
           AVVK + YG G E +A A    G     V +++EG++LR    +A + +L  ++ P   +
Sbjct: 39  AVVKADGYGHGAETVARAALQGGATSLGVATLQEGLELRRAGLEAPVLLLSNLNEPDDLR 98

Query: 93  IIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFN 151
                 L+P +SS+      + L +  G      L++DTG  RLG SL E       +  
Sbjct: 99  TCLHWRLMPTLSSLRDAQLCNALAADSGRCFDVQLKIDTGMARLGCSLSEG--HQTAAVL 156

Query: 152 KKLGQLSL--IISHLACADDPSSHVNSVQLERFRTLISHY----KGIEASLASSSGILLG 205
           + L  L+L  I SHLACAD+P   + S+Q ERF +++S       GI   LA+S+G LL 
Sbjct: 157 QSLEHLNLEGIYSHLACADEPDDALTSLQQERFVSMLSALPRGGAGITRHLANSAGTLLN 216

Query: 206 PNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEARIILIRKALAGELVSYGGQKKLT 263
              H  L R G++LYG      +N   P+Q  +   AR+ LIR  +AG  VSYG +    
Sbjct: 217 RELHHDLVRVGLALYGHAPASHLNNVIPLQPALAVRARVSLIRDVIAGTGVSYGHRFITQ 276

Query: 264 RDSLIAVAAIGYADGYPLTLSG-LDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDI 322
           R + +AV  IGYADG   +LSG + + HS               +P +G ITMD  + D 
Sbjct: 277 RPTRLAVVGIGYADGVLRSLSGHIHALHS------------NRQLPQVGAITMDQLLLDA 324

Query: 323 TDSLSIEVGDYIQIFGPDIKLD 344
           TD+  +E GD + + G D  L+
Sbjct: 325 TDAAGLEPGDIVTLLGQDGDLE 346


>gi|325499632|gb|EGC97491.1| alanine racemase [Escherichia fergusonii ECD227]
          Length = 359

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 119/374 (31%), Positives = 185/374 (49%), Gaps = 39/374 (10%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLIETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVP-QLTFYSK-----LMSCGVSHPY 124
           LR       I +L G         F+ + +P IS+   Q   +++     L +  +  P 
Sbjct: 66  LRAGGITQPILLLEGF--------FEADDLPTISAEHLQTAVHNEEQLVALETAELKEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F    S  K + Q   I+SH A AD+P S     QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVLPEQAEAFYQRLSQCKNVRQPVNIVSHFARADEPQSGATEKQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG------GTDKINKSHPMQTV 235
           F T      G + S+A+S GILL P  HF   RPGI LYG      GT   +     Q V
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWARPGIILYGVSPLEDGTTGADFG--CQPV 234

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           ++  + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS  
Sbjct: 235 MSLTSSLIAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGDGYP--------RAAPS-- 284

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y
Sbjct: 285 -GTPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAAMTKVSAY 343

Query: 356 DLLVRIGTRYAKFY 369
           +L+ R+ +R A  Y
Sbjct: 344 ELITRLTSRVAMKY 357


>gi|168263431|ref|ZP_02685404.1| alanine racemase [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|194444595|ref|YP_002043497.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194403258|gb|ACF63480.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|205347865|gb|EDZ34496.1| alanine racemase [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
          Length = 359

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         FD   +P IS+      V      + L +  ++ P 
Sbjct: 66  LRAGGITQPILLLEGF--------FDAADLPTISAQCLHTAVHNQEQLAALEAVELAEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  +EA  F    +  K + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEEAEAFYQRLTHCKNVRQPVNIVSHFARADEPECGATEHQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVT 237
           F        G + S+A+S GILL P  HF   RPGI LYG +   +K        Q V++
Sbjct: 178 FNAFCRGKPG-QRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R   AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+  +     GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|260436550|ref|ZP_05790520.1| alanine racemase [Synechococcus sp. WH 8109]
 gi|260414424|gb|EEX07720.1| alanine racemase [Synechococcus sp. WH 8109]
          Length = 376

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 114/355 (32%), Positives = 175/355 (49%), Gaps = 34/355 (9%)

Query: 12  DLTALKNNWHSMN--ALSGNART-----------AAVVKDNAYGLGCEKIAPALYNAGVQ 58
           +L   +  W  ++  A+ GNAR             AVVK + YG G E +A A    G  
Sbjct: 4   ELNPRQRAWVEVSPAAIRGNARALCQHLGPRTQLMAVVKADGYGHGAETVARAALQGGAT 63

Query: 59  DFFVTSVEEGVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMS 117
              V +++EG++LR    +A + +L  ++ P   +      L+P +SS+ +    + L +
Sbjct: 64  SLGVATLQEGLELRRAGLEAPVLLLSNLNKPDDLRTCLHWGLMPTLSSLREAQLCNALAA 123

Query: 118 -CGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNS 176
             G      L++DTG  RLG SL E         + +   L  I SHLACAD+P+  + S
Sbjct: 124 DSGRCFDVQLKIDTGMARLGCSLSEGHQTAAELESLEHLNLEGIYSHLACADEPNDALTS 183

Query: 177 VQLERFRTLISHY----KGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSH-- 230
           +Q ERF ++++       GI   LA+S+G LL    H  L R G++LYG     + S+  
Sbjct: 184 LQQERFVSMLAALPQAGAGITRHLANSAGTLLNRELHHDLVRVGLALYGHAPASHLSNVI 243

Query: 231 PMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSG-LDSE 289
           P+Q  +   AR+ LIR+  AG  VSYG +    R + +AV  IGYADG   +LSG + + 
Sbjct: 244 PLQPALAVRARVSLIREVPAGTGVSYGHRFITERPTRLAVVGIGYADGVLRSLSGRIHAL 303

Query: 290 HSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLD 344
           H            +   +P +G ITMD  + D TD+  +E GD + + G D  L+
Sbjct: 304 H------------RNRQLPQVGAITMDQLLLDATDAAELEQGDIVTLLGQDGDLE 346


>gi|168231244|ref|ZP_02656302.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|168466930|ref|ZP_02700778.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|194472435|ref|ZP_03078419.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|197249755|ref|YP_002149160.1| alanine racemase [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|194458799|gb|EDX47638.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|195630651|gb|EDX49263.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|197213458|gb|ACH50855.1| alanine racemase [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|205334185|gb|EDZ20949.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
          Length = 359

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         FD   +P IS+      V      + L +  ++ P 
Sbjct: 66  LRAGGITQPILLLEGF--------FDAADLPTISAQCLHTAVHNQEQLAALEAVELAEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  +EA  F    +  K + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEEAEAFYQRLTHCKNVRQPVNIVSHFARADEPECGATEHQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVT 237
           F        G + S+A+S GILL P  HF   RPGI LYG +   +K        Q V++
Sbjct: 178 FNAFCQGKPG-QRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R   AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRA--------APS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+  +     GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEITKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|326423831|ref|NP_760315.2| alanine racemase [Vibrio vulnificus CMCP6]
 gi|34098535|sp|Q8DCL0|ALR1_VIBVU RecName: Full=Alanine racemase 1
 gi|319999201|gb|AAO09842.2| alanine racemase [Vibrio vulnificus CMCP6]
          Length = 358

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 114/372 (30%), Positives = 185/372 (49%), Gaps = 34/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N   +   + +++  AVVK N YG G   +A   +  G   F V  +EE ++
Sbjct: 8   IDLVALQHNLQLIKQQAPHSKLMAVVKANGYGHGLRHVAK--HAVGADAFGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +  G   ++   N+  V+    QL     L +  +  P    L+
Sbjct: 66  LRACGVVKPILLLEGFYSSGDLPVLVTNNIQTVVHCEEQL---RDLENAELETPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLER 181
           +D+G +RLG+  ++     + +F ++L Q   +      +SH  CAD+ ++ +   Q+E 
Sbjct: 123 IDSGMHRLGVRPEQ-----YQAFVERLHQCPNVAKPLRYMSHFGCADEMNNEMTPKQIEL 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTA 238
           F +L    KG E SLA+S+G+L       +  RPGI +YG +   DK       + V+T 
Sbjct: 178 FLSLTRGCKG-ERSLAASAGLLAWQESQLEWVRPGIIMYGVSPFGDKTASELGYKPVMTL 236

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           ++ +I +R   AGE V YG      RD+ + V AIGY DGYP T        +P+   G 
Sbjct: 237 KSHLIAVRDVKAGESVGYGATWISERDTKVGVIAIGYGDGYPRT--------APN---GT 285

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
              + G  VPI G+++MDM   D+    +  VGD   ++G D+  +DVA   GT  Y+L+
Sbjct: 286 PVLVNGRKVPIAGRVSMDMLTVDLGPDATDHVGDEAILWGADLPAEDVAQHIGTIAYELV 345

Query: 359 VRIGTRYAKFYT 370
            ++ +R    Y+
Sbjct: 346 TKLTSRVEMSYS 357


>gi|145632963|ref|ZP_01788696.1| alanine racemase [Haemophilus influenzae 3655]
 gi|144986619|gb|EDJ93185.1| alanine racemase [Haemophilus influenzae 3655]
          Length = 360

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 180/367 (49%), Gaps = 24/367 (6%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L  + V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTLEQS-VDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
            LR       I +L G    Q+  I   N I  I  V        L    +  P    L+
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETI--VHNREQLEALKRANLPSPIKVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFRT 184
           +DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF +
Sbjct: 126 IDTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQINRFLS 183

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEARI 242
                +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + +
Sbjct: 184 ATKDKQG-ERTIAASGGILFWPKSHLECIRPGIIIYGISPTDTIGKEFDLTPVMNLTSSL 242

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R    G+ V YGG     RD+ I V A+GY DGYP      D      V+L G+   
Sbjct: 243 IAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPR-----DVPEGTPVYLNGR--- 294

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
              +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++ 
Sbjct: 295 ---LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKLT 351

Query: 363 TRYAKFY 369
            R    Y
Sbjct: 352 PRVITEY 358


>gi|88858927|ref|ZP_01133568.1| alanine racemase 1, PLP-binding, biosynthetic [Pseudoalteromonas
           tunicata D2]
 gi|88819153|gb|EAR28967.1| alanine racemase 1, PLP-binding, biosynthetic [Pseudoalteromonas
           tunicata D2]
          Length = 358

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 117/375 (31%), Positives = 182/375 (48%), Gaps = 40/375 (10%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +I L AL +N+  +   +  ++  AV+K NAYG G   IA  L +A    F V  ++E +
Sbjct: 7   EISLAALDHNFKRVKEFAPASQIMAVLKANAYGHGLVAIAKRLSSADA--FAVARIDEAL 64

Query: 70  KLRLYTPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G   P    I+   N   +I    QL     LM+C +       L
Sbjct: 65  ALRAGGLVKPIVLLEGFFEPQDLPILLANNFQTIIHHQSQL---DALMNCDLDGMLTTWL 121

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLS---------LIISHLACADDPSSHVNSV 177
           ++DTG +RLG+S ++        F+K    LS          +++H ACADD S+     
Sbjct: 122 KIDTGMHRLGISPEQ--------FSKAYQTLSQCEHVNPNIRLMTHFACADDLSNGKTQQ 173

Query: 178 QLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINK---SHPMQT 234
           QL  F  LI+  K  +  LA+S+ I+  P+ H    RPG+ +YG +  +NK    H +  
Sbjct: 174 QLAVFSELIADKKQ-QTCLANSAAIIGWPDSHGDWVRPGLMMYGVSPMLNKVGADHGLAP 232

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           V+  + R+I +R    GE V YG       D++I V A+GY DGYP         H+PS 
Sbjct: 233 VMRLKTRLISLRVVKKGEAVGYGSTWTCPIDTIIGVVAMGYGDGYP--------RHAPS- 283

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTN 354
             G    + G  VP++G+++MDM   D+      ++GD + ++GP++ ++ VA  + T  
Sbjct: 284 --GTPVMVNGKQVPLVGRVSMDMITVDLGLETDAKIGDQVILWGPELPVEVVAQCADTIP 341

Query: 355 YDLLVRIGTRYAKFY 369
           Y+LL  I  R    Y
Sbjct: 342 YELLCNITPRVDYHY 356


>gi|332711200|ref|ZP_08431133.1| alanine racemase [Lyngbya majuscula 3L]
 gi|332350014|gb|EGJ29621.1| alanine racemase [Lyngbya majuscula 3L]
          Length = 408

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 119/373 (31%), Positives = 181/373 (48%), Gaps = 25/373 (6%)

Query: 10  KIDLTALKNNWHSMNALSGN-ARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           +ID  AL +N   +  L  +  +  AVVK +AYG G   +A     AG     V +V EG
Sbjct: 44  EIDQVALHHNLRQIQQLWRHPTQLMAVVKADAYGHGALTVARTAIEAGAGGLCVATVSEG 103

Query: 69  VKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQ-LTFYSKLMSCGVSHPYAL 126
           ++LR    +A I +L   + P Q K I    L P + +  Q L F   L     S P  L
Sbjct: 104 IQLRQGGIKATILLLGATNTPEQVKAIAHWQLEPTLCNPQQALVFSETLSGLNQSLPVHL 163

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           ++DTG +RLG+  Q+A++F          +++ + SHLA AD P   V   Q +RF+  I
Sbjct: 164 KLDTGMSRLGMPWQDAIEFVRLVQQLPNLEIASVYSHLATADSPDPTVMRQQHQRFKNAI 223

Query: 187 SHYK--GIEAS---LASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAE 239
           +  +  GI      LA+S+  L     H+   R G+++YG    + + K   ++ V+  +
Sbjct: 224 AQLQAGGITPPRLHLANSAATLTDSALHYDWVRVGLAVYGLYPAEHLQKVIHLKPVMQVK 283

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           ARI  I+    G  +SYG Q    R   +AV  IGYADG P  LS   +           
Sbjct: 284 ARITQIKTIPPGTGISYGHQFISNRQMRLAVVGIGYADGVPRNLSNRINV---------- 333

Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALASGTTNY 355
             I+G  VP +G ITMD  M D++D  +I+VG+ + + G D    I  DD A+A GT ++
Sbjct: 334 -IIRGQQVPQIGAITMDQLMLDVSDIPNIQVGEIVTLIGQDGEEQISADDWAMALGTISW 392

Query: 356 DLLVRIGTRYAKF 368
           +++     R  + 
Sbjct: 393 EIICGFKHRLPRV 405


>gi|146309923|ref|YP_001174997.1| alanine racemase [Enterobacter sp. 638]
 gi|145316799|gb|ABP58946.1| alanine racemase [Enterobacter sp. 638]
          Length = 359

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 118/367 (32%), Positives = 181/367 (49%), Gaps = 25/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +   I D +L   I +  QL     L +  +S P    ++
Sbjct: 66  LRAGGITQPILLLEGFFEATDLTTIADQHLHTAIHNEEQLL---ALETAELSEPVTVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++A  F    S  K + Q   I+SH A AD+P       QL+ F T  
Sbjct: 123 LDTGMHRLGVRPEQAEAFYQRLSQCKNVHQPVNIVSHFARADEPECGATEQQLDIFNTFC 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVTAEARI 242
               G+  S+A+S GILL P  HF   RPGI LYG +   NK       +Q V++  + +
Sbjct: 183 EGKPGMR-SIAASGGILLWPQSHFDWARPGIILYGVSPLENKPWGPDFGLQPVMSLVSNL 241

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R+  AGE V YGG      D+ + V A+GY DGYP          +PS   G    +
Sbjct: 242 IAVREHKAGEPVGYGGTWVSESDTRLGVVAMGYGDGYPRA--------APS---GTPVLV 290

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  V I+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L+ R+ 
Sbjct: 291 NGREVKIVGRVAMDMICVDLGPDAQDKAGDAVVLWGEGLPVERIAEITKVSAYELITRLT 350

Query: 363 TRYAKFY 369
           +R A  Y
Sbjct: 351 SRVAMKY 357


>gi|320155181|ref|YP_004187560.1| alanine racemase, biosynthetic [Vibrio vulnificus MO6-24/O]
 gi|319930493|gb|ADV85357.1| alanine racemase, biosynthetic [Vibrio vulnificus MO6-24/O]
          Length = 361

 Score =  156 bits (394), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 114/372 (30%), Positives = 185/372 (49%), Gaps = 34/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N   +   + +++  AVVK N YG G   +A   +  G   F V  +EE ++
Sbjct: 11  IDLVALQHNLQLIKQQAPHSKLMAVVKANGYGHGLRHVAK--HAVGADAFGVARIEEALQ 68

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +  G   ++   N+  V+    QL     L +  +  P    L+
Sbjct: 69  LRACGVVKPILLLEGFYSSGDLPVLVTNNIQTVVHCEEQL---RDLENAELETPVVVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLER 181
           +D+G +RLG+  ++     + +F ++L Q   +      +SH  CAD+ ++ +   Q+E 
Sbjct: 126 IDSGMHRLGVRPEQ-----YQAFVERLHQCPNVAKPLRYMSHFGCADEMNNEMTPKQIEL 180

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTA 238
           F +L    KG E SLA+S+G+L       +  RPGI +YG +   DK       + V+T 
Sbjct: 181 FLSLTRGCKG-ERSLAASAGLLAWQESQLEWVRPGIIMYGVSPFGDKTASELGYKPVMTL 239

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           ++ +I +R   AGE V YG      RD+ + V AIGY DGYP T        +P+   G 
Sbjct: 240 KSHLIAVRDVKAGESVGYGATWISERDTKVGVIAIGYGDGYPRT--------APN---GT 288

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
              + G  VPI G+++MDM   D+    +  VGD   ++G D+  +DVA   GT  Y+L+
Sbjct: 289 PVLVNGRKVPIAGRVSMDMLTVDLGPDATDHVGDEAILWGADLPAEDVAQHIGTIAYELV 348

Query: 359 VRIGTRYAKFYT 370
            ++ +R    Y+
Sbjct: 349 TKLTSRVEMSYS 360


>gi|253991385|ref|YP_003042741.1| alanine racemase [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253782835|emb|CAQ86000.1| alanine racemase) [Photorhabdus asymbiotica]
          Length = 359

 Score =  156 bits (394), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 115/366 (31%), Positives = 180/366 (49%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +  ++  +   AVVK NAYG G  + A  L +A    F V  + E + 
Sbjct: 8   IDRRALRHNLQRVREIAPKSNLIAVVKANAYGHGLLETAHTLDDADC--FGVARIGEALT 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +  +   N I  V+ S+ QL     L    +SHP    ++
Sbjct: 66  LRHGGIVKPILLLEGCFDAADLPVLVANHIETVVHSIEQL---EALEQAKLSHPVKVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++A +F    S  K + Q   I+SH   AD+P+      Q+  F+   
Sbjct: 123 LDSGMHRLGVRPEDAEEFYQRLSRCKNVQQPVNIVSHFGRADEPTLDTTCQQIACFQAFC 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           +   G E S+ +S GILL P  H    RPG+ +YG +   DK      +   +T ++ +I
Sbjct: 183 ADKPG-EKSIDASGGILLWPEVHQDWVRPGLMMYGVSPLSDKTAADFNLMPAMTLKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +RK  AGE V YGG     RD+ + V AIGY DGYP          +PS   G   +I 
Sbjct: 242 AVRKHKAGEAVGYGGTWISERDTCLGVVAIGYGDGYPRC--------APS---GTPIYIN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI G+++MDM   D+    + +VGD   ++G  + ++ +A  +G   Y+L+ ++ +
Sbjct: 291 GREVPIAGRVSMDMISVDLGPDAADKVGDEAVLWGDVLPVERIAECTGIITYELVTKLTS 350

Query: 364 RYAKFY 369
           R    Y
Sbjct: 351 RVVMEY 356


>gi|325578240|ref|ZP_08148375.1| alanine racemase [Haemophilus parainfluenzae ATCC 33392]
 gi|325159976|gb|EGC72105.1| alanine racemase [Haemophilus parainfluenzae ATCC 33392]
          Length = 360

 Score =  156 bits (394), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 121/368 (32%), Positives = 185/368 (50%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK+N   +   + +++  AVVK NAYG G   ++ AL  + V  F V  +EE +
Sbjct: 9   KISSLALKHNLQVIKEKAPHSKIIAVVKANAYGHGVVFVSSAL-ESMVDCFAVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    ++  II   N+  V+ +  QL     L    V  P    L
Sbjct: 68  SLRSNGIIKPILLLEGFFDEKDLPIIAVNNIETVVHNREQL---EALKRAAVPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG+SL E +D+ +    KKL Q+      +SH + AD+  S    VQL+RF 
Sbjct: 125 KIDTGMHRLGVSLDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELDSDYTQVQLDRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
                 KG E ++A+S GIL  P  H    RPGI +YG   TD +     +  V+   + 
Sbjct: 183 QATKD-KGGERTIAASGGILFWPEAHLDCIRPGIIMYGISPTDTVGAEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           ++ +R+   GE V YGG     +D+ I V AIGY DGYP      D      V+L G+  
Sbjct: 242 LLAVREHKKGEPVGYGGIWTSPKDTKIGVVAIGYGDGYPR-----DVPEGTPVYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VP +G+++MDM   D+      +VGD + ++G ++ ++ VA  SG  +Y+L+ ++
Sbjct: 295 ----IVPSVGRVSMDMLTVDLGADSQDKVGDEVILWGKELPIETVAKYSGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|200386495|ref|ZP_03213107.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|199603593|gb|EDZ02138.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
          Length = 359

 Score =  156 bits (394), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 180/372 (48%), Gaps = 35/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         FD   +P IS+      V      + L +  ++ P 
Sbjct: 66  LRAGGITQPILLLEGF--------FDAADLPTISAQCLHTAVHNQEQLAALEAVELAEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  +EA  F    +  K + Q   I+SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEEAEAFYQRLTRCKNVRQPVNIVSHFARADEPECGATEHQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVT 237
           F        G + S+A+S GILL P  HF   RPGI LYG +   +K        Q V++
Sbjct: 178 FNAFCRGKPG-QRSIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R   AGE V YGG     RD+ + V A+GY DGYP          +PS   G
Sbjct: 237 LTSSLIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYP--------RAAPS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+  +     GD + ++G  + ++ +A  +  + Y+L
Sbjct: 286 TPVLVNGREVPIVGRVAMDMICVDLGPNAQDNAGDPVVLWGEGLPVERIAEMTKVSAYEL 345

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 346 ITRLTSRVAMKY 357


>gi|313109932|ref|ZP_07795860.1| biosynthetic alanine racemase [Pseudomonas aeruginosa 39016]
 gi|310882362|gb|EFQ40956.1| biosynthetic alanine racemase [Pseudomonas aeruginosa 39016]
          Length = 363

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 113/366 (30%), Positives = 179/366 (48%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL+A+++N+      +   +  AVVK NAYG G  ++  AL++     F V  +EE  +
Sbjct: 8   VDLSAIRHNYALAKRCAPQRQAFAVVKANAYGHGAREVVTALHD-DADGFAVACLEEAAE 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY--ALQ 127
           +R     ARI +L G     E  +     L  VI    Q   +   ++ G+  P    L+
Sbjct: 67  VRALHASARILLLEGCFEASEYALAGQLRLDLVIQGAEQGEAF---LAAGLDIPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG     AL   H       G   L +ISH ACAD+ +  +   QLE F  L+
Sbjct: 124 LDSGMHRLGFD-PAALRAWHARLRSHPGVRELNLISHFACADERNHPLTEQQLESFLGLL 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
                 + SLA+S+ +L  P  H    RPGI LYG T   + S     ++  ++  A++I
Sbjct: 183 D-LDFDQRSLANSAAVLTIPAAHMDWLRPGIMLYGSTPLADLSAAELGLRPAMSLGAQLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YG      R + I   + GYADGYP T        +P+   G    + 
Sbjct: 242 SLREVAVGESVGYGATWIAERPARIGTVSCGYADGYPRT--------APA---GTPVLVG 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G    + G+++MDM   D++D     VGD ++++G  + +D+VA A GT  Y+LL ++G 
Sbjct: 291 GRRATLAGRVSMDMLAVDLSDLPEARVGDPVELWGAGLSVDEVARACGTLGYELLSKVGA 350

Query: 364 RYAKFY 369
           R  + +
Sbjct: 351 RVPRAF 356


>gi|396388|gb|AAC43147.1| alanine racemase [Escherichia coli str. K-12 substr. MG1655]
          Length = 358

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 115/372 (30%), Positives = 179/372 (48%), Gaps = 36/372 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +   +  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLREXAPASKMVAVVKANAYGHGLLETARTLPDADA--FXVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       + +L G         FD   +P IS+      V      + L    +  P 
Sbjct: 66  LRAGGITKPVLLLEGF--------FDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F H  +  K + Q   I+SH A AD+P       QL  
Sbjct: 118 TVWMKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS----HPMQTVVT 237
           F T      G + S+A+S GILL P  HF   RPGI LYG +   ++S       Q V++
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMS 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             + +I +R+  AGE V YGG     RD+ + V A+GY DGY    SG     +P     
Sbjct: 237 LTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYXAAPSG-----TPV---- 287

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y+L
Sbjct: 288 ---LVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYEL 344

Query: 358 LVRIGTRYAKFY 369
           + R+ +R A  Y
Sbjct: 345 ITRLTSRVAMKY 356


>gi|218551364|ref|YP_002385156.1| alanine racemase [Escherichia fergusonii ATCC 35469]
 gi|218358906|emb|CAQ91565.1| alanine racemase 1, PLP-binding, biosynthetic [Escherichia
           fergusonii ATCC 35469]
 gi|324112309|gb|EGC06287.1| alanine racemase [Escherichia fergusonii B253]
          Length = 359

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 119/374 (31%), Positives = 185/374 (49%), Gaps = 39/374 (10%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLIETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVP-QLTFYSK-----LMSCGVSHPY 124
           LR       I +L G         F+ + +P IS+   Q   +++     L +  +  P 
Sbjct: 66  LRAGGITQPILLLEGF--------FEADDLPTISAEHLQTAVHNEEQLVALETAELKEPV 117

Query: 125 --ALQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F    S  K + Q   I+SH A AD+P S     QL+ 
Sbjct: 118 IVWMKLDTGMHRLGVLPEQAEAFYQRLSQCKNVRQPVNIVSHFARADEPQSGATEKQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG------GTDKINKSHPMQTV 235
           F T      G + S+A+S GILL P  HF   RPGI LYG      GT   +     Q V
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWARPGIILYGVSPLEDGTTGADFG--CQPV 234

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           ++  + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS  
Sbjct: 235 MSLTSSLIAVREHKAGEPVGYGGTWISERDTRLGVVAMGYGDGYP--------RAAPS-- 284

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y
Sbjct: 285 -GTPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAAMTKVSAY 343

Query: 356 DLLVRIGTRYAKFY 369
           +L+ R+ +R A  Y
Sbjct: 344 ELITRLTSRVAMKY 357


>gi|270263327|ref|ZP_06191597.1| hypothetical protein SOD_d03440 [Serratia odorifera 4Rx13]
 gi|270043015|gb|EFA16109.1| hypothetical protein SOD_d03440 [Serratia odorifera 4Rx13]
          Length = 359

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 108/364 (29%), Positives = 183/364 (50%), Gaps = 20/364 (5%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +   +  +R  AVVK NAYG G  + A  L +A    + V  + E + 
Sbjct: 8   IDRRALRHNLQQVRRQAPQSRLIAVVKANAYGHGLLETAHTLQDADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR       I +L G    ++  ++   N+   + S+ QL    +        P  +++D
Sbjct: 66  LRSGGIVKPILLLEGFFCAEDLPVLVANNIETAVHSIEQLEALEQ-TELARPVPVWMKLD 124

Query: 130 TGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           TG +RLG+  ++A  F    S  + + Q   I+SH + AD+P S     Q++ F + +  
Sbjct: 125 TGMHRLGVRPEQAEAFYQRLSACRNVAQPVNIMSHFSRADEPDSDATLKQMQCFESFVRG 184

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARIILI 245
             G + S+A+S G LL P+ H    RPGI LYG +   D       +Q  +T ++ +I +
Sbjct: 185 KPG-QRSIAASGGTLLWPDAHNDWVRPGIILYGVSPMEDACGSQFDLQPAMTLKSNLIAV 243

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R   AGE V YGG      D+ + V A+GY DGYP +        +PS   G   ++ G 
Sbjct: 244 RDHKAGEAVGYGGTWVSEGDTRLGVVAMGYGDGYPRS--------APS---GTPVWLNGR 292

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
            VP++G+++MDM   D+  + + +VGD + ++G  + ++ +A  +G + Y+L+ ++  R 
Sbjct: 293 EVPVVGRVSMDMISVDLGPNATDKVGDEVVLWGKALPVERIAACTGISAYELITKLTQRV 352

Query: 366 AKFY 369
           A  Y
Sbjct: 353 AMEY 356


>gi|37528186|ref|NP_931531.1| alanine racemase [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|36787623|emb|CAE16730.1| alanine racemase, biosynthetic [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 359

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 117/366 (31%), Positives = 182/366 (49%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +  ++  +   AVVK NAYG G  + A  L +A    F V  + E + 
Sbjct: 8   IDRRALRHNLQRVREIAPKSNLIAVVKANAYGHGLLETAHTLDDADC--FGVARIGEALT 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     + ++   N I  V+ SV QL     L    +SHP    ++
Sbjct: 66  LRHGGIVKPILLLEGCFDAADLLVLVANHIETVVHSVEQL---QALEQAKLSHPVKVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG+  ++A +F    S  K + Q   I+SH   AD+P+      Q+  F+   
Sbjct: 123 LDSGMHRLGVRPEDAEEFYQRLSRCKNVQQPVNIVSHFGRADEPTVDTTCQQIACFQAFC 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           +   G E S+ +S GILL P  H    RPG+ +YG +   DK      +   +T ++ +I
Sbjct: 183 ADKPG-EKSIDASGGILLWPEVHQDWVRPGLMMYGVSPLSDKTAVDFNLIPAMTLKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +RK  AGE V YGG     RD+ + V AIGY DGYP +        +PS   G    I 
Sbjct: 242 AVRKHKAGESVGYGGIWVSERDTYLGVVAIGYGDGYPRS--------APS---GTPIHIN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI G+++MDM   D+    + +VGD + ++G  + ++ VA  +G   Y+L+ ++ +
Sbjct: 291 GREVPIAGRVSMDMISVDLGPEATDKVGDEVVLWGDVLPVERVAKHTGIITYELVTKLTS 350

Query: 364 RYAKFY 369
           R    Y
Sbjct: 351 RVVMEY 356


>gi|26250840|ref|NP_756880.1| alanine racemase [Escherichia coli CFT073]
 gi|110644389|ref|YP_672119.1| alanine racemase [Escherichia coli 536]
 gi|191171958|ref|ZP_03033503.1| alanine racemase [Escherichia coli F11]
 gi|227886936|ref|ZP_04004741.1| alanine racemase [Escherichia coli 83972]
 gi|300980476|ref|ZP_07175023.1| alanine racemase [Escherichia coli MS 200-1]
 gi|300992970|ref|ZP_07180125.1| alanine racemase [Escherichia coli MS 45-1]
 gi|301047007|ref|ZP_07194116.1| alanine racemase [Escherichia coli MS 185-1]
 gi|33301027|sp|Q8FB20|ALR1_ECOL6 RecName: Full=Alanine racemase, biosynthetic
 gi|26111271|gb|AAN83454.1|AE016770_254 Alanine racemase, biosynthetic [Escherichia coli CFT073]
 gi|110345981|gb|ABG72218.1| alanine racemase, biosynthetic [Escherichia coli 536]
 gi|190907723|gb|EDV67317.1| alanine racemase [Escherichia coli F11]
 gi|227836077|gb|EEJ46543.1| alanine racemase [Escherichia coli 83972]
 gi|300301052|gb|EFJ57437.1| alanine racemase [Escherichia coli MS 185-1]
 gi|300307778|gb|EFJ62298.1| alanine racemase [Escherichia coli MS 200-1]
 gi|300406744|gb|EFJ90282.1| alanine racemase [Escherichia coli MS 45-1]
 gi|307556202|gb|ADN48977.1| alanine racemase [Escherichia coli ABU 83972]
 gi|315291550|gb|EFU50910.1| alanine racemase [Escherichia coli MS 153-1]
 gi|324014852|gb|EGB84071.1| alanine racemase [Escherichia coli MS 60-1]
          Length = 359

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 119/374 (31%), Positives = 182/374 (48%), Gaps = 39/374 (10%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLIETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISS------VPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         F+ + +P IS+      V        L +  +  P 
Sbjct: 66  LRAGGITRPILLLEGF--------FEADDLPTISAEHLHTAVHNEEQLVALENAELKEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  ++A  F    S  K + Q   I+SH A AD+P S     QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVLPEQAEAFYQRLSQCKNVRQPVNIVSHFARADEPQSGATEKQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG------GTDKINKSHPMQTV 235
           F T      G + S+A+S GILL P  HF   RPGI LYG      GT   +     Q V
Sbjct: 178 FNTFCEGKPG-QRSIAASGGILLWPQSHFDWARPGIILYGVSPLEDGTTGADFG--CQPV 234

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           ++  + +I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS  
Sbjct: 235 MSLTSSLIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYP--------RAAPS-- 284

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +  + Y
Sbjct: 285 -GTPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAY 343

Query: 356 DLLVRIGTRYAKFY 369
           +L+ R+ +R A  Y
Sbjct: 344 ELITRLTSRVAMKY 357


>gi|90414458|ref|ZP_01222434.1| alanine racemase [Photobacterium profundum 3TCK]
 gi|90324463|gb|EAS41022.1| alanine racemase [Photobacterium profundum 3TCK]
          Length = 359

 Score =  155 bits (393), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 116/368 (31%), Positives = 186/368 (50%), Gaps = 26/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL +N   ++  + N++  AVVK N YG G   +A +L +A    F V  +EE + 
Sbjct: 8   INTDALTHNIRQLHLQAPNSKLLAVVKANGYGHGLLHVAKSLPDADA--FGVARIEEALT 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +   +  II   N+  V+ S+ QL     L S  + +     L+
Sbjct: 66  LRAGGVVKPILLLEGFYGASDLPIIVTNNIHTVVHSIEQL---EALESAELDNQAVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++  DF         + +    +SH  CADD +S+V + Q+  F +L 
Sbjct: 123 IDTGMHRLGVRPEQLDDFVQRLHACDNVAKPLRYMSHFGCADDLTSNVTNQQINTFLSLT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT-----DKINKSHPMQTVVTAEAR 241
               G E SLA+S+GIL  P+   +  RPGI +YG +     D+  ++  +Q V+T  + 
Sbjct: 183 EGCSG-ERSLAASAGILAWPDSQLEWIRPGIIMYGVSPFIEPDRSAEAFNLQPVMTLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    GE V YGG     RD+ + V AIGY DGYP T        +P+   G    
Sbjct: 242 LIAVRDVKEGEQVGYGGIWTSERDTKVGVIAIGYGDGYPRT--------APN---GTPVL 290

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G +VP+ G+++MDM   D+  +   +VGD   ++G  +  + VA   GT  Y+L+ ++
Sbjct: 291 VNGRIVPMAGRVSMDMLTVDLGPNAQDKVGDEAVLWGNGLPAEVVAEHIGTIAYELVTKL 350

Query: 362 GTRYAKFY 369
            +R    Y
Sbjct: 351 TSRVDMTY 358


>gi|15600123|ref|NP_253617.1| biosynthetic alanine racemase [Pseudomonas aeruginosa PAO1]
 gi|20137487|sp|Q9HUN4|ALR1_PSEAE RecName: Full=Alanine racemase, biosynthetic
 gi|9951209|gb|AAG08315.1|AE004906_3 biosynthetic alanine racemase [Pseudomonas aeruginosa PAO1]
          Length = 358

 Score =  155 bits (393), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 114/367 (31%), Positives = 180/367 (49%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL+A+++N+      +   +  AVVK NAYG G  ++  AL++     F V  +EE  +
Sbjct: 8   VDLSAIRHNYALAKRCAPQRQAFAVVKANAYGHGAREVVTALHD-DADGFAVACLEEAAE 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY--ALQ 127
           +R     ARI +L G     E  +     L  VI    Q   +   ++ G+  P    L+
Sbjct: 67  VRALHASARILLLEGCFEASEYALAGQLRLDLVIQGAEQGEAF---LAAGLDIPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG     AL   H       G   L +ISH ACAD+ +  +   QLE F  L+
Sbjct: 124 LDSGMHRLGFD-PAALRAWHARLRSHPGVRELNLISHFACADERNHPLTEQQLESFLGLL 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
                 + SLA+S+ +L  P  H    RPGI LYG T   + S     ++  ++  A++I
Sbjct: 183 D-LDFDQRSLANSAAVLTIPAAHMDWLRPGIMLYGSTPLADLSAAELGLKPAMSLGAQLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YG      R + I   + GYADGYP T     +     V +GG+  I 
Sbjct: 242 SLREVAVGESVGYGATWIAERPARIGTVSCGYADGYPRT-----APAGTPVLVGGRRAI- 295

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
                + G+++MDM   D++D     VGD ++++G  + +D+VA A GT  Y+LL ++  
Sbjct: 296 -----LAGRVSMDMLAVDLSDLPEARVGDPVELWGAGLSVDEVARACGTLGYELLSKVTA 350

Query: 364 RYAKFYT 370
           R  + Y+
Sbjct: 351 RVPRRYS 357


>gi|145635716|ref|ZP_01791411.1| alanine racemase [Haemophilus influenzae PittAA]
 gi|145639886|ref|ZP_01795486.1| alanine racemase [Haemophilus influenzae PittII]
 gi|229845613|ref|ZP_04465739.1| alanine racemase [Haemophilus influenzae 6P18H1]
 gi|145267039|gb|EDK07048.1| alanine racemase [Haemophilus influenzae PittAA]
 gi|145270977|gb|EDK10894.1| alanine racemase [Haemophilus influenzae PittII]
 gi|229811480|gb|EEP47183.1| alanine racemase [Haemophilus influenzae 6P18H1]
 gi|309751068|gb|ADO81052.1| Alanine racemase [Haemophilus influenzae R2866]
          Length = 360

 Score =  155 bits (393), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 118/368 (32%), Positives = 183/368 (49%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L    V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTL-EQNVDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I   N I  V+ +  QL     L    +  P    L
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQL---DALKRANLPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF 
Sbjct: 125 KIDTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQINRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
           ++    +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + 
Sbjct: 183 SVTKDKQG-ERTIAASGGILFWPESHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    G+ V YGG     RD+ I V A+GY DGYP      D      ++L G+  
Sbjct: 242 LIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPR-----DVPEGTPIYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+       +GD + ++G ++ ++ VA  +G  +Y+L+ ++
Sbjct: 295 ----LVPIVGRVSMDMLTVDLGADSQDLIGDEVILWGKELPIETVAKFTGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|68249839|ref|YP_248951.1| alanine racemase [Haemophilus influenzae 86-028NP]
 gi|148826096|ref|YP_001290849.1| alanine racemase [Haemophilus influenzae PittEE]
 gi|229847109|ref|ZP_04467214.1| alanine racemase [Haemophilus influenzae 7P49H1]
 gi|68058038|gb|AAX88291.1| alanine racemase [Haemophilus influenzae 86-028NP]
 gi|148716256|gb|ABQ98466.1| alanine racemase [Haemophilus influenzae PittEE]
 gi|229809938|gb|EEP45659.1| alanine racemase [Haemophilus influenzae 7P49H1]
          Length = 360

 Score =  155 bits (393), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 182/368 (49%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L    V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTL-EQNVDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I   N I  V+ +  QL     L    +  P    L
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQL---EALKRSNLPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF 
Sbjct: 125 KIDTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQINRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
           +     +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + 
Sbjct: 183 SATKDKQG-ERTIAASGGILFWPKSHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    G+ V YGG     RD+ I V A+GY DGYP      D      V+L G+  
Sbjct: 242 LIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPR-----DVPEGTPVYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++
Sbjct: 295 ----LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|254282682|ref|ZP_04957650.1| alanine racemase [gamma proteobacterium NOR51-B]
 gi|219678885|gb|EED35234.1| alanine racemase [gamma proteobacterium NOR51-B]
          Length = 351

 Score =  155 bits (393), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 113/363 (31%), Positives = 183/363 (50%), Gaps = 21/363 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFF-VTSVEE 67
           L IDL AL +N     +L+  +R  AV+K +AYG G    A AL   G+ D F V  VEE
Sbjct: 7   LSIDLDALVHNAKLCQSLAAPSRFMAVIKADAYGHGAVPCARALR--GIADAFAVALVEE 64

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
            V+LR       I V+ G+    + + I +  L PVI S  QL + S         P  L
Sbjct: 65  AVELRAAGISEPILVMEGLFSADDMRHIVEHKLWPVIHSRHQLDYLSPEHH---GTPLWL 121

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           ++DTG +RLG+  ++               ++L+ SHL  A++P + ++  Q++ ++ + 
Sbjct: 122 KIDTGMHRLGIEPEKLPQMLSRIRELGFSDITLM-SHLGDAENPDTALSQRQIDAWQNIT 180

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
             +  +  SL +S+ +           R G  LYGG    N   P++ V++ ++ ++ +R
Sbjct: 181 GQHSSV-TSLCNSAAVAQRSVPESSWVRAGYMLYGGQTTPNPL-PLKPVMSFQSAVMALR 238

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
              AGE V YGG+    R S+IA  A GYADGYP +     +E    V +GG+      +
Sbjct: 239 TIAAGETVGYGGRWCAQRPSVIATVAAGYADGYPRS-----AEDGTPVNIGGE------I 287

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
            P++G+++MDM   D+TD   +++G    ++G    +DDVA  +GT  Y+L  R+  R  
Sbjct: 288 APLVGRVSMDMVTVDVTDLPGVKIGTPALLWGASPTIDDVANRAGTIGYELTARMPPRTP 347

Query: 367 KFY 369
           + Y
Sbjct: 348 RTY 350


>gi|49086668|gb|AAT51370.1| PA4930 [synthetic construct]
          Length = 359

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 114/367 (31%), Positives = 180/367 (49%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL+A+++N+      +   +  AVVK NAYG G  ++  AL++     F V  +EE  +
Sbjct: 8   VDLSAIRHNYALAKRCAPQRQAFAVVKANAYGHGAREVVTALHD-DADGFAVACLEEAAE 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY--ALQ 127
           +R     ARI +L G     E  +     L  VI    Q   +   ++ G+  P    L+
Sbjct: 67  VRALHASARILLLEGCFEASEYALAGQLRLDLVIQGAEQGEAF---LAAGLDIPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG     AL   H       G   L +ISH ACAD+ +  +   QLE F  L+
Sbjct: 124 LDSGMHRLGFD-PAALRAWHARLRSHPGVRELNLISHFACADERNHPLTEQQLESFLGLL 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
                 + SLA+S+ +L  P  H    RPGI LYG T   + S     ++  ++  A++I
Sbjct: 183 D-LDFDQRSLANSAAVLTIPAAHMDWLRPGIMLYGSTPLADLSAAELGLKPAMSLGAQLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YG      R + I   + GYADGYP T     +     V +GG+  I 
Sbjct: 242 SLREVAVGESVGYGATWIAERPARIGTVSCGYADGYPRT-----APAGTPVLVGGRRAI- 295

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
                + G+++MDM   D++D     VGD ++++G  + +D+VA A GT  Y+LL ++  
Sbjct: 296 -----LAGRVSMDMLAVDLSDLPEARVGDPVELWGAGLSVDEVARACGTLGYELLSKVTA 350

Query: 364 RYAKFYT 370
           R  + Y+
Sbjct: 351 RVPRRYS 357


>gi|145637837|ref|ZP_01793485.1| alanine racemase [Haemophilus influenzae PittHH]
 gi|145268980|gb|EDK08935.1| alanine racemase [Haemophilus influenzae PittHH]
          Length = 360

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 182/368 (49%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L    V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTL-EQNVDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I   N I  V+ +  QL     L    +  P    L
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQL---DALKRANLPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF 
Sbjct: 125 KIDTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQINRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
           +     +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + 
Sbjct: 183 SATKDKQG-ERTIAASGGILFWPKSHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    G+ V YGG     RD+ I V A+GY DGYP      D      V+L G+  
Sbjct: 242 LIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPR-----DVPEGTPVYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++
Sbjct: 295 ----LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|294634343|ref|ZP_06712881.1| alanine racemase [Edwardsiella tarda ATCC 23685]
 gi|291092240|gb|EFE24801.1| alanine racemase [Edwardsiella tarda ATCC 23685]
          Length = 363

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 111/368 (30%), Positives = 182/368 (49%), Gaps = 26/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N+  + + + ++R  AVVK NAYG G  + A  L+ A    + V  + E + 
Sbjct: 8   IDRRALRHNFQQIRSFAPHSRLIAVVKANAYGHGLLETANTLHQADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +  ++   N+   + S  QL     L    +  P    ++
Sbjct: 66  LRSGGIVKPILLLEGFFSASDLPVLVANNIETAVHSEEQL---QALEQAQLERPVKVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++A  F         + Q    +SH + AD+P       Q+  F   +
Sbjct: 123 LDTGMHRLGVRPEQAEAFYQRLCACPNVAQPVNFMSHFSRADEPQCGRTEAQMACFDAFV 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS-----HPMQTVVTAEAR 241
               G + S+A+S GILL P  H  + RPGI LYG + + + +     + +Q  +T ++ 
Sbjct: 183 QGKPG-DQSIAASGGILLWPQSHRDMVRPGIILYGVSPQADLALAADHYGLQPAMTLQSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R+  AGE V YGG      D+ + V AIGY DGYP +        +PS   G    
Sbjct: 242 LIAVREHKAGEPVGYGGTWVAECDTRLGVVAIGYGDGYPRS--------APS---GTPVL 290

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           I G  VPI+G+++MDM   D+       VGD + ++GP + ++ VA  +G + Y+L+ ++
Sbjct: 291 INGREVPIVGRVSMDMISVDLGPQAQDRVGDKVIMWGPGLPVEKVAACTGISAYELITKL 350

Query: 362 GTRYAKFY 369
            +R A  Y
Sbjct: 351 TSRVAMEY 358


>gi|145631023|ref|ZP_01786799.1| alanine racemase [Haemophilus influenzae R3021]
 gi|144983490|gb|EDJ90966.1| alanine racemase [Haemophilus influenzae R3021]
          Length = 360

 Score =  155 bits (392), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 182/368 (49%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L    V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTL-EQNVDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I   N I  V+ +  QL     L    +  P    L
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQL---DALKRANLPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF 
Sbjct: 125 KIDTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQINRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
           +     +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + 
Sbjct: 183 SATKDKQG-ERTIAASGGILFWPESHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    G+ V YGG     RD+ I V A+GY DGYP      D      V+L G+  
Sbjct: 242 LIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPR-----DVPEGTPVYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++
Sbjct: 295 ----LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|58039646|ref|YP_191610.1| alanine racemase [Gluconobacter oxydans 621H]
 gi|58002060|gb|AAW60954.1| Alanine racemase [Gluconobacter oxydans 621H]
          Length = 257

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 129/232 (55%), Gaps = 12/232 (5%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL +DL A+ +N+  +  L+  A  AAVVK +AYGLG E++AP L NAG  DFFV  V+E
Sbjct: 18  RLTVDLDAIASNYRYLQTLASGASCAAVVKADAYGLGIERVAPVLENAGATDFFVAHVDE 77

Query: 68  GVKLR-LYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP-YA 125
           G++LR + + +ARI VL+G  PG         L PV++S+ Q+  +    S   + P  A
Sbjct: 78  GIRLRSVVSEKARITVLHGPRPGASADCVRYGLRPVLNSLEQIALWRDEGSRTDALPEAA 137

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLG-----QLSLIISHLACADDPSSHVNSVQLE 180
           LQVD+G +R GLS     D    +     G     ++ L++SHLACAD P    N  Q +
Sbjct: 138 LQVDSGMSRFGLS-----DADLETLQADKGLVDGLKVGLVMSHLACADTPDHPANQAQKD 192

Query: 181 RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM 232
           R   + +       SL++SSGI LG +YH  + RPG +LYG        +P+
Sbjct: 193 RLLQMSARLPPAPLSLSASSGIFLGTDYHLDVVRPGAALYGIAPNRTGPNPL 244


>gi|254238354|ref|ZP_04931677.1| biosynthetic alanine racemase [Pseudomonas aeruginosa C3719]
 gi|126170285|gb|EAZ55796.1| biosynthetic alanine racemase [Pseudomonas aeruginosa C3719]
          Length = 358

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 179/367 (48%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL+A+++N+      +   +  AVVK NAYG G  ++  AL++     F V  +EE  +
Sbjct: 8   VDLSAIRHNYALAKRCAPQRQAFAVVKANAYGHGAREVVTALHD-DADGFAVACLEEAAE 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY--ALQ 127
           +R     ARI +L G     E  +     L  VI    Q   +   ++ G+  P    L+
Sbjct: 67  VRALHASARILLLEGCFEASEYALAGQLRLDLVIQGAEQGEAF---LAAGLDIPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG     AL   H       G   L +ISH ACAD+ +  +   QLE F  L+
Sbjct: 124 LDSGMHRLGFD-PAALRAWHARLRNHPGVRELNLISHFACADERNHPLTEQQLESFLGLL 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
                 + SLA+S+ +L  P  H    RPGI LYG T   + S     ++  ++  A++I
Sbjct: 183 D-LDFDQRSLANSAAVLTIPAAHMDWLRPGIMLYGSTPLADLSAAELGLRPAMSLGAQLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YG      R + I   + GYADGYP T        +P+   G    + 
Sbjct: 242 SLREVAVGESVGYGATWIAERPARIGTVSCGYADGYPRT--------APA---GTPVLVG 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G    + G+++MDM   D++D     VGD ++++G  + +D+VA A GT  Y+LL ++  
Sbjct: 291 GRRATLAGRVSMDMLAVDLSDLPEARVGDPVELWGAGLSVDEVARACGTLGYELLSKVTA 350

Query: 364 RYAKFYT 370
           R  + Y+
Sbjct: 351 RVPRHYS 357


>gi|51894072|ref|YP_076763.1| alanine racemase [Symbiobacterium thermophilum IAM 14863]
 gi|81826014|sp|Q67K79|ALR_SYMTH RecName: Full=Alanine racemase
 gi|51857761|dbj|BAD41919.1| alanine racemase [Symbiobacterium thermophilum IAM 14863]
          Length = 377

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 109/372 (29%), Positives = 173/372 (46%), Gaps = 23/372 (6%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           ++DL A++ N  ++  +S   R  AVVK N YG G   +A A   AG     V SVEEGV
Sbjct: 12  EVDLNAVRANIRALKRISKAPRLMAVVKANGYGHGAVPVATAAIEAGADWLGVASVEEGV 71

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNL-IPVISSVPQLTFYSKLMSCGVSHPYALQV 128
            LR +   A I VL  + PGQ + +    L + +           +    G      L+V
Sbjct: 72  TLRRHGISAPILVLGYVSPGQAEAVLTEGLRVALFDGELGQALNREGRRLGRWARVHLKV 131

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERF--RTLI 186
           DTG  R+GL   E              ++  + +HLA AD+P +    +QLER+      
Sbjct: 132 DTGMGRIGLQPAEVGRLGRELARLDHVEVEGVFTHLATADEPGNPYTRLQLERYEAALAE 191

Query: 187 SHYKGIEASL---ASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQ--TVVTAEAR 241
               G+  ++   A+S+G++L P  H+ + R GI++ G       + P++    +T + R
Sbjct: 192 LAAAGVRPAIRHAANSAGLMLHPEAHYDMVRSGIAVVGLPPAPGVAWPVKLAPALTWKTR 251

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           + L++   AG  +SYG      R   IA   +GYADGYP  LS              +  
Sbjct: 252 VGLVKWLEAGHSISYGCTYTTARREQIATLPVGYADGYPRRLSNR-----------AQVL 300

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIF----GPDIKLDDVALASGTTNYDL 357
           I+G   P++G +TMD  M  + D L + VGD + +     G +I   ++A  + T +Y++
Sbjct: 301 IRGRRCPVVGVVTMDQMMVRVPDDLPVRVGDEVVLIGRQGGEEITATELAGLADTISYEI 360

Query: 358 LVRIGTRYAKFY 369
           +  I  R  +FY
Sbjct: 361 VCGISRRVPRFY 372


>gi|260914151|ref|ZP_05920624.1| alanine racemase [Pasteurella dagmatis ATCC 43325]
 gi|260631784|gb|EEX49962.1| alanine racemase [Pasteurella dagmatis ATCC 43325]
          Length = 360

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 116/367 (31%), Positives = 185/367 (50%), Gaps = 24/367 (6%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK+N  ++   + NA+  AVVK NAYG G   ++ A+    V  F V  +EE +
Sbjct: 9   KISSVALKHNIQTIKQKAPNAKIIAVVKANAYGHGVVFVSEAVEKM-VDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I+   N+  V+ ++ QL     L S  + +P    L
Sbjct: 68  SLRSNGITKPILLLEGFFCTQDLPILAVNNIQTVVHNIEQL---EALQSSDLPNPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTL 185
           ++DTG +RLG+ L +  +F     N      ++  +SH + AD+  S   ++QL RF   
Sbjct: 125 KIDTGMHRLGVDLSQVDEFYQALKNTPNVDPNIGFVSHFSRADEIHSDYTALQLNRFLQA 184

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKIN---KSHPMQTVVTAEARI 242
            +  KG E S+A+S GIL   + H    RPGI +YG    IN   + + +  V+T  + +
Sbjct: 185 TADKKG-ERSIAASGGILFWEDSHLDWIRPGIIMYG-IAPINVPAREYDLTPVMTLTSSL 242

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I ++    GE V YGG     +D+ I V AIGY DGYP  +             G   ++
Sbjct: 243 ISVKAHKKGEPVGYGGVWVSDKDTKIGVVAIGYGDGYPRDIP-----------TGTPVYL 291

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  VPI+GK++MDM   D+      +VGD + ++G ++ ++++A  SG  +Y+L+ ++ 
Sbjct: 292 NGRRVPIVGKVSMDMLTVDLGQDSQDKVGDEVILWGKELPIEEIAELSGVISYELITKLT 351

Query: 363 TRYAKFY 369
            R    Y
Sbjct: 352 PRVLTEY 358


>gi|319776471|ref|YP_004138959.1| alanine racemase [Haemophilus influenzae F3047]
 gi|329123976|ref|ZP_08252524.1| alanine racemase [Haemophilus aegyptius ATCC 11116]
 gi|317451062|emb|CBY87295.1| alanine racemase 1, PLP-binding, biosynthetic [Haemophilus
           influenzae F3047]
 gi|327467720|gb|EGF13215.1| alanine racemase [Haemophilus aegyptius ATCC 11116]
          Length = 360

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 183/368 (49%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L  + V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTLEQS-VDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I   N I  V+ +  QL     L    +  P    L
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQL---DALKRANLPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF 
Sbjct: 125 KIDTGMHRLGIALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQIYRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
           +     +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + 
Sbjct: 183 SATKDKQG-ERTIAASGGILFWPESHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    G+ V YGG     RD+ I V A+GY DGYP      D      V+L G+  
Sbjct: 242 LIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPR-----DVPEGTPVYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++
Sbjct: 295 ----LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|107104029|ref|ZP_01367947.1| hypothetical protein PaerPA_01005102 [Pseudomonas aeruginosa PACS2]
 gi|218894025|ref|YP_002442894.1| biosynthetic alanine racemase [Pseudomonas aeruginosa LESB58]
 gi|254244178|ref|ZP_04937500.1| biosynthetic alanine racemase [Pseudomonas aeruginosa 2192]
 gi|126197556|gb|EAZ61619.1| biosynthetic alanine racemase [Pseudomonas aeruginosa 2192]
 gi|218774253|emb|CAW30070.1| biosynthetic alanine racemase [Pseudomonas aeruginosa LESB58]
          Length = 358

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 179/367 (48%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL+A+++N+      +   +  AVVK NAYG G  ++  AL++     F V  +EE  +
Sbjct: 8   VDLSAIRHNYALAKRCAPQRQAFAVVKANAYGHGAREVVTALHD-DADGFAVACLEEAAE 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY--ALQ 127
           +R     ARI +L G     E  +     L  VI    Q   +   ++ G+  P    L+
Sbjct: 67  VRALHASARILLLEGCFEASEYALAGQLRLDLVIQGAEQGEAF---LAAGLDIPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG     AL   H       G   L +ISH ACAD+ +  +   QLE F  L+
Sbjct: 124 LDSGMHRLGFD-PAALRAWHARLRNHPGVRELNLISHFACADERNHPLTEQQLESFLGLL 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
                 + SLA+S+ +L  P  H    RPGI LYG T   + S     ++  ++  A++I
Sbjct: 183 D-LDFDQRSLANSAAVLTIPAAHMDWLRPGIMLYGSTPLADLSAAELGLRPAMSLGAQLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YG      R + I   + GYADGYP T        +P+   G    + 
Sbjct: 242 SLREVAVGESVGYGATWIAERPARIGTVSCGYADGYPRT--------APA---GTPVLVG 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G    + G+++MDM   D++D     VGD ++++G  + +D+VA A GT  Y+LL ++  
Sbjct: 291 GRRATLAGRVSMDMLAVDLSDLPEARVGDPVELWGAGLSVDEVARACGTLGYELLSKVTA 350

Query: 364 RYAKFYT 370
           R  + Y+
Sbjct: 351 RVPRRYS 357


>gi|5690427|gb|AAD47082.1|AF165882_1 biosynthetic alanine racemase [Pseudomonas aeruginosa PAO1]
          Length = 358

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 180/367 (49%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL+A+++N+      +   +  AVVK NAYG G  ++  AL++     F V  +EE  +
Sbjct: 8   VDLSAIRHNYALAKRCAPQRQAFAVVKANAYGHGAREVVTALHD-DADGFAVACLEEAAE 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY--ALQ 127
           +R     ARI +L G     E  +     L  VI    Q   +   ++ G+  P    L+
Sbjct: 67  VRALHASARILLLEGCFEASEYALAGQLRLDLVIQGAEQGEAF---LAAGLDIPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG     AL   H       G   L +ISH ACAD+ +  +   QLE F  L+
Sbjct: 124 LDSGMHRLGFD-PAALRAWHARLRNHPGVRELNLISHFACADERNHPLTEQQLESFLGLL 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
                 + SLA+S+ +L  P  H    RPGI LYG T   + S     ++  ++  A++I
Sbjct: 183 D-LDFDQRSLANSAAVLTIPAAHMDWLRPGIMLYGSTPLADLSAAELGLKPAMSLGAQLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YG      R + I   + GYADGYP T     +     V +GG+  + 
Sbjct: 242 SLREVAVGESVGYGATWIAERPARIGTVSCGYADGYPRT-----APAGTPVLVGGRRAL- 295

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
                + G+++MDM   D++D     VGD ++++G  + +D+VA A GT  Y+LL ++  
Sbjct: 296 -----LAGRVSMDMLAVDLSDLPEARVGDPVELWGAGLSVDEVARACGTLGYELLSKVTA 350

Query: 364 RYAKFYT 370
           R  + Y+
Sbjct: 351 RVPRRYS 357


>gi|332163185|ref|YP_004299762.1| alanine racemase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|318603930|emb|CBY25428.1| alanine racemase, biosynthetic [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325667415|gb|ADZ44059.1| alanine racemase [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|330861935|emb|CBX72104.1| alanine racemase [Yersinia enterocolitica W22703]
          Length = 359

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 186/364 (51%), Gaps = 20/364 (5%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +  ++  +R  AVVK NAYG G  + A  L +A    + V  + E + 
Sbjct: 8   IDRRALRHNLQQVRRIAPQSRLIAVVKANAYGHGLLETAHTLQDADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR       I +L G    ++  I   N I   + S+ QL            H + +++D
Sbjct: 66  LRSGGIVKPILLLEGFFAAEDLPILAANCIETAVHSIEQLEALEVAELSAPIHVW-MKLD 124

Query: 130 TGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           TG +RLG+  ++A  F    S  K + Q   I+SH + AD+P       QL+ F T  + 
Sbjct: 125 TGMHRLGVRPEQAEAFYQRLSACKNVIQPVNIMSHFSRADEPQVDTTRQQLDCFDTFAAD 184

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT--DKINKSH-PMQTVVTAEARIILI 245
             G + S+A+S GILL P  H    RPGI LYG +  D+   SH  ++  +  ++ +I +
Sbjct: 185 KPG-KQSIAASGGILLWPEAHRDWVRPGIILYGVSPMDEPYASHFELKPAMALKSSLIAV 243

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+  AGE V YGG     RD+ + V AIGY DGYP +        +PS   G   ++   
Sbjct: 244 REHKAGEPVGYGGTWVSERDTRLGVVAIGYGDGYPRS--------APS---GTPMWLNDR 292

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
            V I+G+++MDM   D+  + + +VGD + ++G ++ ++ +A  +G + Y+L+ ++ +R 
Sbjct: 293 EVGIVGRVSMDMISVDLGPNATDKVGDEVLLWGAELPVEKIAACTGISAYELITKLTSRV 352

Query: 366 AKFY 369
           A  Y
Sbjct: 353 AMEY 356


>gi|309973248|gb|ADO96449.1| Alanine racemase [Haemophilus influenzae R2846]
          Length = 360

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 182/368 (49%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L    V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKALNSKIIAVVKANAYGHGVVFVASTL-EQNVDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I   N I  V+ +  QL     L    +  P    L
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQL---EALKRSNLPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF 
Sbjct: 125 KIDTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQINRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
           +     +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + 
Sbjct: 183 SATKDKQG-ERTIAASGGILFWPKSHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    G+ V YGG     RD+ I V A+GY DGYP      D      V+L G+  
Sbjct: 242 LIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPR-----DVPEGTPVYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++
Sbjct: 295 ----LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|152989346|ref|YP_001350978.1| biosynthetic alanine racemase [Pseudomonas aeruginosa PA7]
 gi|150964504|gb|ABR86529.1| alanine racemase [Pseudomonas aeruginosa PA7]
          Length = 358

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/367 (30%), Positives = 180/367 (49%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL+A+++N++     +   +  AVVK NAYG G  ++  AL++     F V  +EE  +
Sbjct: 8   VDLSAIRHNYNLAKRCAPQRQAFAVVKANAYGHGAREVVTALHDE-ADGFAVACLEEAAE 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY--ALQ 127
           +R     ARI +L G     E  +     L  VI  + Q   +   ++ G+  P    L+
Sbjct: 67  VRALHADARILLLEGCFEASEYALAGQLRLDLVIQGLEQGEAF---LAAGLDTPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG     AL   H       G   L +ISH ACAD+ +  +   Q+E F  L+
Sbjct: 124 LDSGMHRLGFD-PAALRAWHARLRNHPGVRELNLISHFACADERNHPLTEQQVECFLGLL 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
                 + SLA+S+ +L  P  H    RPGI LYG T   + S     ++  ++  AR+I
Sbjct: 183 D-LDFDQRSLANSAAVLTIPAAHMDWLRPGIMLYGATPFADLSAAELGLKPAMSLTARLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+  AGE V YG      R + I   + GYADGYP         ++P+   G    + 
Sbjct: 242 SVREVAAGESVGYGAGWVAERPTRIGTVSCGYADGYP--------RNAPA---GTPVLVG 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G    + G+++MDM   D+     + VGD ++++G  + +D+VA A G+  Y+LL ++  
Sbjct: 291 GRRTRLAGRVSMDMLTVDLGGLPDVRVGDPVELWGAQLAVDEVACACGSIGYELLSKVTA 350

Query: 364 RYAKFYT 370
           R  + Y 
Sbjct: 351 RVPRRYA 357


>gi|296126374|ref|YP_003633626.1| alanine racemase [Brachyspira murdochii DSM 12563]
 gi|296018190|gb|ADG71427.1| alanine racemase [Brachyspira murdochii DSM 12563]
          Length = 369

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 115/371 (30%), Positives = 190/371 (51%), Gaps = 23/371 (6%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           ++DL+ LKNN   +++++   +   +VK NAYG G  +I+ A    G     V +VEEG+
Sbjct: 8   EVDLSILKNNIEIIHSIANGVKLLNIVKANAYGHGLVEISQASEQFGADALGVATVEEGI 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSK-LMSCGVSHPYALQV 128
           K+R    +  I VL+     + +++   +LIP+IS+   L +Y + L   G S    ++V
Sbjct: 68  KIRESGVKLPIIVLFQHFKQEAELVCRYDLIPIISNDECLEYYDRYLKKYGGSLKLYIKV 127

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACA---DDPSSHVNSVQLERFRTL 185
           DTG NR+G   ++ LD      +     +  I +H A A   DD S      Q++ F  +
Sbjct: 128 DTGLNRMGARAEDVLDLAKKVLSYSTLSIEGINTHYAAADMQDDYSREFTQRQIDIFNNV 187

Query: 186 ISHYK--GI---EASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEA 240
           I+  K  GI       A+S+ +L   N +F + R GI LYG T        ++ ++  ++
Sbjct: 188 ITTLKSNGIVINNVHTANSAALLSYKNTYFDMVRAGIILYGYTYDEAYDLGIKPILNLKS 247

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
           +++LIRK   GE +SYG   +  RD+ IAV  IGYADG    LS     ++  V + GK 
Sbjct: 248 KVVLIRKIKKGESISYGMTWRADRDTNIAVVPIGYADGVSRKLS-----NNWEVKINGKY 302

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALAS--GTTNYDLL 358
           +      P+ G++ MD  + +I +   I+  D + IFG D +L+   LA    + ++++L
Sbjct: 303 Y------PLRGRVCMDSIIIEIGND-DIKTEDDVLIFGNDKRLNANTLAKRIDSISHEVL 355

Query: 359 VRIGTRYAKFY 369
           V IG R  + Y
Sbjct: 356 VNIGDRVTRVY 366


>gi|209522716|ref|ZP_03271274.1| alanine racemase [Arthrospira maxima CS-328]
 gi|209496765|gb|EDZ97062.1| alanine racemase [Arthrospira maxima CS-328]
          Length = 399

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 120/380 (31%), Positives = 177/380 (46%), Gaps = 31/380 (8%)

Query: 9   LKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           +++D  A+ NN   + + LS   R  AV+K +AYG G   +A  +   GV DF V ++ E
Sbjct: 28  VEVDRWAIANNVKQIRHLLSPETRLMAVIKADAYGHGAVSVAKIVSEIGVDDFAVATIPE 87

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQ-LTFYSKLMSCGVSHPYA 125
           G++LR    Q  I VL  +H   E K I    L P + +  Q L F   L S   S P  
Sbjct: 88  GIELRRLGIQQPILVLGAVHTSDEIKAIAHWGLQPTLCTPTQALLFSETLQSIKRSLPVQ 147

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           L +DTG +RLG   ++AL+F          ++S I SH A AD     +   Q  RF+ +
Sbjct: 148 LNIDTGMSRLGTWWEQALEFVQLVRGLPNLEISGIYSHFATADIRDRTIMDQQHWRFQQV 207

Query: 186 ISHYKGIEA-----------SLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPM 232
           ++  +                LA+S+  L  P  H+ + R G+SLYG      +     +
Sbjct: 208 LAQIQEHTTLFSIPTVKPCLHLANSAATLTDPALHYDMVRVGLSLYGLYPAPHLRSVVNL 267

Query: 233 QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP 292
           Q  ++  AR+  I+   AG  VSYG +    + + IAV  IGYADG P  LS        
Sbjct: 268 QPAMSIRARVTQIKTIEAGCGVSYGYKFIAKQKTPIAVVGIGYADGVPRHLSN------- 320

Query: 293 SVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVAL 348
                 K  I+G  VP +G ITMD  M D+T    ++VG+ + + G D    I  DD A 
Sbjct: 321 ----QMKVLIRGQFVPQIGAITMDQLMLDVTAIPDLQVGEVVTLLGSDRHHSISADDWAE 376

Query: 349 ASGTTNYDLLVRIGTRYAKF 368
             GT ++++L     R  + 
Sbjct: 377 QLGTISWEILCGFKHRLPRI 396


>gi|54310410|ref|YP_131430.1| alanine racemase [Photobacterium profundum SS9]
 gi|123614432|sp|Q3V7I5|ALR_PHOPR RecName: Full=Alanine racemase
 gi|46914851|emb|CAG21628.1| putative alanine racemase, biosynthetic [Photobacterium profundum
           SS9]
          Length = 359

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 115/368 (31%), Positives = 186/368 (50%), Gaps = 26/368 (7%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL +N   ++  + N++  AVVK N YG G   +A +L +A    F V  +EE + 
Sbjct: 8   INTDALTHNIRQLHLQAPNSKLLAVVKANGYGHGLLHVAKSLPDADA--FGVARIEEALT 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +   +  +I   N+  V+ S+ QL     L S  + +     L+
Sbjct: 66  LRAGGVVKPILLLEGFYGASDLPVIVTNNIHTVVHSIEQL---EALESAELDNQAVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++  D          + +    +SH  CADD +S+V + Q+  F +L 
Sbjct: 123 IDTGMHRLGVRPEQLDDVVQRLHACDNVAKPLRYMSHFGCADDLASNVTNQQINTFLSLT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT-----DKINKSHPMQTVVTAEAR 241
              +G E SLA+S+GIL  P+   +  RPGI +YG +     D+  ++  MQ V+T  + 
Sbjct: 183 EGCRG-ERSLAASAGILAWPDSQLEWIRPGIIMYGVSPFTEPDRSAEAFNMQPVMTLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    GE V YGG     RD+ + V AIGY DGYP T        +P+   G    
Sbjct: 242 LIAVRDVKEGEQVGYGGIWTSERDTKVGVIAIGYGDGYPRT--------APN---GTPVL 290

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           + G +VP+ G+++MDM   D+  +   +VGD   ++G  +  + VA   GT  Y+L+ ++
Sbjct: 291 VNGRIVPMAGRVSMDMLTVDLGPNAQDKVGDEAILWGNGLPAEVVAEHIGTIAYELVTKL 350

Query: 362 GTRYAKFY 369
            +R    Y
Sbjct: 351 TSRVDMTY 358


>gi|75906615|ref|YP_320911.1| alanine racemase [Anabaena variabilis ATCC 29413]
 gi|75700340|gb|ABA20016.1| alanine racemase [Anabaena variabilis ATCC 29413]
          Length = 395

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 116/378 (30%), Positives = 178/378 (47%), Gaps = 33/378 (8%)

Query: 9   LKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           ++IDL AL +N   +   LS   +  AVVK +AYG G   +A     AG     V +V E
Sbjct: 28  VEIDLEALSHNVQQLKQFLSPRTQLMAVVKADAYGHGAVTVAQTALQAGASCLGVATVPE 87

Query: 68  GVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH---- 122
           G++LR    QA I +L   H P Q + I    L P I S  Q   +S  +   + H    
Sbjct: 88  GIQLREAGMQAPILILGATHTPEQIQAIAQWQLQPTIGSPKQALIFSNTLET-IQHDSPV 146

Query: 123 PYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL--IISHLACADDPSSHVNSVQLE 180
           P  +++DTG +RLG + Q+A +F      ++L  L++  + SHLA AD P   +   Q  
Sbjct: 147 PVHIKLDTGMSRLGTNWQQAGEFVQ--LVERLPHLNIASVYSHLATADSPDPGIMEEQYR 204

Query: 181 RFRTLISHYKGIEAS-----LASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQ 233
           RF   I+  K +        LA+S+  L  P  H+ + R G+++YG      + K   ++
Sbjct: 205 RFEEAIAQIKALSIKIPCLHLANSAATLADPRLHYDMVRVGLAVYGLYPAPHLQKKISLK 264

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+  +AR+  ++   AG  VSYG Q     +  +AV  IGYADG P  LS         
Sbjct: 265 PVIQVQARVTHVKTIAAGTGVSYGHQFIAPHEMRLAVVGIGYADGIPRNLSN-------- 316

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALA 349
                +  I+G  VP +G ITMD  M D++    ++ G+ + + G      I  DD A  
Sbjct: 317 ---KMQVLIRGQRVPQIGAITMDQLMIDVSALPDLQEGEIVTLLGKQGKEKITADDWAEE 373

Query: 350 SGTTNYDLLVRIGTRYAK 367
             T ++++L     R  +
Sbjct: 374 LNTISWEILCGFKHRLPR 391


>gi|301170339|emb|CBW29945.1| alanine racemase 1, PLP-binding, biosynthetic [Haemophilus
           influenzae 10810]
          Length = 360

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 119/368 (32%), Positives = 183/368 (49%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L  + V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTLEQS-VDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I   N I  V+ +  QL     L    +  P    L
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQL---DALKRANLPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E +D+ +    K+L Q+      +SH + AD+  S    +Q+ RF 
Sbjct: 125 KIDTGMHRLGVALDE-VDYFYQEL-KELPQIQPHLGFVSHFSRADELESDYTQLQINRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
           +     +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + 
Sbjct: 183 SATKDKQG-ERTIAASGGILFWPESHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    G+ V YGG     RD+ I V A+GY DGYP      D      V+L G+  
Sbjct: 242 LIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPR-----DVPEGTPVYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++
Sbjct: 295 ----LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|157145451|ref|YP_001452770.1| alanine racemase [Citrobacter koseri ATCC BAA-895]
 gi|157082656|gb|ABV12334.1| hypothetical protein CKO_01194 [Citrobacter koseri ATCC BAA-895]
          Length = 356

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 121/369 (32%), Positives = 188/369 (50%), Gaps = 42/369 (11%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSVEEGV 69
           +DL A+K N   +   + +AR  +VVK NAYG G E+I  AL   G  D F + ++EE +
Sbjct: 9   LDLQAMKQNLGIVRQAAPDARVWSVVKANAYGHGIERIWTAL---GATDGFAMLNLEEAI 65

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR    +  I +L G     E  I+DT  L   I S  QL     L +  ++ P    L
Sbjct: 66  TLRERGWKGPILMLEGFFHADELAIYDTYRLTTCIHSNWQLKV---LQNARLNAPLDVYL 122

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNK--KLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           +V++G NRLG  L E +            +G+++L+ SH A A+ P        +++  T
Sbjct: 123 KVNSGMNRLGF-LPERVQTVWQQLRALPNVGEMTLM-SHFADAEHPEG------IDQAMT 174

Query: 185 LISHY-KGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQTV 235
            I+H  +G+E   SL++S+  L  P  HF   RPGI LYG +      D  N    ++ V
Sbjct: 175 KIAHATEGLECRRSLSNSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTG--LKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  ++II ++   AG+ V YGG+   T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSQIIGVQTLKAGDRVGYGGRYTATQEQRIGIVAAGYADGYP--------RHAPN-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGVRTGTVGTVSMDMLAVDLTPCPQAGIGTSVELWGKEIKIDDVASAAGTVGY 341

Query: 356 DLLVRIGTR 364
           +L+  +  R
Sbjct: 342 ELMCALAPR 350


>gi|288941546|ref|YP_003443786.1| alanine racemase [Allochromatium vinosum DSM 180]
 gi|288896918|gb|ADC62754.1| alanine racemase [Allochromatium vinosum DSM 180]
          Length = 367

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 115/382 (30%), Positives = 185/382 (48%), Gaps = 34/382 (8%)

Query: 2   HSNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFF 61
            S   LR +I L A+++N+    +L+  +R  AVVK NAYG G   +A  L +     F 
Sbjct: 3   RSARPLRARIHLDAIRHNYRRAKSLAPRSRALAVVKANAYGHGAIAVARTLADE-ADGFA 61

Query: 62  VTSVEEGVKLRLYTPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFY-----SKL 115
           V  VEE ++LR    Q  + +L G+  P +  ++    L  V+    QL +      S+ 
Sbjct: 62  VACVEEALELRESGIQEPMLLLEGVFSPDEIALVERAGLAMVVHCREQLDWVLNAHPSRR 121

Query: 116 MSCGVSHPYALQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHV 174
           + C +      ++DTG +R+G SL E  +     +    +G+  + ++H A AD+     
Sbjct: 122 LDCWI------KLDTGMHRVGFSLSEFAEVNARLAACPHVGE-RVAMTHFARADEIDHPY 174

Query: 175 NSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG-------GTDKIN 227
            S Q+E F   ++  + I  SLA+S+ +   P  H   TRPGI LYG       G++   
Sbjct: 175 TSAQIEAFEQALNGAR-IGRSLANSAAVFAWPQAHGDWTRPGIMLYGVSPFAGTGSNANM 233

Query: 228 KSHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLD 287
            +  ++  +T E+ +I +R   AGE V YGG+    R + + VAAIGYADGYP       
Sbjct: 234 DAGDLRPAMTLESALIAVRDLDAGEPVGYGGRFVCERPTRVGVAAIGYADGYP-----RH 288

Query: 288 SEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVA 347
           +     + +GG+      +  ++G+++MDM   D+T       GD ++++G  +    VA
Sbjct: 289 ARDGTPIAVGGR------LTRLIGRVSMDMITLDLTGFDEARPGDPVELWGRTVPAGAVA 342

Query: 348 LASGTTNYDLLVRIGTRYAKFY 369
            AS T  Y L   IG R    Y
Sbjct: 343 EASDTIAYQLFTGIGRRVPLMY 364


>gi|262275138|ref|ZP_06052949.1| alanine racemase biosynthetic [Grimontia hollisae CIP 101886]
 gi|262221701|gb|EEY73015.1| alanine racemase biosynthetic [Grimontia hollisae CIP 101886]
          Length = 358

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 109/364 (29%), Positives = 176/364 (48%), Gaps = 19/364 (5%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I + AL +N   + A++ N+RT A +K N YG G   +A AL +     F V  +EE V 
Sbjct: 8   IHMAALNHNIEIIRAMAPNSRTWAAIKANGYGHGLLPVAKAL-STQTDGFGVARLEEAVS 66

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR    +  I +L G     +    +  NL   +  + QL    K       H + L++D
Sbjct: 67  LRKGGIENPILLLEGFFSWADLPALEAHNLQTAVHCIEQLEALEKATLRQPLHVW-LKID 125

Query: 130 TGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           TG +RLG+  +   +F    + +  + +    +SH  CAD+    V   Q+  F  L   
Sbjct: 126 TGMHRLGVRPEHVSEFIERLNASPNVAKPLNFMSHFGCADELDKPVTPQQIALFNELTVS 185

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQTVVTAEARIILI 245
             G + SLA+SSG L+ P+ HF   RPGISLYG +    +  +   ++  +T  + +I +
Sbjct: 186 QPGYK-SLAASSGSLMWPDSHFDFVRPGISLYGISPVAARCGQDFGLKPAMTMTSSLIAV 244

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+   GE V Y G+    RD+ + V AIGY DGYP          +P    G    + G 
Sbjct: 245 REVKKGEAVGYSGRWVAERDTQLGVVAIGYGDGYPRV--------APD---GTPVLVNGR 293

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
            VP+ G+++MDM   D+    +  VGD + ++G  + ++++A   GT  Y+L+  + +R 
Sbjct: 294 RVPLAGRVSMDMITVDLGPDSTDSVGDEVIMWGEGLPVEEIARHVGTIGYELVTNLTSRV 353

Query: 366 AKFY 369
              Y
Sbjct: 354 HIVY 357


>gi|37523387|ref|NP_926764.1| alanine racemase [Gloeobacter violaceus PCC 7421]
 gi|35214391|dbj|BAC91759.1| alanine racemase [Gloeobacter violaceus PCC 7421]
          Length = 381

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 173/364 (47%), Gaps = 26/364 (7%)

Query: 9   LKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           ++IDL AL++N   +   L  + R  AVVK +AYG G      A   AG     V ++EE
Sbjct: 12  VEIDLDALRHNVQQIRQRLRSHCRVMAVVKADAYGHGALSAGRAALEAGAACLGVATLEE 71

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
           G +LR       I VL  IH G E   +    L P + +  Q+   ++ +S    HP  L
Sbjct: 72  GAQLRESGLGCPIVVLGPIHTGAEVAAVEHWRLEPTLCTPRQVLVCAEHLS--APHPVHL 129

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           ++DTG  RLG   Q+A++F   ++     Q++ + SHLA AD+P S     Q  RF  ++
Sbjct: 130 KIDTGMTRLGAPWQDAVEFVRLAYRLPRLQVASVYSHLATADEPDSAALGEQHRRFERVL 189

Query: 187 SHYK--GIEAS---LASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAE 239
              +  G+      LA+S+  L  P  H+ L R G++LYG     +   +  ++ V+   
Sbjct: 190 GELEAAGVRPECVHLANSAAALGDPGLHYDLVRVGVALYGLYPAPEFYGAAELRPVMQVR 249

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           AR+  +R+  A   VSYG   +    S +A  AIGYADG P  LSG             +
Sbjct: 250 ARVTQVREVPADTGVSYGHFWRTPTPSRLATVAIGYADGVPRRLSGQL-----------Q 298

Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALASGTTNY 355
             + G   P +G ITMD  + D T   ++E GD + + G D    I   D A   GT  Y
Sbjct: 299 VLVHGRRAPQVGAITMDQIVIDCTHLSAVEEGDVVTLLGRDGNEAIGAADWADPLGTIAY 358

Query: 356 DLLV 359
           ++L 
Sbjct: 359 EILC 362


>gi|332304651|ref|YP_004432502.1| alanine racemase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332171980|gb|AEE21234.1| alanine racemase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 375

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/383 (29%), Positives = 189/383 (49%), Gaps = 35/383 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGN----------ARTAAVVKDNAYGLGCEKIAPALYNAG 56
           + + +DL A+++N++   +L             ++T AV+K +AYG G    A AL +  
Sbjct: 5   ISITVDLNAIRHNFNYAQSLGAKPKNGDSLDNVSQTMAVIKADAYGHGAVATARAL-DGK 63

Query: 57  VQDFFVTSVEEGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKL 115
                V+S+EE V LR    +  I +L G     E  ++ D NL  V+ +  Q+    +L
Sbjct: 64  ATLLAVSSIEEAVSLRQNHIKTPILLLEGCFCSSELSVLDDLNLQVVLHNQHQI---EEL 120

Query: 116 MSCGVSHP--YALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSH 173
           ++  +  P    L++DTG +RLG+S  +A        N K  +  ++++H A +D P+  
Sbjct: 121 LNTSLDEPADVWLKIDTGMHRLGISAADANHTYQTLANSKNVRSIVLMTHFAMSDQPNHT 180

Query: 174 VNSVQLERFRTLISHYKG----IEASLASSSGILLGPNYHFQLTRPGISLYGGT--DKIN 227
               Q E F  L+         I  S A+S+ ++  P  H    RPGI LYG +  D  N
Sbjct: 181 FFKRQHEDFHNLVKALSTTDQLIPNSAANSAAVMSAPESHGTWNRPGIMLYGISPFDHEN 240

Query: 228 K-SHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGL 286
             S P+   +   ++II +R+  AGE V YG     T+ S+IA  A GY DGYP T    
Sbjct: 241 TFSAPLIPAMQFHSKIIALRQVNAGESVGYGATWTATQPSIIATVAAGYGDGYPRTAKS- 299

Query: 287 DSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDV 346
                     G    I G + P+ G+++MDM   D+T    +++GD ++++G ++ +++V
Sbjct: 300 ----------GTPVMINGQIAPLAGRVSMDMLCVDVTKLNKVKIGDDVELWGKELSVNEV 349

Query: 347 ALASGTTNYDLLVRIGTRYAKFY 369
           A  + T  Y+L+ R+ TR  + +
Sbjct: 350 AQWADTLGYELVTRMPTRAKRIF 372


>gi|116053079|ref|YP_793398.1| biosynthetic alanine racemase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115588300|gb|ABJ14315.1| biosynthetic alanine racemase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 358

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 179/367 (48%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL+A+++N+      +   +  AVVK NAYG G  ++  AL++     F V  +EE  +
Sbjct: 8   VDLSAIRHNYALAKRCAPQRQAFAVVKANAYGHGAREVVTALHD-DADGFAVACLEEAAE 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY--ALQ 127
           +R     ARI +L G     E  +     L  VI    Q   +   ++ G+  P    L+
Sbjct: 67  VRALHASARILLLEGCFEASEYALAGQLRLDLVIQGAEQGEAF---LAAGLDIPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG     AL   H       G   L +ISH ACAD+ +  +   QLE F  L+
Sbjct: 124 LDSGMHRLGFD-PVALRAWHARLRNHPGVRELNLISHFACADERNHPLTEQQLESFLGLL 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
                 + SLA+S+ +L  P  H    RPGI LYG T   + S     ++  ++  A++I
Sbjct: 183 D-LDFDQRSLANSAAVLTIPAAHMDWLRPGIMLYGSTPLADLSAAELGLRPAMSLGAQLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YG      R + I   + GYADGYP T        +P+   G    + 
Sbjct: 242 SLREVAVGESVGYGATWIAERPARIGTVSCGYADGYPRT--------APA---GTPVLVG 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G    + G+++MDM   D++D     VGD ++++G  + +D+VA A GT  Y+LL ++  
Sbjct: 291 GRRATLAGRVSMDMLAVDLSDLPEARVGDPVELWGAGLSVDEVARACGTLGYELLSKVTA 350

Query: 364 RYAKFYT 370
           R  + Y+
Sbjct: 351 RVPRRYS 357


>gi|109900323|ref|YP_663578.1| alanine racemase [Pseudoalteromonas atlantica T6c]
 gi|122971491|sp|Q15NL4|ALR_PSEA6 RecName: Full=Alanine racemase
 gi|109702604|gb|ABG42524.1| alanine racemase [Pseudoalteromonas atlantica T6c]
          Length = 375

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 119/387 (30%), Positives = 192/387 (49%), Gaps = 43/387 (11%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNA----------RTAAVVKDNAYGLGCEKIAPALYNAG 56
           + + +DL A++ N+   NAL  NA           T AV+K +AYG G    A AL N  
Sbjct: 5   ISITVDLDAIRQNFAYANALGVNALESSINDRQSNTLAVIKADAYGHGAVATARAL-NGQ 63

Query: 57  VQDFFVTSVEEGVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKL 115
                V+S+EE V LR +  +  I +L G   P +  ++ + NL  VI +  Q+     L
Sbjct: 64  AALLAVSSIEEAVSLRQHHIKTPILLLEGCFCPSELSVVNELNLQIVIHNQKQI---EDL 120

Query: 116 MSCGVSHPYA--LQVDTGFNRLGLSLQEALD-FTHNSFNKKLGQLSLIISHLACADDPS- 171
           ++  ++ P    L+VDTG +RLG+ + +AL  +T  + +K +  + ++++H A +D P  
Sbjct: 121 LAQVLTKPIKVWLKVDTGMHRLGIPVSDALKAYTQLASSKNVCSV-MLMTHFATSDHPDH 179

Query: 172 ----SHVNSVQ-LERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKI 226
               S + S+Q L    +    Y G   SLA+S+ +L  P       RPGI LYG     
Sbjct: 180 PLLLSQIQSIQKLAEKVSAEPSYAG--CSLANSAALLATPKSISTWNRPGIMLYG-ISPF 236

Query: 227 NKSH----PMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLT 282
           N+S     P+   +T  +++I +R+   GE V YG      R S+IA  A GY DGYP T
Sbjct: 237 NQSDINVLPLIPAMTFSSKVIALRRVATGESVGYGAIWTAKRPSIIATVAAGYGDGYPRT 296

Query: 283 LSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIK 342
                         G    + G + P+ G+++MDM   D+T    I  G  ++++G +I 
Sbjct: 297 AKS-----------GTPVMVNGQIAPLAGRVSMDMLCVDVTQLTDISEGSPVELWGKNIP 345

Query: 343 LDDVALASGTTNYDLLVRIGTRYAKFY 369
           ++DVA  + T  Y+L+ R+ TR  + +
Sbjct: 346 VNDVAAWADTLGYELVTRMPTRAKRVF 372


>gi|145641722|ref|ZP_01797298.1| alanine racemase [Haemophilus influenzae R3021]
 gi|145273536|gb|EDK13406.1| alanine racemase [Haemophilus influenzae 22.4-21]
          Length = 360

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 119/366 (32%), Positives = 185/366 (50%), Gaps = 22/366 (6%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L    V  F V  +EE +
Sbjct: 9   KISSHALKKNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTL-EQNVDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYALQV 128
            LR       I +L G    Q+  I   N I  V+ +  QL    +     +   + L++
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQLDALKRANLPSLIKVW-LKI 126

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFRTL 185
           DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF + 
Sbjct: 127 DTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQINRFLSA 184

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEARII 243
               +G E ++A+S GIL  P  H +  RPGI +YG   TD I K   +  V+   + +I
Sbjct: 185 TKDKQG-ERTIAASGGILFWPESHLECIRPGIIMYGISPTDTIGKEFGLTPVMNLTSSLI 243

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R    G+ V YGG     RD+ I V A+GY DGYP  +     E +P V+L G+    
Sbjct: 244 AVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPSNVP----EGTP-VYLNGR---- 294

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
             +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++  
Sbjct: 295 --LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKLTP 352

Query: 364 RYAKFY 369
           R    Y
Sbjct: 353 RVITEY 358


>gi|238789907|ref|ZP_04633687.1| Alanine racemase 1 [Yersinia frederiksenii ATCC 33641]
 gi|238721980|gb|EEQ13640.1| Alanine racemase 1 [Yersinia frederiksenii ATCC 33641]
          Length = 359

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 117/366 (31%), Positives = 187/366 (51%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +  ++  +R  AVVK NAYG G  + A  L +A    + V  + E + 
Sbjct: 8   IDRRALRHNLQQVRRMAPQSRLIAVVKANAYGHGLLETAHTLQDADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHP--YALQ 127
           LR       I +L G    ++  I   N I   + S+ QL     L +  +S P    ++
Sbjct: 66  LRSGGIVKPILLLEGFFTAEDLPILVANRIETAVHSIEQL---EALEAATLSAPINVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++A  F    S  + + Q   I+SH + AD+P       QL+ F T  
Sbjct: 123 LDTGMHRLGVRPEQAEAFYQRLSACRNVIQPVNIMSHFSRADEPKVETTRQQLDCFDTFA 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT--DKINKSH-PMQTVVTAEARII 243
               G + S+A+S GILL P  H    RPGI LYG +  D+   SH  +   +  ++ +I
Sbjct: 183 KDKPG-KQSIAASGGILLWPEAHRDWVRPGIILYGVSPMDEPYGSHFNLLPAMELKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+  AGE V YGG     RD+ + V AIGY DGYP +        +PS   G   +I 
Sbjct: 242 AVREHKAGEPVGYGGTWVSKRDTRLGVVAIGYGDGYPRS--------APS---GTPMWIN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  V I+G+++MDM   D+    + +VGD + ++G ++ ++ +A  +G + Y+L+ ++ +
Sbjct: 291 GREVGIVGRVSMDMISVDLGPDATDKVGDEVLLWGAELPVEKIAARTGISAYELITKLTS 350

Query: 364 RYAKFY 369
           R A  Y
Sbjct: 351 RVAMEY 356


>gi|148826764|ref|YP_001291517.1| alanine racemase [Haemophilus influenzae PittGG]
 gi|148718006|gb|ABQ99133.1| alanine racemase [Haemophilus influenzae PittGG]
          Length = 360

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 119/368 (32%), Positives = 182/368 (49%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK N   +   + N++  AVVK NAYG G   +A  L    V  F V  +EE +
Sbjct: 9   KISSHALKQNLEIIKQKAPNSKIIAVVKANAYGHGVVFVASTL-EQNVDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    Q+  I   N I  V+ +  QL     L    +  P    L
Sbjct: 68  ALRSNGITKPILLLEGFFNEQDLPILAVNNIETVVHNHEQL---EALKRSNLPSPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL---IISHLACADDPSSHVNSVQLERFR 183
           ++DTG +RLG++L E +D+ +    KKL Q+      +SH + AD+  S    +Q+ RF 
Sbjct: 125 KIDTGMHRLGVALDE-VDYFYQEL-KKLPQIQPHLGFVSHFSRADELESDYTQLQINRFL 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEAR 241
           +     +G E ++A+S GIL  P  H +  RPGI +YG   T+ I K   +  V+   + 
Sbjct: 183 SATKDKQG-ERTIAASGGILFWPKSHLECIRPGIIMYGISPTNTIGKEFGLTPVMNLTSS 241

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +R    G+ V YGG     RD+ I V A+GY DGYP      D      V+L G+  
Sbjct: 242 LIAVRHHKQGDPVGYGGIWTSPRDTKIGVVAMGYGDGYPR-----DVPEGTPVYLNGR-- 294

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
               +VPI+G+++MDM   D+       VGD + ++G ++ ++ VA  +G  +Y+L+ ++
Sbjct: 295 ----LVPIVGRVSMDMLTVDLGADSQDLVGDEVILWGKELPIETVAKFTGILSYELITKL 350

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 351 TPRVITEY 358


>gi|261341531|ref|ZP_05969389.1| alanine racemase [Enterobacter cancerogenus ATCC 35316]
 gi|288316330|gb|EFC55268.1| alanine racemase [Enterobacter cancerogenus ATCC 35316]
          Length = 359

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 115/367 (31%), Positives = 180/367 (49%), Gaps = 25/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +   I + +L   + +  QL     L +  +S P    ++
Sbjct: 66  LRAGGITQPILLLEGFFEAADLPTIAEQHLHTSVHNEEQLV---ALETAELSEPVTVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHNSFN-KKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++A  F       K + Q   I+SH A AD+P       QL+ F T  
Sbjct: 123 LDTGMHRLGVRPEDAETFYQRLCQCKNVRQPVNIVSHFARADEPECGATEQQLDIFNTFC 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP----MQTVVTAEARI 242
               G   S+A+S GILL P  HF   RPGI LYG +   +K        Q V++  + +
Sbjct: 183 EGKPGAR-SIAASGGILLWPQSHFDWARPGIILYGVSPLEHKPWGPDFGFQPVMSLVSNL 241

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I +R+  AGE V YGG     RD+ + V A+GY DGYP          +PS   G    +
Sbjct: 242 IAVREHKAGEPVGYGGTWTSERDTRLGVVAMGYGDGYPRA--------APS---GTPVLV 290

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  V ++G++ MDM   D+      + GD + ++G  + ++ +A  +G + Y+L+ R+ 
Sbjct: 291 NGREVKLVGRVAMDMICVDLGPDAQDKAGDDVVMWGEGLPVERIAEMTGVSAYELITRLT 350

Query: 363 TRYAKFY 369
           +R A  Y
Sbjct: 351 SRVAMKY 357


>gi|145298771|ref|YP_001141612.1| alanine racemase [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142851543|gb|ABO89864.1| alanine racemase [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 367

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/361 (31%), Positives = 179/361 (49%), Gaps = 24/361 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID+ AL +N+  +   + +++  AV+K NAYG G  ++A  L  A    + V  +EE + 
Sbjct: 8   IDVDALHHNFAVVRRHAPHSKIIAVLKANAYGHGLLQVANTLSQADA--YGVARIEEALV 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I VL G    +   ++   +L   I +  QL     L    +  P    L+
Sbjct: 66  LRANAITKPILVLGGFFSAEALPLLAAHDLQTTIHTWDQLAL---LEQADLPTPITVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHNSFN-KKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG NRLGL  Q+   F     N K + Q   +++H + +D+  S     Q+E F  L 
Sbjct: 123 LDTGMNRLGLRAQDIPAFVERLANCKNVVQPFHLMTHFSQSDEQDSQATPQQIEEFNALT 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQTVVTAEARII 243
           +  +G E ++A+S+GIL  P+      RPGI LYG +    ++   H ++ V+T ++++I
Sbjct: 183 ARMQG-ERAMANSAGILAWPDSRSDWIRPGIMLYGASPFGGQLASDHDLRPVMTLKSQLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            IR    GE V YGG      D+ + V A+GY DGYP          +P    G    I 
Sbjct: 242 AIRPCEQGESVGYGGHWVAHHDTTLGVVAVGYGDGYP--------RMAPQ---GTPVLIN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI+G+++MDM   D+      + GD + ++G  + ++ VA   GT  Y+LL R+ +
Sbjct: 291 GRRVPIVGRVSMDMITVDLGPGAGDKTGDEVILWGDGLPVEQVAEKIGTIPYELLTRLTS 350

Query: 364 R 364
           R
Sbjct: 351 R 351


>gi|260767143|ref|ZP_05876087.1| alanine racemase biosynthetic [Vibrio furnissii CIP 102972]
 gi|260617864|gb|EEX43039.1| alanine racemase biosynthetic [Vibrio furnissii CIP 102972]
 gi|315181333|gb|ADT88247.1| alanine racemase, biosynthetic [Vibrio furnissii NCTC 11218]
          Length = 364

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 113/370 (30%), Positives = 183/370 (49%), Gaps = 32/370 (8%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+L AL++N   +   + N++  AVVK N YG G   +A   +  G   F V  +EE ++
Sbjct: 11  INLDALRHNLQQIKQQAPNSKLMAVVKANGYGHGLRHVAK--HAVGADAFGVARIEEALQ 68

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +  G   ++   N+  V+    QL     L S  +  P    L+
Sbjct: 69  LRASGVVKPILLLEGFYSQGDLPVLVTNNIQTVLHCEEQL---QALESAELETPVVVWLK 125

Query: 128 VDTGFNRLGLSLQEALDFTH-----NSFNKKLGQLSLIISHLACADDPSSHVNSVQLERF 182
           +D+G +RLG+  ++   F       N+  K L      +SH  CAD+      + Q+E F
Sbjct: 126 IDSGMHRLGVRPEQYAQFVARLQACNNVAKPL----RYMSHFGCADELDKSTTTEQIELF 181

Query: 183 RTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAE 239
            +L +  +G E S+A+S+G+L  P    +  RPGI +YG +   +K  +    Q V+T +
Sbjct: 182 LSLTNGCEG-ERSMAASAGLLAWPQSQMEWVRPGIIMYGVSPFAEKNAQQLGYQPVMTLK 240

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           + +I +R   AGE V YG      RD+ I V AIGY DGYP T        +P+   G  
Sbjct: 241 SHLIAVRDVKAGESVGYGATWVSERDTKIGVIAIGYGDGYPRT--------APN---GTP 289

Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
             + G +VP+ G+++MDM   D+       VGD   ++G ++ +++VA   GT  Y+L+ 
Sbjct: 290 VVVNGRVVPLAGRVSMDMLTVDLGPDARDNVGDEAILWGSELPVEEVASHIGTLGYELVT 349

Query: 360 RIGTRYAKFY 369
           ++ +R    Y
Sbjct: 350 KLTSRVDMSY 359


>gi|312881940|ref|ZP_07741697.1| alanine racemase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309370376|gb|EFP97871.1| alanine racemase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 360

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 109/366 (29%), Positives = 181/366 (49%), Gaps = 22/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL ALK+N   +   + N++  AVVK N+YG G   +A   + +    F V  +EE ++
Sbjct: 8   IDLEALKHNLGRVKQQAPNSKVMAVVKANSYGHGLHYVAQ--HASAADAFGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQV 128
           LR       I +L G +  ++  +  TN I  +    +  +   L    + +P    L++
Sbjct: 66  LRASGVVKPILLLEGFYSSRDLPVLVTNSIHTVVHCEEQLY--DLEKASLENPVVVWLKI 123

Query: 129 DTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLIS 187
           D+G +RLG+  +    F       K + +    +SH  CAD+    +   Q+E F +L  
Sbjct: 124 DSGMHRLGVRPEHFEHFVERLEACKNVAKPLRYMSHFGCADELDKPITQKQIELFLSLTK 183

Query: 188 HYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARIIL 244
              G E SLA+S+G+L  P+   +  RPGI LYG +   NK+      + V+T ++ +I 
Sbjct: 184 GCLG-ERSLANSAGVLAWPDSQLEWVRPGIILYGVSPLPNKTATDLGFKPVMTLKSHLIA 242

Query: 245 IRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKG 304
           +R   +GE V YGG     RD+ + V AIGY DGYP          +P+   G    + G
Sbjct: 243 VRTVKSGESVGYGGNWTSDRDTKVGVIAIGYGDGYP--------RMAPN---GTPVLVNG 291

Query: 305 YMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTR 364
             VP+ G+++MDM   D+      +VGD   ++G  + +++VA   GT  Y+L+ ++ +R
Sbjct: 292 RKVPMAGRVSMDMLTVDLGPDAKDKVGDEAILWGNGLDVEEVAHHIGTIAYELVTKLTSR 351

Query: 365 YAKFYT 370
               Y+
Sbjct: 352 VDMEYS 357


>gi|212633597|ref|YP_002310122.1| alanine racemase [Shewanella piezotolerans WP3]
 gi|254802381|sp|B8CIQ9|ALR_SHEPW RecName: Full=Alanine racemase
 gi|212555081|gb|ACJ27535.1| Alanine racemase [Shewanella piezotolerans WP3]
          Length = 358

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 187/369 (50%), Gaps = 26/369 (7%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSV 65
           F R +I   ALK+N   ++ L+ +++  AVVK N YG G   +A  L NA    F +  +
Sbjct: 4   FPRAEISRKALKHNLARLHELAPSSKVMAVVKANGYGHGLLNVAQCLDNA--DGFGLARL 61

Query: 66  EEGVKLRLYTPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR     A++ +L G    G    + + ++  V+    QL     L S  ++ P 
Sbjct: 62  EEALALRTGGVTAKLLLLEGFFRIGDLTTLVEHDIETVVHHESQLEM---LESINLTKPV 118

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHNSF--NKKLGQLSLIISHLACADDPSSHVNSVQLE 180
              L+VD+G +RLG S  +  D T+     N  + +   +++H ACAD+PS+   + Q  
Sbjct: 119 TVWLKVDSGMHRLGFSPAQ-FDATYQRLMANDNVAKPIHLMTHFACADEPSNPSTAEQQR 177

Query: 181 RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQTVVT 237
            F TLI    G + +LA+S+G L          RPGI+LYG +     +   H +   + 
Sbjct: 178 VFDTLIKGLPG-DRTLANSAGALFWQQSQADWIRPGIALYGVSPVFGDLGAKHGLMPAMD 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             +++I IR+  AGE   YG      +D+ + V AIGY DGYP         ++P   LG
Sbjct: 237 LVSQLIAIREHKAGESAGYGSYWTAEKDTNLGVVAIGYGDGYP--------RNAP---LG 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G +VPI+G+++MDM   D+    + +VGD   ++G ++ +++VA   GT  Y+L
Sbjct: 286 TPVLVNGRIVPIVGRVSMDMLTVDLGIDANDKVGDLAVLWGKELPVEEVAEHIGTIAYEL 345

Query: 358 LVRIGTRYA 366
           + ++  R A
Sbjct: 346 VTKLTPRVA 354


>gi|220931017|ref|YP_002507925.1| alanine racemase [Halothermothrix orenii H 168]
 gi|254802366|sp|B8D0W1|ALR_HALOH RecName: Full=Alanine racemase
 gi|219992327|gb|ACL68930.1| alanine racemase [Halothermothrix orenii H 168]
          Length = 379

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 113/379 (29%), Positives = 183/379 (48%), Gaps = 36/379 (9%)

Query: 10  KIDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           +IDL+ L+ N++ +  + G N +  +VVK +AYG G   +A  L  AG Q   V   EEG
Sbjct: 12  EIDLSCLQFNFNQVKEILGSNVKIMSVVKADAYGHGVIPVAKTLVEAGTQRLAVAIPEEG 71

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSC-GVSHPYALQ 127
           V+LR       I VL  + P Q +++F  +LIP +         ++L +   V     ++
Sbjct: 72  VELREAGLSVPIQVLGEVLPSQYELLFKYDLIPTVGREETALSLNRLAAKYNVVKKVHIK 131

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI-----ISHLACADDPSSHVNSVQLERF 182
           VDTG  R+G+  +EA+ F      KK+  LS I     ++H A AD+        Q ++F
Sbjct: 132 VDTGMGRIGVRPREAVGFV-----KKVNSLSNIKIEGLMTHFASADERDKSYTYEQWDKF 186

Query: 183 RTLISHYKGIEASL-----ASSSGILLGPNYHFQLTRPGISLYG---GTDKINKSHPMQT 234
           + ++     +   +     ++S+ I+    +   + RPGI LYG     D IN    ++ 
Sbjct: 187 KQVLDGLNKLRIDIPIKHSSNSAAIIDFKKFGLDMVRPGIMLYGLKPSRDLINNID-LKP 245

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           V+T + RI+ +++   G  +SYG      R S IA   +GYADGYP  LS          
Sbjct: 246 VLTWKTRIVYLKEVPPGTGISYGTTYVTNRKSKIATLPVGYADGYPRILSN--------- 296

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALAS 350
              G+  ++G   PI G++ MD  M D+T+   + VGD + + G      I   D+A  +
Sbjct: 297 --QGQVLVRGRKAPIRGRVCMDQIMIDVTEIPDVRVGDEVVLIGEQGTQKISATDIAEKA 354

Query: 351 GTTNYDLLVRIGTRYAKFY 369
            T NY+++  I  R  + Y
Sbjct: 355 DTINYEIVCGISQRVPREY 373


>gi|296391770|ref|ZP_06881245.1| alanine racemase [Pseudomonas aeruginosa PAb1]
          Length = 358

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 113/367 (30%), Positives = 178/367 (48%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           +DL+A+++N+      +   +  AVVK NAYG G  ++  AL++     F V  +EE  +
Sbjct: 8   VDLSAIRHNYALAKRCAPQRQAFAVVKANAYGHGAREVVTALHD-DADGFAVACLEEAAE 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY--ALQ 127
           +R     ARI +L G     E  +     L  VI    Q   +   ++ G+  P    L+
Sbjct: 67  VRALHASARILLLEGCFEASEYALAGQLRLDLVIQGAEQGEAF---LAAGLDIPLNVWLK 123

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL-IISHLACADDPSSHVNSVQLERFRTLI 186
           +D+G +RLG     AL   H       G   L +ISH ACAD+ +      QLE F  L+
Sbjct: 124 LDSGMHRLGFD-PVALRAWHARLRNHPGVRELNLISHFACADERNHPFTEQQLESFLGLL 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
                 + SLA+S+ +L  P  H    RPGI LYG T   + S     ++  ++  A++I
Sbjct: 183 D-LDFDQRSLANSAAVLTIPAAHMDWLRPGIMLYGSTPLADLSAAELGLKPAMSLGAQLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+   GE V YG      R + I   + GYADGYP T        +P+   G    + 
Sbjct: 242 SLREVAVGESVGYGATWIAERPTRIGTVSCGYADGYPRT--------APA---GTPVLVG 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G    + G+++MDM   D++D     VGD ++++G  + +D+VA A GT  Y+LL ++  
Sbjct: 291 GRRATLAGRVSMDMLAVDLSDLPEARVGDPVELWGARLSVDEVARACGTLGYELLSKVTA 350

Query: 364 RYAKFYT 370
           R  + Y+
Sbjct: 351 RVPRRYS 357


>gi|170728531|ref|YP_001762557.1| alanine racemase [Shewanella woodyi ATCC 51908]
 gi|254802385|sp|B1KHY4|ALR_SHEWM RecName: Full=Alanine racemase
 gi|169813878|gb|ACA88462.1| alanine racemase [Shewanella woodyi ATCC 51908]
          Length = 358

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 109/368 (29%), Positives = 188/368 (51%), Gaps = 24/368 (6%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSV 65
           F R +I   ALKNN   +  ++ N+   AVVK N YG G   +A  L  A    F +  +
Sbjct: 4   FPRAEISAQALKNNLSRLRQIAPNSSVMAVVKANGYGHGLLNVASCLTEA--DGFGLARL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +A++ +L G     +   + +  +  VI +  QL     L +  +S P 
Sbjct: 62  EEALALRAGGVKAKLVLLEGFFRQVDLTTLVEHGIDTVIHNEVQLDM---LENASLSKPV 118

Query: 125 A--LQVDTGFNRLGLSLQE-ALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L++D+G +RLG + ++ A  +       ++ +   I+SH ACAD+P + +   QL+ 
Sbjct: 119 TVWLKLDSGMHRLGFTPEQFAQVYARLEACPQVAKPINIMSHFACADEPDNPMTQEQLQV 178

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKIN---KSHPMQTVVTA 238
           F  L  + KG   +LA+S+G L  P+      RPGI+LYG +  I    ++H ++  +  
Sbjct: 179 FEALTKNSKGYR-TLANSAGTLYWPDSQADWIRPGIALYGVSPVIGDLGRNHGLEPAMKL 237

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            +++I +R+  AG+ V YG       D+ + V AIGY DGYP         ++P    G 
Sbjct: 238 VSQLIAVREHKAGQPVGYGCFWHAKADTRLGVVAIGYGDGYP--------RNAPE---GT 286

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             ++ G  VP++G+++MDM   D+       +GD + ++G ++ +++VA   GT  Y+L+
Sbjct: 287 PVWVNGRRVPVVGRVSMDMLTVDLGIDAKDSIGDDVVLWGKELPVEEVAEHIGTIAYELV 346

Query: 359 VRIGTRYA 366
            ++  R A
Sbjct: 347 TKLTPRVA 354


>gi|156932325|ref|YP_001436241.1| alanine racemase [Cronobacter sakazakii ATCC BAA-894]
 gi|156530579|gb|ABU75405.1| hypothetical protein ESA_00100 [Cronobacter sakazakii ATCC BAA-894]
          Length = 359

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 114/374 (30%), Positives = 183/374 (48%), Gaps = 39/374 (10%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ++  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   VNRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVI------SSVPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         F+   +P I      ++V      + L    +S P 
Sbjct: 66  LREGGITQPILLLEGF--------FNAADLPAIAAQRFHTAVHSEEQLAALEQATLSEPV 117

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  + A  F    +  K + Q   ++SH A AD+P       QL+ 
Sbjct: 118 TVWMKLDTGMHRLGVRPEAAQAFYDRLAACKNVRQPVNVVSHFARADEPDCGATERQLDI 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM------QTV 235
           F +  +H K  + S+A+S GIL  P  HF   RPGI LYG +     +HP       Q  
Sbjct: 178 FNSF-THDKPGKRSIAASGGILFWPQSHFDWVRPGIILYGLSPL--DTHPWGAELGFQPA 234

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           ++  + +I +R   AGE V YGG     RD+ + V A+GY DGYP          +P+  
Sbjct: 235 MSLTSSLIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRC--------APT-- 284

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G  VPI+G++ MDM   D+    + + GD + ++G  + ++ +A A+G + Y
Sbjct: 285 -GTPVLVNGREVPIVGRVAMDMICVDLGPDAAEKAGDTVIMWGEALPVERIAEATGVSAY 343

Query: 356 DLLVRIGTRYAKFY 369
           +L+ R+ +R A  Y
Sbjct: 344 ELVTRLTSRVAMRY 357


>gi|254415385|ref|ZP_05029146.1| alanine racemase [Microcoleus chthonoplastes PCC 7420]
 gi|196177860|gb|EDX72863.1| alanine racemase [Microcoleus chthonoplastes PCC 7420]
          Length = 391

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 119/380 (31%), Positives = 180/380 (47%), Gaps = 29/380 (7%)

Query: 4   NEFLRLKIDLTALKNNWHSMNAL-SGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFV 62
            E   ++ID  AL +N + +  L S   +  AVVK +AYG G   +A      G     V
Sbjct: 22  TERAWVEIDRAALAHNLNQLKQLLSAKTQLMAVVKADAYGHGATMVAQTALATGAYGLCV 81

Query: 63  TSVEEGVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQ-LTFYSKLMSCGV 120
            +VEEG++LR     A I +L   + P Q + I    L P I +  Q L F   L  C  
Sbjct: 82  ATVEEGIQLREAGIDAPIVILGATNTPEQVRAIAHWYLQPTICTPQQALVFSDTLSRCQT 141

Query: 121 SHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL--IISHLACADDPSSHVNSVQ 178
                L +DTG +RLG+S Q+A +F      ++L  L L  + SHLA AD P   V  +Q
Sbjct: 142 PLSVHLNIDTGMSRLGMSWQQATEFVQ--LVQRLPHLKLASVYSHLATADSPDPTVMRLQ 199

Query: 179 LERFRTLIS--HYKGIEAS---LASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHP 231
            +RF   I+  H   I      LA+S+  L  P  H+   R G++LYG      ++    
Sbjct: 200 HQRFEAAIAQLHAANIVPPCLHLANSAATLTDPALHYDWVRVGLALYGLYPAPHLHPKVN 259

Query: 232 MQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHS 291
           ++ V+  + R+  ++   AG  VSYG   +  +   +AV  IGYADG P  LS   +   
Sbjct: 260 LKPVMQVKTRVTQVKTIPAGTGVSYGYTFRTQKQLRLAVVGIGYADGVPRNLSNKMT--- 316

Query: 292 PSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVA 347
                   G I+G  V  +G ITMD  M D+++   ++VG+ + + G D    I  DD A
Sbjct: 317 --------GLIRGQRVSQIGAITMDQLMLDVSNIPDLQVGEIVTLIGRDGDRQISADDWA 368

Query: 348 LASGTTNYDLLVRIGTRYAK 367
           ++  T ++++L     R  +
Sbjct: 369 ISLNTISWEILCGFKHRLPR 388


>gi|308051015|ref|YP_003914581.1| alanine racemase [Ferrimonas balearica DSM 9799]
 gi|307633205|gb|ADN77507.1| alanine racemase [Ferrimonas balearica DSM 9799]
          Length = 358

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 111/372 (29%), Positives = 195/372 (52%), Gaps = 39/372 (10%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +I  +AL +N   + AL+ N++  AVVK NAYG G  ++A   + + V  F +  +EE +
Sbjct: 8   EIRRSALNHNLQRLRALAPNSKLMAVVKANAYGHGLIRLAS--WMSDVDGFGLARIEEAL 65

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR    QAR+ +L G+   ++ +      L  VI    Q+     L    +S P    L
Sbjct: 66  ALRESGSQARLVLLEGVFSAEDLEQAAQHELDVVIHDAEQVRL---LEHTPLSQPLTIWL 122

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLE 180
           ++DTG +RLG++ ++      ++  ++L Q   +      ++H + AD+  +     Q++
Sbjct: 123 KIDTGMHRLGVTAEQ-----FSALYQRLCQCDNVRTPPNLMTHFSVADELENPETVRQIQ 177

Query: 181 RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKIN---KSHPMQTVVT 237
           RF  L  +  G E +L++S+G L  P+ H    RPG++LYG    I    +   ++ V+T
Sbjct: 178 RFNQLAQNLPG-EKALSNSAGTLSWPSAHGDWVRPGLALYGVNPMIGGRAEQFDLKPVMT 236

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             ++++ +R+  AGE V YG   + +RD+ IAV A+GY DGYP         H+ S   G
Sbjct: 237 MRSKVLAVRELKAGEPVGYGQTWRSSRDTRIAVIAMGYGDGYP--------RHAVS---G 285

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               I G   P+ G+I+MDM   ++ ++  ++VGD + ++G  + ++++A  +GT  Y+L
Sbjct: 286 TPVLINGQRYPLAGRISMDMLTVEVGEA-PVQVGDDVVLWGDGLPVEEIAECAGTIPYEL 344

Query: 358 LV----RIGTRY 365
           L     R+  RY
Sbjct: 345 LCSTTARVQYRY 356


>gi|332288773|ref|YP_004419625.1| alanine racemase [Gallibacterium anatis UMN179]
 gi|330431669|gb|AEC16728.1| alanine racemase [Gallibacterium anatis UMN179]
          Length = 357

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 114/361 (31%), Positives = 185/361 (51%), Gaps = 23/361 (6%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK+N   +++L+ N++  AVVK NAYG G E ++  + +  V  F V  + E +
Sbjct: 7   KISSLALKHNIEKIHSLAPNSKIIAVVKANAYGHGVEFVSQTVQD-NVDCFGVARLGEAL 65

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YAL 126
           +LR       I +L G     +  I+   NL  V+    QL     L++  + +P    +
Sbjct: 66  RLRSNGITKPILLLEGFFSASDLPILSVNNLETVVHCDEQL---EALLAAKLPNPINVWI 122

Query: 127 QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           ++DTG +RLG+ L E   +    S ++ + Q+  I SH + AD+  S     QL+RF T 
Sbjct: 123 KIDTGMHRLGVQLDEVDRYYQALSASQNVNQIRFI-SHFSRADELDSDYTLKQLDRFLTA 181

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEARII 243
            +   G E S+A+S GIL   + H    RPGI +YG       + ++ +  V+T  + +I
Sbjct: 182 CAGKVG-EKSIAASGGILFWKDSHLDWIRPGIIMYGISANSTPSSAYDLIPVMTLTSSLI 240

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R    GE V YGG+    +D+ I V AIGY DGYP             V  G   +I 
Sbjct: 241 AVRNHKKGEPVGYGGRWVSEKDTKIGVVAIGYGDGYPR-----------DVPTGTPVYIN 289

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI+GK++MDM   D+      +VGD + ++G ++ ++++A   G  +Y+L+ ++  
Sbjct: 290 GRRVPIVGKVSMDMLTVDLGADAQDKVGDEVILWGKELPIEEIAEIIGVISYELVTKLTP 349

Query: 364 R 364
           R
Sbjct: 350 R 350


>gi|296119282|ref|ZP_06837850.1| alanine racemase [Corynebacterium ammoniagenes DSM 20306]
 gi|295967674|gb|EFG80931.1| alanine racemase [Corynebacterium ammoniagenes DSM 20306]
          Length = 366

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 114/372 (30%), Positives = 179/372 (48%), Gaps = 22/372 (5%)

Query: 6   FLRLKIDLTALKNNWHSMNALSG-NARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTS 64
            L  +I+L A+ +N H +  L G + R   VVK +AYG G EK+AP +  AG       +
Sbjct: 3   LLSTRINLDAISHNVHKLKELVGPDVRLMCVVKADAYGHGVEKVAPVMLKAGADVLGCAT 62

Query: 65  VEEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           V+E V LR     A + V +   P Q+  + D     ++  VP L     L+   V    
Sbjct: 63  VDEAVALRSMGIDAPL-VAWMWEPEQD--LSDALSSNIVIGVPSLQHAQVLVDIEVPVKV 119

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           A++V+TG +R G+   +  +      +    +++ ++SHLACAD+P +    VQ E FR 
Sbjct: 120 AIKVETGMHRNGVDRAQWAEVFALLNDAPHIEVTGLMSHLACADEPDNPHTDVQAEEFRA 179

Query: 185 LISHYK--GIEAS---LASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAE 239
            I+  +  G+E     LA+S   L  P+ HF   R G++ YG        H +Q  +T  
Sbjct: 180 AIAQAREAGLECPINHLANSPATLTRPDLHFDQVRVGLACYGLEPVAGLDHELQPAMTWA 239

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           A II ++    GE   YG       D  +AV  +GYADG P ++ G     S  V +GGK
Sbjct: 240 ANIINVKPIKKGESSCYGLTWTAPADGYLAVLPVGYADGLPRSIQG-----SLQVTIGGK 294

Query: 300 GFIKGYMVPILGKITMDMTMFDITDS-LSIEVGDYIQIFGP-DIKLDDVALASGTTNYDL 357
            +      P +G+++MD  + D+ D+   +   D   IFG       ++A A+GT NY++
Sbjct: 295 SY------PHVGRVSMDQIVIDLGDNPFGVRADDEAIIFGEGGHSATELADAAGTINYEI 348

Query: 358 LVRIGTRYAKFY 369
           + R   R  + Y
Sbjct: 349 ICRPTGRTKRIY 360


>gi|78185553|ref|YP_377987.1| alanine racemase [Synechococcus sp. CC9902]
 gi|78169847|gb|ABB26944.1| alanine racemase [Synechococcus sp. CC9902]
          Length = 375

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 110/342 (32%), Positives = 172/342 (50%), Gaps = 22/342 (6%)

Query: 9   LKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           +++   A+K N  ++   L+      AVVK + YG G   +A A  + G     V +++E
Sbjct: 12  VEVSPAAIKANASALCQHLTPGTELMAVVKADGYGHGAVSVANAALDGGAASLGVATLQE 71

Query: 68  GVKLRLYTPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYA 125
           G++LR    +A I +L  +  P   +   +  L+P +SS+        L    G      
Sbjct: 72  GLELRRAGLKAPILLLSNLCDPEDLRTCLEWQLMPTLSSLADAKLCHALAEDSGRRFKVQ 131

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           L++DTG +RLG +L +  + T    + K  +L  I SHLACADD S+ V   Q +RF+++
Sbjct: 132 LKIDTGMSRLGCALDDGAETTQAIQHLKNLELKGIYSHLACADDRSTTVTQQQRQRFQSV 191

Query: 186 ISHYK----GIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAE 239
           I        G+   LA+S+G LL PN H+ L R G++LYG    D +    P+++ ++  
Sbjct: 192 IETLPQRGVGLCRHLANSAGTLLEPNLHYDLVRVGLALYGHAPADHLRDIVPLRSALSVR 251

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSG-LDSEHSPSVFLGG 298
           A++ LIR+  AG  VSYG Q        +AV AIGYADG   +LSG +D  H        
Sbjct: 252 AKVTLIREIKAGTGVSYGHQYISPNARRLAVVAIGYADGVLRSLSGQIDVLH-------- 303

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD 340
               +   +P +G ITMD  + D TD+  +  G  + + G D
Sbjct: 304 ----RDKRLPQVGAITMDQLLIDATDATDLHPGSIVTLLGRD 341


>gi|197334235|ref|YP_002155060.1| alanine racemase [Vibrio fischeri MJ11]
 gi|197315725|gb|ACH65172.1| alanine racemase [Vibrio fischeri MJ11]
          Length = 357

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 117/370 (31%), Positives = 180/370 (48%), Gaps = 28/370 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +ID++AL +N   +   + +++  AVVK N YG G   IA      G   F V  +EE +
Sbjct: 7   QIDMSALAHNLQKIKQQAPSSKLLAVVKANGYGHGLLNIAKG--AQGADAFGVARIEEAL 64

Query: 70  KLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
           +LR       I +L G +  G   I+   N+   I    QL     L S  +  P    L
Sbjct: 65  QLRAGGIVKPILLLEGFYSAGDLPILVTNNIQTAIHCKEQL---EALESTDLEFPVVAWL 121

Query: 127 QVDTGFNRLGL---SLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR 183
           +VD+G +RLG+     QE +D  H    K + +    +SH  CAD+  S   + Q++ F 
Sbjct: 122 KVDSGMHRLGIRPEEFQEYVDRLHAC--KNVAKPLRYMSHFGCADELDSSTTTEQIDTFM 179

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEA 240
           +L    +G E SLA+S+G+L  P+      RPGI +YG +   ++  +       +T  +
Sbjct: 180 SLTKGCQG-ERSLAASAGLLAWPDSRLDWVRPGIIMYGVSPFSEQSAQELGYLPTMTLTS 238

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
            +I +R   AGE V YG      RD+ I V AIGY DGYP T        +P+   G   
Sbjct: 239 HLIAVRDVKAGESVGYGAMWTSERDTKIGVIAIGYGDGYPRT--------APN---GTPV 287

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
            + G  VPI G+++MDM   D+      +VGD   ++G D+  ++VA   GT  Y+L+ +
Sbjct: 288 LVNGRKVPIAGRVSMDMLTVDLGPEAQDKVGDEAILWGRDLPSEEVAEHIGTIAYELVTK 347

Query: 361 IGTRYAKFYT 370
           + +R    YT
Sbjct: 348 LTSRVQMQYT 357


>gi|153209215|ref|ZP_01947281.1| alanine racemase [Coxiella burnetii 'MSU Goat Q177']
 gi|212218349|ref|YP_002305136.1| alanine racemase, biosynthetic [Coxiella burnetii CbuK_Q154]
 gi|226711036|sp|B6J6U2|ALR_COXB1 RecName: Full=Alanine racemase
 gi|120575470|gb|EAX32094.1| alanine racemase [Coxiella burnetii 'MSU Goat Q177']
 gi|212012611|gb|ACJ19991.1| alanine racemase, biosynthetic [Coxiella burnetii CbuK_Q154]
          Length = 364

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 114/370 (30%), Positives = 187/370 (50%), Gaps = 37/370 (10%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I++TALK+N   + AL+  +   A++K N YG G  ++A AL +A    F V  ++E + 
Sbjct: 8   INVTALKHNLSQIKALAPKSLAWAMIKSNGYGHGLVRVAKALSDANA--FGVACIDEALT 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR    ++ I V+ G +   E   F  + L  VI    Q++   K  +   S    L++D
Sbjct: 66  LREVGIKSPIIVMKGFYNEAELSQFARHRLGAVIHCSDQVSLLEK-TNLTSSLSVWLKID 124

Query: 130 TGFNRLGLSLQEALDF-----THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           TG NRLG S++++        T +S  K +G    +++HLA AD+ +     +Q++RF +
Sbjct: 125 TGMNRLGFSVEQSPAVYNQLKTSSSIQKPIG----LMTHLADADNENKTFTELQIKRFFS 180

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT----------DKINKSHPMQT 234
           +     G   S+ +S+G    PN    L RPGI LYG +          +KI K    + 
Sbjct: 181 VTEKMIG-PKSIVNSAGFFAYPNALVDLIRPGIILYGISPFGINYNSFKEKIEKK--FRP 237

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           V+T  A+II I+     + V YG       D  IA+ +IGY DGYP         H+PS 
Sbjct: 238 VMTLSAKIIAIKNRRQNDSVGYGCTWSCPEDMPIAIVSIGYGDGYP--------RHAPS- 288

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTN 354
             G    + G + P++G+++MDM   D+    + +VGD + ++G  + ++ +A  +GT  
Sbjct: 289 --GTPVLLNGKICPLIGRVSMDMIAIDLRSQPNAQVGDDVILWGEGLPVEIIAEKAGTIA 346

Query: 355 YDLLVRIGTR 364
           Y+LL +I  R
Sbjct: 347 YELLCKITQR 356


>gi|197286571|ref|YP_002152443.1| alanine racemase [Proteus mirabilis HI4320]
 gi|227357646|ref|ZP_03841999.1| alanine racemase (biosynthetic) [Proteus mirabilis ATCC 29906]
 gi|194684058|emb|CAR45397.1| alanine racemase (biosynthetic) [Proteus mirabilis HI4320]
 gi|227162356|gb|EEI47360.1| alanine racemase (biosynthetic) [Proteus mirabilis ATCC 29906]
          Length = 363

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 116/363 (31%), Positives = 182/363 (50%), Gaps = 25/363 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N+  +   + ++   AVVK NAYG G  + A  L +     F V  + E + 
Sbjct: 8   IDRRALRHNFQHVRDYAPHSHLIAVVKANAYGHGLLETAYTLMD-DADCFGVARIGEALT 66

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +  I   N I  V+ S  QL     L +  +  P    ++
Sbjct: 67  LRSGGIVKPILLLEGFFDAVDLPILVVNHIETVVHSEEQL---EALENADLEEPVKVWMK 123

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPS-SHVNSVQLERFRTL 185
           +DTG +RLG+  +EA  F       K + Q   ++SH + AD+P    V   Q++ F+  
Sbjct: 124 LDTGMHRLGVRPEEAEAFYQRLCACKNVQQPVNLVSHFSRADEPDIPEVTQNQIQLFQAF 183

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTVVTAEAR 241
           I    G + S+A+S+GIL  P  H+Q  RPGI  YG    G ++  K   +   +T +  
Sbjct: 184 IQDKAG-DKSIAASAGILFWPQVHYQWVRPGIITYGISPTGDNRTGKDFGLTPAMTLKTS 242

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +RK  AGE V YGG     +D+ + V AIGY DGYP +        +PS   G   +
Sbjct: 243 LIAVRKHKAGEPVGYGGTWVSEKDTYLGVIAIGYGDGYPRS--------APS---GTPVW 291

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           I G  VPI+G+++MDM   D+   L   VGD   ++G  + ++++A  SG + Y+L+ ++
Sbjct: 292 INGRKVPIVGRVSMDMISVDLGSELIDRVGDEAILWGDVLPVEEIAKYSGISAYELITKL 351

Query: 362 GTR 364
            +R
Sbjct: 352 TSR 354


>gi|148243246|ref|YP_001228403.1| alanine racemase [Synechococcus sp. RCC307]
 gi|147851556|emb|CAK29050.1| Alanine racemase [Synechococcus sp. RCC307]
          Length = 395

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 113/341 (33%), Positives = 171/341 (50%), Gaps = 24/341 (7%)

Query: 9   LKIDLTALKNNWHSMN-ALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           L+ID  A++ N   +  +LS      AVVK + YG G   +A A  + G   F V ++ E
Sbjct: 25  LEIDRDAIRYNTAQLKGSLSPGCALMAVVKADGYGHGAVTVAEAALDGGASSFGVATLAE 84

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA- 125
           G++LR    +A I VL  +   +E +      L P ISS+ Q    S +   G     A 
Sbjct: 85  GIELRQAGIEAPILVLGNLQQPEEFRCCLHWQLSPTISSLRQGLIGSNVGVAGGKPLLAH 144

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL--IISHLACADDPSSHVNSVQLERFR 183
           L++DTG  RLG+  Q+          ++L  LS+  + SHLA AD+P   +N+ Q ERF 
Sbjct: 145 LKLDTGMARLGIDWQQGPKLLEEL--QQLDGLSIAGVYSHLADADNPDGLLNATQQERFE 202

Query: 184 TLISHYKGIEAS-----LASSSGILLGPNYHFQLTRPGISLYGGTDKIN-KSHPMQTVVT 237
            ++  +  +E       LA+S+G L  P  H+ + R G+SLYG +   + K  P++  ++
Sbjct: 203 AVLRRFHELELKPGLRHLANSAGTLSSPELHYDMVRVGLSLYGHSPAAHLKQLPLRPAMS 262

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
             A++ L+R   AG  VSYG Q   TR S +AV  IGYADG    LSG            
Sbjct: 263 VHAKVTLLRDVPAGAGVSYGHQFHTTRPSRLAVLGIGYADGVSRRLSGQM---------- 312

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFG 338
            +   +G  +P +G ITMD  + D TD   +++GD + + G
Sbjct: 313 -EVLAEGRRLPQVGAITMDQIVIDATDLPELDIGDSVTLLG 352


>gi|295095419|emb|CBK84509.1| alanine racemase [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 359

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 116/370 (31%), Positives = 181/370 (48%), Gaps = 31/370 (8%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 8   INRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +   I D +L   + +  QL   + L +  +S P    ++
Sbjct: 66  LRAGGITQPILLLEGFFEASDLPTIADQHLHTAVHNEEQL---AALETAELSEPVTVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  + A  F    S  K + Q   I+SH A AD+P       QL+ F T  
Sbjct: 123 LDTGMHRLGVRPESAEAFYQRLSQCKNVRQPVNIVSHFARADEPECGATEQQLDIFNTFC 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS-------HPMQTVVTAE 239
               G+  S+A+S GILL P  HF   RPGI LYG +   NK         P+ ++V+  
Sbjct: 183 EGKPGMR-SIAASGGILLWPQSHFDWARPGIILYGVSPLENKPWGPDFGFKPVMSLVS-- 239

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
            ++I +R+  AGE V YGG      D+ + V A+GY DGYP          +P+   G  
Sbjct: 240 -KLIAVREHKAGEPVGYGGTWTSEHDTRLGVVAMGYGDGYPRA--------APT---GTP 287

Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
             + G  V I+G++ MDM   D+      + GD   ++G  + ++ +A  +  + Y+L+ 
Sbjct: 288 VLVNGREVKIVGRVAMDMICVDLGPDAQDKAGDDAVMWGEGLPVERIAEITKVSAYELIT 347

Query: 360 RIGTRYAKFY 369
           R+ +R A  Y
Sbjct: 348 RLTSRVAMKY 357


>gi|220934104|ref|YP_002513003.1| alanine racemase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254802394|sp|B8GNS7|ALR_THISH RecName: Full=Alanine racemase
 gi|219995414|gb|ACL72016.1| alanine racemase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 361

 Score =  152 bits (385), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 113/370 (30%), Positives = 183/370 (49%), Gaps = 24/370 (6%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           R +IDL AL++N  +    +  +R  AV+K  AYG G   +A     A    F ++ ++E
Sbjct: 6   RARIDLNALRHNLRTARRAAPRSRVMAVIKAEAYGHGMLAVA-RALAAQADAFAISCIDE 64

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDT--NLIPVISSVPQLTFYSKLMSCGVSHPYA 125
              LR       + VL G     + I      ++ PVI S  QL     L S  +  P  
Sbjct: 65  ARVLREAGVTLPLVVLQGFRDAAQLIEVARLGDVQPVIHSTGQLDV---LESAALPAPLR 121

Query: 126 --LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERF 182
             L++DTG +RLGL   EA    +  +   ++  +  +++HLACAD+P      +QL+ F
Sbjct: 122 VWLKLDTGMHRLGLPPGEAAVLQNRIAALPQVAGVPGLMTHLACADEPERPETGIQLQVF 181

Query: 183 RTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQTVVTAE 239
               +   G E S+A+S+ +L  P       RPGI LYG +    +  +S  +Q V+T  
Sbjct: 182 DAATADLPG-ERSIANSAAVLRTPAACRDWVRPGIMLYGASPLAGETAQSLDLQPVMTVS 240

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           A ++ +++  AG+ V YGG         +AV A+GY DGYP         H+PS   G  
Sbjct: 241 APVVAVKRLAAGDAVGYGGGYVCQSPRTMAVVAMGYGDGYP--------RHAPS---GTP 289

Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLV 359
             + G    ++G+++MDM   D+T+   +  GD + ++G  + +D++A A+GT +Y+LL 
Sbjct: 290 VRVHGRRCALMGRVSMDMLCVDVTEVPGVAPGDDVTLWGEGLPVDEIAAAAGTISYELLC 349

Query: 360 RIGTRYAKFY 369
            +G R    Y
Sbjct: 350 SVGGRLRLEY 359


>gi|251792441|ref|YP_003007167.1| alanine racemase [Aggregatibacter aphrophilus NJ8700]
 gi|247533834|gb|ACS97080.1| alanine racemase [Aggregatibacter aphrophilus NJ8700]
          Length = 360

 Score =  152 bits (385), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 182/369 (49%), Gaps = 28/369 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK+N  ++   + N++  AVVK NAYG G   ++ A+ +  V  F V  +EE +
Sbjct: 9   KISSVALKHNIQTIKQKAPNSKIIAVVKANAYGHGVVFLSSAVESL-VDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQV 128
           KLR       I +L G    ++  I+   N+  V+ S  QL    +  +      + L++
Sbjct: 68  KLRSNGITKPILLLEGFFSSKDLPILAVNNIQTVVHSKEQLEALERAKTPNPVKVW-LKI 126

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLERF 182
           DTG +RLG+ L E       +F +KL  L+ +      +SH + AD+        QL RF
Sbjct: 127 DTGMHRLGVHLDEV-----ETFYQKLKSLTCVDPNIGFVSHFSRADELECGYTEKQLARF 181

Query: 183 RTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEA 240
                   G E S+++S GIL  P  H    RPGI +YG    +   K + +  V+   +
Sbjct: 182 LQATEGKSG-ERSISASGGILFWPEAHLDWIRPGIIMYGISPNNTAGKEYGLTPVMNLTS 240

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
            +I +R+   GE V YGG     +D+ I V AIGY DGYP      D      V+L G+ 
Sbjct: 241 SLIAVREHKKGEPVGYGGVWVSDKDTKIGVVAIGYGDGYPR-----DVPEGTPVYLNGR- 294

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
                 VPI+GK++MDM   D+      +VGD + ++G ++ ++++A  +G  +Y+L+ +
Sbjct: 295 -----RVPIVGKVSMDMLTVDLGADSQDKVGDEVILWGKELPIEEIASIAGIISYELITK 349

Query: 361 IGTRYAKFY 369
           +  R    Y
Sbjct: 350 LTPRVLTEY 358


>gi|219871770|ref|YP_002476145.1| alanine racemase [Haemophilus parasuis SH0165]
 gi|219691974|gb|ACL33197.1| alanine racemase [Haemophilus parasuis SH0165]
          Length = 378

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 110/381 (28%), Positives = 186/381 (48%), Gaps = 38/381 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+ +AL++N   + +L+ +++  AVVK NAYG G   +   L +  V+ F V  ++E + 
Sbjct: 8   INGSALRHNMRLIKSLAPHSKICAVVKANAYGQGIRAVIKNLEDQ-VEAFGVARIKEALT 66

Query: 71  LRLYTPQARIFVLYGIHPGQEKII-----FDT------------NLIPVISSVPQLTFYS 113
           ++      +I +L G    +E +      FDT            N+     +  Q  F+ 
Sbjct: 67  IQESGYAGKILLLEGFFDREELLKTLSRRFDTVIHCLEQLELLENVAQEWQAEKQKGFWQ 126

Query: 114 KLMSCGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSH 173
           +           L++DTG +RLG+  ++  +F        L +    +SH + AD+    
Sbjct: 127 RKTKIYFPITVWLKIDTGMHRLGIHPEQVAEFYQRLTACPLVECIHFVSHFSRADELDCD 186

Query: 174 VNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM- 232
               Q+  F T+   YK +E S+++SSGIL     H+   RPGI +YG +     S P+ 
Sbjct: 187 YTEKQIATFETVSQEYK-VERSISASSGILYWKQAHYDWVRPGIIMYGISPH---STPIV 242

Query: 233 ----QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDS 288
               + V+T  + +I +R   AGE V YGG     +D+ I V AIGY DGYP        
Sbjct: 243 DLGFKPVMTLSSSLIAVRSHKAGEPVGYGGSWVSDKDTKIGVVAIGYGDGYP-------- 294

Query: 289 EHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVAL 348
            ++P    G   F+ G  VPI+G+++MDM   D+      +VGD ++++G  + +++VA 
Sbjct: 295 RNAPE---GTPVFVNGRKVPIVGRVSMDMMTVDLGIDSQDKVGDEVELWGERLLIEEVAE 351

Query: 349 ASGTTNYDLLVRIGTRYAKFY 369
           A G+ NY+L+ ++  R    Y
Sbjct: 352 AIGSINYELITKLTPRVITEY 372


>gi|317493449|ref|ZP_07951870.1| alanine racemase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918392|gb|EFV39730.1| alanine racemase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 359

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 112/366 (30%), Positives = 185/366 (50%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N+  +   + ++R  AVVK NAYG G  + A  L +A    + V  + E +K
Sbjct: 8   IDRRALRHNFQQIRQFAPHSRLIAVVKANAYGHGLLETAKTLKDADC--YGVARIGEALK 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +  ++   N+   I S  QL     L    +  P    ++
Sbjct: 66  LRSGGIVKPILMLEGFFSADDLPVLVANNIETAIHSEEQL---QALEEAELERPVKVWMK 122

Query: 128 VDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++A  F T  S  + + Q   I+SH + AD+P + +   QL  F    
Sbjct: 123 LDTGMHRLGVRPEQADAFYTRLSNCRNVEQPVNIMSHFSRADEPETGMTEAQLACFDAFA 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEARII 243
           +   G++ S+A+S GILL    H  + RPGI LYG +   +     + +Q V+T ++ +I
Sbjct: 183 TGKPGLQ-SIAASGGILLWTQSHRDMVRPGIILYGVSPLAEPYADHYGLQPVMTLKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+  AGE V Y G     RD+ + V AIGY DGYP +        +PS   G    + 
Sbjct: 242 AVREHKAGEPVGYNGTWVSQRDTRLGVVAIGYGDGYPRS--------APS---GTPVLVN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  VPI+G+++MDM   D+      +VGD + ++  ++ ++ +A  +G + Y+L+ ++  
Sbjct: 291 GREVPIVGRVSMDMISVDLGPEAKDKVGDEVVLWSAELPVEKIAKYTGISAYELITKLTP 350

Query: 364 RYAKFY 369
           R    Y
Sbjct: 351 RVTMEY 356


>gi|238798495|ref|ZP_04641974.1| Alanine racemase 1 [Yersinia mollaretii ATCC 43969]
 gi|238717657|gb|EEQ09494.1| Alanine racemase 1 [Yersinia mollaretii ATCC 43969]
          Length = 359

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 118/366 (32%), Positives = 184/366 (50%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +  ++  +R  AVVK NAYG G  +IA  L +A    + V  + E + 
Sbjct: 8   IDRRALRHNLQQVRRMAPQSRLIAVVKANAYGHGLLEIAHTLQDADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHP--YALQ 127
           LR       I +L G    ++  I   N I   I S+ QL     L +  +  P    ++
Sbjct: 66  LRSGGIVKPILLLEGFFSAEDLPILAANRIETAIHSIEQL---EALEAADLPAPINVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  + A  F    S    + Q   I+SH + AD+P       QL  F    
Sbjct: 123 LDTGMHRLGIRPEHAEAFYQRLSTCPNVIQPVNIMSHFSRADEPQVETTRQQLACFDAFA 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT--DKINKSH-PMQTVVTAEARII 243
           +   G + S+A+S GILL P  H    RPGI LYG +  D+   SH  +   +  ++ +I
Sbjct: 183 TGKPG-KQSIAASGGILLWPEAHRDWVRPGIILYGVSPLDEPYASHFDLLPAMALKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+  AGE V YGG     RD+ + V AIGY DGYP +        +PS   G   ++ 
Sbjct: 242 AVREHKAGEPVGYGGTWVSERDTRLGVVAIGYGDGYPRS--------APS---GTPMWLN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  V I+G+++MDM   D+    S +VGD + ++G ++ ++ VA  +G + Y+L+ ++ +
Sbjct: 291 GREVGIVGRVSMDMISVDLGPDASDKVGDEVLLWGAELPVERVAACTGISAYELITKLTS 350

Query: 364 RYAKFY 369
           R A  Y
Sbjct: 351 RVAMEY 356


>gi|315634389|ref|ZP_07889676.1| alanine racemase [Aggregatibacter segnis ATCC 33393]
 gi|315476979|gb|EFU67724.1| alanine racemase [Aggregatibacter segnis ATCC 33393]
          Length = 360

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 182/369 (49%), Gaps = 28/369 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK+N  ++   + N++  AVVK NAYG G   ++ A+ +  V  F V  +EE +
Sbjct: 9   KISSVALKHNIQTIKQKAPNSKIIAVVKANAYGHGVVFVSSAVESL-VDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQV 128
           KLR       I +L G    ++  I+   N+  V+ S  QL    +  +      + L++
Sbjct: 68  KLRSNGITKPILLLEGFFSSKDLPILAVNNIQTVVHSQEQLEALEEAQTPNPVKVW-LKI 126

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLERF 182
           DTG +RLG+ L E      +SF +KL  L  +      +SH + AD+        QL RF
Sbjct: 127 DTGMHRLGVHLDEV-----DSFYQKLKSLPCVDPNIGFVSHFSRADELECGYTEKQLSRF 181

Query: 183 RTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTAEA 240
                   G E S+++S GIL   + H    RPGI +YG    +   K + +  V+   +
Sbjct: 182 LQATEGKSG-ERSISASGGILFWQDAHLDWIRPGIIMYGISPNNTAGKEYGLTPVMNLTS 240

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
            +I +R+   GE V YGG     +D+ I V AIGY DGYP      D      V+L G+ 
Sbjct: 241 SLIAVREHKKGEPVGYGGVWTSEKDTKIGVVAIGYGDGYPR-----DVPQGTPVYLNGR- 294

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
                 VPI+GK++MDM   D+      +VGD + ++G ++ ++++A  +G  +Y+L+ +
Sbjct: 295 -----RVPIVGKVSMDMLTVDLGADSQDKVGDEVILWGKELPIEEIAEITGVISYELITK 349

Query: 361 IGTRYAKFY 369
           +  R    Y
Sbjct: 350 LTPRVLTEY 358


>gi|323703375|ref|ZP_08115024.1| alanine racemase [Desulfotomaculum nigrificans DSM 574]
 gi|323531644|gb|EGB21534.1| alanine racemase [Desulfotomaculum nigrificans DSM 574]
          Length = 372

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 118/388 (30%), Positives = 186/388 (47%), Gaps = 41/388 (10%)

Query: 4   NEFLRLKIDLTALKNNWHSMNALSGNART-AAVVKDNAYGLGCEKIAPALYNAGVQDFFV 62
            E +  +IDL A+++N   +  L G  R   AVVK N YG G   +A A  +AG     V
Sbjct: 2   QEPIWAEIDLGAIRHNIKEVRRLVGPDREIMAVVKANGYGHGAVPVARAALSAGATRLAV 61

Query: 63  TSVEEGVKLRLYTPQARIFVLYGIHPGQ---------EKIIFDTNLIPVISSVPQLTFYS 113
             + E + LR       I VL  I P Q            ++ T+L   IS V Q     
Sbjct: 62  ARLNEAMVLRQAGINVPILVLGFIPPEQLAAALTNHITLTLYRTDLAEEISRVAQ----- 116

Query: 114 KLMSCGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSH 173
           KL    V H   L+VDTG  RLG   ++ ++           +L  I +H A AD+    
Sbjct: 117 KLGQPAVIH---LKVDTGMGRLGFIPEQGIEEVKRVSQLAGLKLEGIYTHFAAADETDKS 173

Query: 174 VNSVQLERFRTLIS--HYKGIEASL---ASSSGILLGPNYHFQLTRPGISLYG--GTDKI 226
               QL+RF + IS    +G+  +L   A+S+ I+  P  +  + RPGI +YG   ++++
Sbjct: 174 YTRWQLDRFLSFISALEEQGVTFALRHCANSAAIIDHPEAYLDMVRPGIIIYGLYPSEEV 233

Query: 227 NKSH-PMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSG 285
           NKS   ++  +  + R+  ++    G  +SYG    + R+++I    +GYADGYP  LS 
Sbjct: 234 NKSRVDLRPAMALKTRVAHLKTVKPGTKISYGCTYTVPRETVIGSLPLGYADGYPRLLSS 293

Query: 286 LDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----I 341
                       G+  I+G   PI+G++ MD +M D+     ++VGD + IFG D    +
Sbjct: 294 R-----------GQVIIRGQRAPIVGRVCMDQSMVDVGHIPGVKVGDEVLIFGRDGADYL 342

Query: 342 KLDDVALASGTTNYDLLVRIGTRYAKFY 369
            +++VA   GT NY+++  +G R  + Y
Sbjct: 343 PVEEVAAWLGTINYEMVCLVGARVPRIY 370


>gi|33866630|ref|NP_898189.1| alanine racemase [Synechococcus sp. WH 8102]
 gi|33633408|emb|CAE08613.1| putative alanine racemase [Synechococcus sp. WH 8102]
          Length = 376

 Score =  152 bits (383), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 115/372 (30%), Positives = 180/372 (48%), Gaps = 31/372 (8%)

Query: 14  TALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLR 72
           TA++ N   +   L    +  AVVK + YG G   +A A    G     V +++EG++LR
Sbjct: 17  TAIEANCRLLCRQLVTGCQLMAVVKADGYGHGAVTVARASLRGGASSLGVATLQEGLELR 76

Query: 73  LYTPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFYSKLM--SCGVSHPYALQVD 129
               +A + +L  +  P   +   +  L+P +SS+ +    + +         P  L++D
Sbjct: 77  DAGIEAPVLILSALPSPEDLRHCLEQRLMPTLSSLDEANTAAAVAAERGNERFPVQLKLD 136

Query: 130 TGFNRLGLSLQEALDFTHNSFNKKLGQLSLI--ISHLACADDPSSHVNSVQLERFRTLIS 187
           TG  RLG   QE      +   + L QL L+   SHLACAD+    +  +QL+RFR++I 
Sbjct: 137 TGMARLGGEWQEGAQLVQSI--RTLPQLELVGLYSHLACADELGDQLTHLQLQRFRSVIE 194

Query: 188 HY----KGIEASLASSSGILLGPNYHFQLTRPGISLYGGT--DKINKSHPMQTVVTAEAR 241
                  G+   LA+S+G L  P  H  + R G++LYG +  D +     +Q  +  +AR
Sbjct: 195 ALPDGGSGLCCHLANSAGTLQDPRLHLDMVRVGLALYGQSPADHLGLDLALQPALAVKAR 254

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSG-LDSEHSPSVFLGGKG 300
           + LIR+  +G  VSYG +   +R S +AV AIGYADG    LSG +D  H          
Sbjct: 255 VSLIREVPSGSGVSYGHRFVTSRPSRLAVIAIGYADGVVRALSGRIDVLH---------- 304

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALASGTTNYD 356
             +G  VP +G ITMD  + D TD   + VGD + + G D    I+  D +   G+  ++
Sbjct: 305 --RGRRVPQVGNITMDQIILDATDVEELTVGDNVTLLGQDGDDCIRPQDWSARCGSIPWE 362

Query: 357 LLVRIGTRYAKF 368
           +L     R  + 
Sbjct: 363 ILCGFKHRLPRV 374


>gi|59710909|ref|YP_203685.1| alanine racemase [Vibrio fischeri ES114]
 gi|59479010|gb|AAW84797.1| alanine racemase 1, PLP-binding, biosynthetic [Vibrio fischeri
           ES114]
          Length = 360

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 119/373 (31%), Positives = 180/373 (48%), Gaps = 34/373 (9%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +ID++AL +N   +   + +++  AVVK N YG G   IA      G   F V  +EE +
Sbjct: 10  QIDMSALAHNLQKIKQQAPSSKLLAVVKANGYGHGLLNIAKG--AQGADAFGVARIEEAL 67

Query: 70  KLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
           +LR       I +L G +  G   I+   N+   I    QL     L S  +  P    L
Sbjct: 68  QLRAGGIVKPILLLEGFYSAGDLPILVTNNIQTAIHCKEQL---EALESTDLEFPVVAWL 124

Query: 127 QVDTGFNRLGL---SLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFR 183
           +VD+G +RLG+     QE +D  H    K + +    +SH  CAD+  S   + Q++ F 
Sbjct: 125 KVDSGMHRLGIRPEEFQEYVDRLHAC--KNVAKPLRYMSHFGCADELDSSTTTEQIDTFM 182

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSH------PMQTVVT 237
           +L    +G E SLA+S+G+L  P+      RPGI +YG +    +S       P  T+ +
Sbjct: 183 SLTKGCQG-ERSLAASAGLLAWPDSRLDWVRPGIIMYGVSPFAEQSAQELGYLPTMTLTS 241

Query: 238 AEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLG 297
               +I +R   AGE V YG      RD+ I V AIGY DGYP T        +P+   G
Sbjct: 242 ---HLIAVRDVKAGESVGYGAIWTSERDTKIGVIAIGYGDGYPRT--------APN---G 287

Query: 298 GKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDL 357
               + G  VPI G+++MDM   D+      +VGD   ++G D+  ++VA   GT  Y+L
Sbjct: 288 TPVLVNGRKVPIAGRVSMDMLTVDLGPDAQDKVGDEAILWGRDLPSEEVAEHIGTIAYEL 347

Query: 358 LVRIGTRYAKFYT 370
           + ++ +R    YT
Sbjct: 348 VTKLTSRVQMQYT 360


>gi|186685683|ref|YP_001868879.1| alanine racemase [Nostoc punctiforme PCC 73102]
 gi|186468135|gb|ACC83936.1| alanine racemase [Nostoc punctiforme PCC 73102]
          Length = 395

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 181/377 (48%), Gaps = 31/377 (8%)

Query: 9   LKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           ++IDL AL  N   +   LS   +  AVVK +AYG G   +A  +  +G     V +V E
Sbjct: 28  VEIDLGALSYNVQQLVQFLSPRTQLMAVVKADAYGHGALTVAQTVIQSGASWLGVATVPE 87

Query: 68  GVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKL---MSCGVSHP 123
            ++LR    +A I +L   H P Q   I   NL P + S  Q   +S +   M+ G   P
Sbjct: 88  AIQLREGGIEAPILILGATHTPEQIHAIAQWNLQPTLCSPKQALVFSNILESMNHGSPVP 147

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL--IISHLACADDPSSHVNSVQLER 181
             +++DTG +RLG + Q+A +F      ++L  LS+  I SHLA ADDP +     Q  R
Sbjct: 148 VHIKLDTGMSRLGTNWQQAGEFVQ--LVQRLPHLSIASIYSHLATADDPDTTAMEEQHRR 205

Query: 182 FRTLISHYKGIEAS-----LASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQT 234
           F   I+  K +E       LA+S+  L  P  H+ + R G+++YG      +  +  ++ 
Sbjct: 206 FEEAIAQIKAMEIEAPCLHLANSAAALTDPALHYDIVRVGLAVYGLYPAPHLQNAIDLKP 265

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           V+  +AR+  ++   AG  VSYG +    R+  +AV  IGYADG P +LS          
Sbjct: 266 VLQLKARVTQVKTIAAGTAVSYGHKFIAPRELRLAVVGIGYADGVPRSLSN--------- 316

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFG----PDIKLDDVALAS 350
               +  I G  V  +G ITMD  M D++   +I+ G+ + + G      I  DD A   
Sbjct: 317 --KMQALIHGQRVSQIGTITMDQLMLDVSAIPNIQEGEVVTLLGKQGKEQISADDWAEQL 374

Query: 351 GTTNYDLLVRIGTRYAK 367
            T ++++L     R  +
Sbjct: 375 NTISWEILCGFKHRLPR 391


>gi|161503072|ref|YP_001570184.1| alanine racemase [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|160864419|gb|ABX21042.1| hypothetical protein SARI_01137 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 356

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 116/370 (31%), Positives = 181/370 (48%), Gaps = 36/370 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVE 66
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL  +G   F + ++E
Sbjct: 5   IQASLDLQVMKQNLSIVRRAAPEARVWSVVKANAYGHGIERVWNAL--SGTDGFAMLNLE 62

Query: 67  EGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPYA 125
           E + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P  
Sbjct: 63  EAITLRERGWKGPILMLEGFFHAQDLETYDTYRLTTCIHSNWQL---KALQNARLNAPLD 119

Query: 126 L--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERF 182
           +  +V++G NRLG   + A          + +G+++ I+SH A AD P         E  
Sbjct: 120 IYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMT-IMSHFAQADHPEGIG-----EAM 173

Query: 183 RTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQT 234
           R +    +GI+   SLA+S+  L  P  H+   RPGI LYG +      D  N    ++ 
Sbjct: 174 RRIALATEGIQCPYSLANSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIANTG--LKP 231

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           V+T  + II ++   AGE V YGG     ++  I + A GYADGYP         H+P+ 
Sbjct: 232 VMTLSSEIIGVQTLRAGEKVGYGGCYSAHQEQRIGIVAAGYADGYP--------RHAPT- 282

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTN 354
             G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  
Sbjct: 283 --GTPVLVDGIRTGTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVAAAAGTLG 340

Query: 355 YDLLVRIGTR 364
           Y+LL  +  R
Sbjct: 341 YELLCAVAPR 350


>gi|260599554|ref|YP_003212125.1| alanine racemase [Cronobacter turicensis z3032]
 gi|260218731|emb|CBA34079.1| Alanine racemase, biosynthetic [Cronobacter turicensis z3032]
          Length = 371

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 113/374 (30%), Positives = 183/374 (48%), Gaps = 39/374 (10%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ++  AL++N   +  L+  ++  AVVK NAYG G  + A  L +A    F V  +EE ++
Sbjct: 20  VNRRALRHNLQRLRELAPASQLVAVVKANAYGHGLLETARTLPDADA--FGVARLEEALR 77

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVI------SSVPQLTFYSKLMSCGVSHPY 124
           LR       I +L G         F+ + +P I      ++V      + L    +S P 
Sbjct: 78  LREGGITQPILLLEGF--------FNADDLPAIAAQRLHTAVHSEEQLAALEQATLSEPV 129

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              +++DTG +RLG+  + A  F +  +  K + Q   ++SH A AD+P       QL+ 
Sbjct: 130 TVWMKLDTGMHRLGVRPEAAQAFYNRLAACKNVRQPVNVVSHFARADEPDCGATERQLDI 189

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM------QTV 235
           F +  +H K  + S+A+S GIL  P  HF   RPGI LYG +     +HP       Q  
Sbjct: 190 FNSF-THDKPGKRSIAASGGILFWPQSHFDWIRPGIILYGVSPL--DTHPWGAELGFQPA 246

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           ++  + +I +R   AGE V YGG     RD+ + V A+GY DGYP          +P+  
Sbjct: 247 MSLISSLIAVRDHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRC--------APT-- 296

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G  VPI+G++ MDM   D+      + GD + ++G  + ++ +A  +G + Y
Sbjct: 297 -GTPVLVNGREVPIVGRVAMDMICVDLGPDAPEKAGDTVVMWGEALPVERIAEVTGVSAY 355

Query: 356 DLLVRIGTRYAKFY 369
           +L+ R+ +R A  Y
Sbjct: 356 ELVTRLTSRVAMRY 369


>gi|161829951|ref|YP_001596838.1| alanine racemase [Coxiella burnetii RSA 331]
 gi|189027533|sp|A9ND48|ALR_COXBR RecName: Full=Alanine racemase
 gi|161761818|gb|ABX77460.1| alanine racemase [Coxiella burnetii RSA 331]
          Length = 364

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 113/370 (30%), Positives = 187/370 (50%), Gaps = 37/370 (10%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I++TALK+N   + AL+  +   A++K N YG G  ++A AL +A    F V  ++E + 
Sbjct: 8   INVTALKHNLSQIKALAPKSLAWAMIKSNGYGHGLVRVAKALSDANA--FGVACIDEALT 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR    ++ I V+ G +   E   F  + L  VI    Q++   K  +   S    L++D
Sbjct: 66  LREVGIKSPIIVMKGFYNEAELSQFARHRLGAVIHCSDQVSLLEK-TNLTSSLSVWLKID 124

Query: 130 TGFNRLGLSLQEALDF-----THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           TG NRLG S++++        T +S  K +G    +++HLA AD+ +     +Q++RF +
Sbjct: 125 TGMNRLGFSVEQSPAVYNQLKTSSSIQKPIG----LMTHLADADNENKTFTELQIKRFFS 180

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT----------DKINKSHPMQT 234
           +     G   S+ +S+G    PN      RPGI LYG +          +KI K    + 
Sbjct: 181 VTEKMIG-PKSIVNSAGFFAYPNALVDWIRPGIILYGISPFGINYNSFKEKIEKK--FRP 237

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           V+T  A+II I+     + V YG     + D  IA+ +IGY DGYP         H+PS 
Sbjct: 238 VMTLSAKIIAIKNRRQNDSVGYGCTWSCSEDMPIAIVSIGYGDGYP--------RHAPS- 288

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTN 354
             G    + G + P++G+++MDM   D+    + +VGD + ++G  + ++ +A  +GT  
Sbjct: 289 --GTPVLLNGKICPLIGRVSMDMIAIDLRSQPNAQVGDDVILWGEGLPVEIIAEKAGTIA 346

Query: 355 YDLLVRIGTR 364
           Y+LL +I  R
Sbjct: 347 YELLCKITQR 356


>gi|113971579|ref|YP_735372.1| alanine racemase [Shewanella sp. MR-4]
 gi|123324703|sp|Q0HF52|ALR_SHESM RecName: Full=Alanine racemase
 gi|113886263|gb|ABI40315.1| alanine racemase [Shewanella sp. MR-4]
          Length = 358

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 108/368 (29%), Positives = 185/368 (50%), Gaps = 24/368 (6%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSV 65
           F R +I  +AL+NN   +   +  ++  AVVK N YG G   +A  L+ A    F +  +
Sbjct: 4   FPRAEISSSALQNNLAVLRQQASRSQVMAVVKANGYGHGLLNVANCLHTA--DGFGLARL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE ++LR    +AR+ +L G     +  ++   ++  V+    Q+     L    +S P 
Sbjct: 62  EEALELRAGGVKARLLLLEGFFRSTDLPLLVAHDIDTVVHHESQIEM---LEQATLSKPV 118

Query: 125 A--LQVDTGFNRLGLSLQE-ALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+VD+G +RLG++ ++ A  +   +    + +   +++H ACAD+P +H   VQ++ 
Sbjct: 119 TVWLKVDSGMHRLGVTPEQFAQVYARLTACDNVAKPIHLMTHFACADEPENHYTQVQMQT 178

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGG---TDKINKSHPMQTVVTA 238
           F  L +   G   +LA+S+G L  P       RPGI+LYG    T     +H +   +  
Sbjct: 179 FNQLTADLPGFR-TLANSAGALYWPKSQGDWIRPGIALYGVSPVTGDCGANHGLIPAMNL 237

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            +R+I +R   AG+ V YG      +D+ + V AIGY DGYP         ++P    G 
Sbjct: 238 VSRLIAVRDHKAGQPVGYGCYWTAKQDTRLGVVAIGYGDGYP--------RNAPE---GT 286

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             ++ G  VPI+G+++MDM   D+    +  VGD   ++G  + +++VA   GT  Y+L+
Sbjct: 287 PVWVNGRRVPIVGRVSMDMLTVDLGADATDLVGDEALLWGAALPVEEVAEHIGTIAYELV 346

Query: 359 VRIGTRYA 366
            ++  R A
Sbjct: 347 TKLTPRVA 354


>gi|146291864|ref|YP_001182288.1| alanine racemase [Shewanella putrefaciens CN-32]
 gi|254802380|sp|A4Y3F6|ALR_SHEPC RecName: Full=Alanine racemase
 gi|145563554|gb|ABP74489.1| alanine racemase [Shewanella putrefaciens CN-32]
 gi|319425098|gb|ADV53172.1| alanine racemase [Shewanella putrefaciens 200]
          Length = 358

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 106/368 (28%), Positives = 186/368 (50%), Gaps = 24/368 (6%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSV 65
           F R +I  +AL+NN   +   +  ++  AVVK N YG G   +A  L NA    F +  +
Sbjct: 4   FPRAEISSSALQNNLAVLRQQASASQVMAVVKANGYGHGLLNVANCLVNA--DGFGLARL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE ++LR    +AR+ +L G     +  ++   ++  V+    Q+    ++    ++ P 
Sbjct: 62  EEALELRAGGVKARLLLLEGFFRSTDLPLLVAHDIDTVVHHESQIEMLEQVK---LTKPV 118

Query: 125 A--LQVDTGFNRLGLSLQE-ALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+VD+G +RLG++ ++ A  +        + +   +++H ACAD+P +H   VQ+  
Sbjct: 119 TVWLKVDSGMHRLGVTPEQFATVYARLMACPNIAKPIHLMTHFACADEPDNHYTDVQMAA 178

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQTVVTA 238
           F  L +   G   +LA+S+G L  P       RPGI+LYG +        +H +   +  
Sbjct: 179 FNELTAGLPGFR-TLANSAGALYWPKSQGDWIRPGIALYGVSPVAGDCGTNHGLIPAMNL 237

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            +R+I +R   A + V YG      +D+ + V AIGY DGYP         ++P    G 
Sbjct: 238 VSRLIAVRDHKANQPVGYGCYWTAKQDTRLGVVAIGYGDGYP--------RNAPE---GT 286

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             ++ G  VPI+G+++MDM   D+    + +VGD + ++G D+ +++VA   GT  Y+L+
Sbjct: 287 PVWVNGRRVPIVGRVSMDMLTVDLGQDATDKVGDDVLLWGQDLPVEEVAERIGTIAYELV 346

Query: 359 VRIGTRYA 366
            ++  R A
Sbjct: 347 TKLTPRVA 354


>gi|260773674|ref|ZP_05882590.1| alanine racemase biosynthetic [Vibrio metschnikovii CIP 69.14]
 gi|260612813|gb|EEX38016.1| alanine racemase biosynthetic [Vibrio metschnikovii CIP 69.14]
          Length = 365

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 112/371 (30%), Positives = 183/371 (49%), Gaps = 28/371 (7%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           +  IDL AL+ N   +   + +++  AVVK N YG G  ++A   Y      F V  ++E
Sbjct: 8   KASIDLQALQYNLQRIKQQAPSSKVMAVVKANGYGHGSCQVA--RYAQDADAFGVARIQE 65

Query: 68  GVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA- 125
            ++LR       I +L G +  G   ++   N+  V+    QL     L    +  P + 
Sbjct: 66  ALQLRANGIVKPILLLEGFYSAGDLPVLMTNNIQTVVHCEEQL---QALERAQLDTPVSV 122

Query: 126 -LQVDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            L++D+G +RLG+  ++  +F    H   N  + +    +SH  CAD+ +S +   Q+E 
Sbjct: 123 WLKIDSGMHRLGVRPEQHAEFVERLHRCPN--VAKPLRYMSHFGCADELNSPITRQQIEL 180

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQTVVTA 238
           F +L    KG E SLA+S+G+L  P       RPGI LYG +    +  ++   + V+T 
Sbjct: 181 FLSLTEGCKG-ERSLAASAGLLAWPESQLDWVRPGIILYGVSPFAHQDAQAMGYRPVMTL 239

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            A +I +R+  AGE + YG      R++ I V AIGY DGYP T        +P+   G 
Sbjct: 240 TAPLIAVREVKAGESIGYGALWTAQRETKIGVIAIGYGDGYPRT--------APN---GT 288

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
              + G +VP+ G+++MDM   D+       VGD   ++G D+ ++ VA   GT  Y+L+
Sbjct: 289 PVLVNGRIVPMAGRVSMDMLTVDLGPESQDNVGDEAILWGQDLPVERVAEHIGTVGYELV 348

Query: 359 VRIGTRYAKFY 369
            ++ +R    Y
Sbjct: 349 TKLTSRVEMHY 359


>gi|261855604|ref|YP_003262887.1| alanine racemase [Halothiobacillus neapolitanus c2]
 gi|261836073|gb|ACX95840.1| alanine racemase [Halothiobacillus neapolitanus c2]
          Length = 378

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 109/364 (29%), Positives = 180/364 (49%), Gaps = 20/364 (5%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           L IDL AL++N      ++   +  A VK +AYG G   +A AL +  V  F V ++ EG
Sbjct: 23  LTIDLAALRHNAAVARQVAKGRKLLAAVKADAYGHGMATVARALRDR-VDGFMVATLGEG 81

Query: 69  VKLRLYTPQARIFVLYGIHPGQEKIIFDTNLI-PVISSVPQLTFYSKLMSCGVSHPYALQ 127
             LRL     R+ VL G+    E        + PV     Q+     +   G+     L+
Sbjct: 82  EALRLAGITQRVLVLQGVMSQAEARRAARRFLEPVFHHASQIDAVGTV-GFGLPLTAWLK 140

Query: 128 VDTGFNRLGLSLQE-ALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +R+G + +E A  +   S  + +     +++H ACAD+P       Q+  F+   
Sbjct: 141 LDTGMHRVGFTPEEFAQAYARLSALRGVRPNPNVLTHFACADEPDRAPTDDQITLFKQTT 200

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
           +   G E SL +S+G+L  P+      RPGI LYGG   I  +     ++ V+T   ++I
Sbjct: 201 TECSG-ETSLCNSAGLLAYPHAGGDWVRPGIMLYGGNPFITGTAADWDLKPVMTLTTQLI 259

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+  AGE V YGG+        + V +IGY DGYP         H+P+   G    + 
Sbjct: 260 AVREVQAGERVGYGGKFTAPATMPVGVVSIGYGDGYP--------RHAPN---GTPIVVN 308

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G    ++G+++MD+   D+   +  +VGD +Q +G  + +D+VA A+GT +Y+L+ ++  
Sbjct: 309 GQRSQVIGRVSMDLVTVDLR-GIQAQVGDTVQCWGDQLPIDEVAQAAGTISYELMCQMSG 367

Query: 364 RYAK 367
           R  +
Sbjct: 368 RVTR 371


>gi|167855746|ref|ZP_02478501.1| alanine racemase [Haemophilus parasuis 29755]
 gi|167853143|gb|EDS24402.1| alanine racemase [Haemophilus parasuis 29755]
          Length = 378

 Score =  151 bits (382), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 108/378 (28%), Positives = 184/378 (48%), Gaps = 32/378 (8%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I+ +AL++N   + +L+ +++  AVVK NAYG G   +   L +  V+ F V  ++E + 
Sbjct: 8   INGSALRHNMRLIKSLAPHSKICAVVKANAYGQGIRAVIKNLEDQ-VEAFGVARIKEALT 66

Query: 71  LRLYTPQARIFVLYGIHPGQEKII-----FDT------------NLIPVISSVPQLTFYS 113
           ++      +I +L G    +E +      FDT            N+     +  Q  F+ 
Sbjct: 67  IQESGYAGKILLLEGFFDREELLKTLSRRFDTVIHCLEQLELLENVAQEWQAEKQKGFWQ 126

Query: 114 KLMSCGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSH 173
           +           L++DTG +RLG+  ++  +F        L +    +SH + AD+    
Sbjct: 127 RKTKIYFPITVWLKIDTGMHRLGIHPEQVAEFYQRLTACPLVECIHFVSHFSRADELDCD 186

Query: 174 VNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM- 232
               Q+  F T+   YK +E S+++SSGIL     H+   RPGI +YG +        + 
Sbjct: 187 YTEKQIATFETVSQEYK-VERSISASSGILYWKQAHYDWVRPGIIMYGISPHTTPIIDLG 245

Query: 233 -QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHS 291
            + V+T  + +I +R   AGE V YGG     +D+ I V AIGY DGYP         ++
Sbjct: 246 FKPVMTLSSSLIAVRSHKAGEPVGYGGSWVSDKDTKIGVVAIGYGDGYP--------RNA 297

Query: 292 PSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASG 351
           P    G   F+ G  VPI+G+++MDM   D+      +VGD ++++G  + +++VA A G
Sbjct: 298 PE---GTPVFVNGRKVPIVGRVSMDMMTVDLGIDSQDKVGDEVELWGERLLIEEVAEAIG 354

Query: 352 TTNYDLLVRIGTRYAKFY 369
           + NY+L+ ++  R    Y
Sbjct: 355 SINYELITKLTPRVITEY 372


>gi|52425237|ref|YP_088374.1| alanine racemase [Mannheimia succiniciproducens MBEL55E]
 gi|81825540|sp|Q65TC1|ALR_MANSM RecName: Full=Alanine racemase
 gi|52307289|gb|AAU37789.1| Alr protein [Mannheimia succiniciproducens MBEL55E]
          Length = 357

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 185/369 (50%), Gaps = 27/369 (7%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           +KI   ALK+N   +   + +++  AVVK NAYG G E ++  L N  V  F V  + E 
Sbjct: 6   VKISSVALKHNIQIIKQKAPHSKIIAVVKANAYGHGVEFVSSTLENL-VDGFGVARLAEA 64

Query: 69  VKLRLYTPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA-- 125
           + +R       I +L G   P    I+   N+  V+ +  QL     +    + +P    
Sbjct: 65  LSVRSNGVTKPILLLEGFFSPKDLPILSVNNIQTVVHNQDQL---DAIKRANLENPIKVW 121

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNK--KLGQLSLIISHLACADDPSSHVNSVQLERFR 183
           L++DTG +RLG+SL+E +D+ +N       + ++  + SH + AD+  S   ++QL RF 
Sbjct: 122 LKIDTGMHRLGVSLEE-VDYYYNELMNCPNVDEVGFV-SHFSRADETDSDYTNIQLNRFL 179

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKIN---KSHPMQTVVTAEA 240
               + KG   ++A+S GIL   + H +  RPGI +YG    IN     + +  V+T  +
Sbjct: 180 DATKNKKG-NRTIAASGGILFWEDSHLEYIRPGIIMYG-VSPINIPSSEYGLIPVMTLTS 237

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
            +I +R    GE V YGG     RD+ I V AIGY DGYP  +             G   
Sbjct: 238 SLIAVRDHKKGEPVGYGGIWVSERDTKIGVVAIGYGDGYPRNVPA-----------GTPI 286

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
           +I G  VPI+G+++MDM   D+      +VGD   ++G ++ +++VA  +G  +Y+L+ +
Sbjct: 287 YINGRRVPIVGRVSMDMVTVDLGPDCKDKVGDEAVLWGKELPIEEVAEITGLLSYELMTK 346

Query: 361 IGTRYAKFY 369
           +  R    Y
Sbjct: 347 LTPRVLTEY 355


>gi|332535828|ref|ZP_08411559.1| alanine racemase, biosynthetic [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332034780|gb|EGI71319.1| alanine racemase, biosynthetic [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 359

 Score =  151 bits (382), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 114/374 (30%), Positives = 190/374 (50%), Gaps = 37/374 (9%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +I+LTAL +N   +   + N++  AV+K NAYG G   IA  L NA    F V  ++EG+
Sbjct: 7   EINLTALAHNLAQVKGFAPNSKVMAVLKANAYGHGLVTIAQHLNNADA--FAVARIDEGL 64

Query: 70  KLRLYTPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFYSKL-----MSCGVSHP 123
            LR       I +L G  +     I+   N   +I    QL    K      ++C     
Sbjct: 65  ALRAGGLTKPIVLLEGFFNKADLPILLANNFQTIIHDEYQLAALEKAKLDAPITCW---- 120

Query: 124 YALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI--ISHLACADDPSSHVNSVQLER 181
             L+V+TG +RLG++  E  +  +N   K     + +  ++H +CADD  +     Q+  
Sbjct: 121 --LKVNTGMHRLGIA-PEQFEAFYNRLQKTPNAKNSVNLMTHFSCADDVDNAKTVQQITL 177

Query: 182 FRTLISHYKGIEAS--LASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVV 236
           F  L++   GI+ +  L++S+GI+  P+ H    RPG+ LYG +   + I + H ++ V+
Sbjct: 178 FDNLVN---GIDQAHCLSNSAGIIAWPSGHGDWVRPGLMLYGVSPMANSIGQQHKLKPVM 234

Query: 237 TAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFL 296
               R+I +R   A E V YGG+ K  + + +AV A+GY DGYP       ++    V +
Sbjct: 235 RLTTRVIAVRDVPANEAVGYGGRWKSDKPTKLAVVAMGYGDGYP-----RHAKEGTPVII 289

Query: 297 GGKGFIKGYMVPILGKITMDMTMFDI-TDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
           G + +       I+G + MDM   DI  +  +I+VGD + ++GP++ ++++AL + T  Y
Sbjct: 290 GEQRY------GIVGSVAMDMISVDIGANEHNIKVGDRVTMWGPELPVEEIALCADTIPY 343

Query: 356 DLLVRIGTRYAKFY 369
           +LL  I  R +  Y
Sbjct: 344 ELLCNITPRVSYEY 357


>gi|284051398|ref|ZP_06381608.1| alanine racemase [Arthrospira platensis str. Paraca]
 gi|291568246|dbj|BAI90518.1| alanine racemase [Arthrospira platensis NIES-39]
          Length = 399

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 120/380 (31%), Positives = 177/380 (46%), Gaps = 31/380 (8%)

Query: 9   LKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           +++D  A+ NN   + + LS   R  AV+K +AYG G   +A  +   GV DF V ++ E
Sbjct: 28  VEVDRWAIANNVKQIRHLLSPETRFMAVIKADAYGHGAVSVAKIVSEIGVDDFAVATIPE 87

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQ-LTFYSKLMSCGVSHPYA 125
           G++LR    Q  I VL  +H   E K I    L P + +  Q L F   L S   S P  
Sbjct: 88  GMELRRLGIQQPILVLGAVHTADEIKAIAHWGLQPTLCTPTQALLFSETLQSIQRSLPVQ 147

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           L +DTG +RLG   ++AL+F          ++S I SH A AD     +   Q  RF+ +
Sbjct: 148 LNIDTGMSRLGTWWEQALEFVQLVRGLPNLEISGIYSHFATADIRDRTIMDQQHWRFQQV 207

Query: 186 ISHYKGIEA-----------SLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPM 232
           ++  +   +            LA+S+  L     H+ + R G+SLYG      +     +
Sbjct: 208 LAQIQEHTSLLSVPTIKPCLHLANSAATLTDRALHYDMVRVGLSLYGLYPAPHLRSVINL 267

Query: 233 QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP 292
           Q  ++  ARI  I+   AG  VSYG +    + + IAV  IGYADG P  LS        
Sbjct: 268 QPAMSIRARITQIKTIEAGCGVSYGYKFIAKQRTPIAVVGIGYADGVPRQLSNC------ 321

Query: 293 SVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVAL 348
                 K  I+G  VP +G ITMD  M D+T    ++VG+ + + G D    I  DD A 
Sbjct: 322 -----MKVLIRGQFVPQIGAITMDQLMLDVTAIPDLQVGEVVTLLGSDRHHSISADDWAQ 376

Query: 349 ASGTTNYDLLVRIGTRYAKF 368
             GT ++++L     R  + 
Sbjct: 377 QLGTISWEILCGFKHRLPRI 396


>gi|307609535|emb|CBW99033.1| hypothetical protein LPW_08181 [Legionella pneumophila 130b]
          Length = 357

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 106/372 (28%), Positives = 190/372 (51%), Gaps = 39/372 (10%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL I+ +AL +N   +  L+   +  A+VK NAYG G  ++AP L +  ++ F V  +EE
Sbjct: 6   RLVIEPSALLHNLSQIKHLAPGKKVIAMVKANAYGCGVREVAPVL-DGRIEAFGVACLEE 64

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
            + +R    +    +  G+    E  +  + +   ++    QL +   L+   + +P  +
Sbjct: 65  ALAIRALGVETSCILFQGVFSSDELSVAVENDFACILHHAQQLEW---LIKTPLPYPIKI 121

Query: 127 --QVDTGFNRLGLSLQEALDF-----THNSFNKKLGQLSLIISHLACADDPSSHVNSVQL 179
             +V+TG +RLG  + E         T    +K +G    +++HLACAD+P    N  Q+
Sbjct: 122 WVKVNTGMHRLGFKIHELQKVMGALQTCTWVDKNIG----LMTHLACADEPHRPENQQQI 177

Query: 180 ERFRTL-ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSH------PM 232
             F+ + I  ++  + S+A+S+ I+  P+ H  + RPGI LYG +   N++       P+
Sbjct: 178 SLFQEISIPGFR--QRSIANSAAIISFPDSHADVVRPGIMLYGVSPFANQNARDLSLIPV 235

Query: 233 QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP 292
              ++A   I  I    +   V YGG  K  + S I + A GY DGYP  +S    E +P
Sbjct: 236 MRFMSA---ISAIHDNPSFAQVGYGGTWKSDKPSRIGIVAAGYGDGYPRHIS----EKTP 288

Query: 293 SVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGT 352
                   +++G  V I+G+++MDM   D+T+   +E+GD ++++G  + ++ +A ++GT
Sbjct: 289 V-------WVRGREVSIVGRVSMDMLTIDLTEHPDVEIGDEVELWGTHVLVERIAKSAGT 341

Query: 353 TNYDLLVRIGTR 364
             Y+LL +I  R
Sbjct: 342 VGYELLCQISER 353


>gi|114046202|ref|YP_736752.1| alanine racemase [Shewanella sp. MR-7]
 gi|123131743|sp|Q0HYW0|ALR_SHESR RecName: Full=Alanine racemase
 gi|113887644|gb|ABI41695.1| alanine racemase [Shewanella sp. MR-7]
          Length = 358

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 107/368 (29%), Positives = 186/368 (50%), Gaps = 24/368 (6%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSV 65
           F R +I  +AL+NN   +   +  ++  AVVK N YG G   +A  L+ A    F +  +
Sbjct: 4   FPRAEISSSALQNNLAVLRQQASRSQVMAVVKANGYGHGLLNVANCLHTA--DGFGLARL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE ++LR    +AR+ +L G     +  ++   ++  V+    Q+     L    +S P 
Sbjct: 62  EEALELRAGGVKARLLLLEGFFRSTDLPLLVAHDIDTVVHHESQIEM---LEQATLSKPV 118

Query: 125 A--LQVDTGFNRLGLSLQE-ALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+VD+G +RLG++ ++ A  +   +    + +   +++H ACAD+P ++   VQ++ 
Sbjct: 119 TVWLKVDSGMHRLGVTPEQFAQVYARLTACDNVAKPIHLMTHFACADEPENNYTQVQMQT 178

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGG---TDKINKSHPMQTVVTA 238
           F  L +   G   +LA+S+G L  P       RPGI+LYG    T     +H +   +  
Sbjct: 179 FNQLTADLPGFR-TLANSAGALYWPKSQGDWIRPGIALYGVSPVTGDCGANHGLIPAMNL 237

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            +R+I +R   AG+ V YG      +D+ + V AIGY DGYP         ++P    G 
Sbjct: 238 VSRLIAVRDHKAGQPVGYGCYWTAKQDTRLGVVAIGYGDGYP--------RNAPE---GT 286

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             ++ G  VPI+G+++MDM   D+    + +VGD   ++G  + +++VA   GT  Y+L+
Sbjct: 287 PVWVNGRRVPIVGRVSMDMLTVDLGADAADQVGDEALLWGAALPVEEVAEHIGTIAYELV 346

Query: 359 VRIGTRYA 366
            ++  R A
Sbjct: 347 TKLTPRVA 354


>gi|237807335|ref|YP_002891775.1| alanine racemase [Tolumonas auensis DSM 9187]
 gi|237499596|gb|ACQ92189.1| alanine racemase [Tolumonas auensis DSM 9187]
          Length = 358

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 112/369 (30%), Positives = 186/369 (50%), Gaps = 28/369 (7%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           R++I+L AL++N+  +   S  ++  AV+K NAYG     +A  L  A    F V  +EE
Sbjct: 6   RIQINLKALQHNFEKIKKCSPKSKIIAVIKGNAYGHDAVLVAKTLQQADA--FAVARIEE 63

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIF-DTNLIPVISSVPQLTFYSKLMSCGVSHPYA- 125
            V LR    +  I +L G    ++ +I       PVI    QL   + ++S  +  P   
Sbjct: 64  AVVLRQAGIERPIVLLEGCFCAKDLLIAAHYQFQPVIHHAGQL---ADILSASLPTPVKV 120

Query: 126 -LQVDTGFNRLGLSLQEALDFT---HNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            L++DTG +R+G+  ++   +     NS N   G +  + SH   AD+ S+     QL  
Sbjct: 121 WLKIDTGMHRIGIMPEQVAHYVTQLSNSANVS-GHVGFV-SHFYRADELSASTTHEQLAC 178

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG---GTDKINKSHPMQTVVTA 238
           F    + Y G E SL++S+G+L   + HF   RPGI+LYG     D    +  +Q V+T 
Sbjct: 179 FIQATAPYPG-EKSLSNSAGVLYWSDAHFDWVRPGIALYGISPRADSTGIAEGLQPVMTL 237

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           ++ +I +R+  AGE + YGG     +D+ I V A+GY DGYP          +P+   G 
Sbjct: 238 KSTLISVREHKAGESIGYGGHWIADQDTRIGVIAMGYGDGYP--------RMAPA---GT 286

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
              + G  V + G+++MDM   D+      ++GD + ++G  +  ++VA   GT  Y+L+
Sbjct: 287 PVLVNGRKVALAGRVSMDMMTVDLGPESQDQIGDEVTLWGNGLPAEEVARHIGTIAYELV 346

Query: 359 VRIGTRYAK 367
           ++I +R  +
Sbjct: 347 IKITSRVQR 355


>gi|120600208|ref|YP_964782.1| alanine racemase [Shewanella sp. W3-18-1]
 gi|254802384|sp|A1RNI3|ALR_SHESW RecName: Full=Alanine racemase
 gi|120560301|gb|ABM26228.1| alanine racemase [Shewanella sp. W3-18-1]
          Length = 358

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 106/368 (28%), Positives = 186/368 (50%), Gaps = 24/368 (6%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSV 65
           F R +I  +AL+NN   +   +  ++  AVVK N YG G   +A  L NA    F +  +
Sbjct: 4   FPRAEISSSALQNNLAVLRQQARASQVMAVVKANGYGHGLLNVANCLVNA--DGFGLARL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE ++LR    +AR+ +L G     +  ++   ++  V+    Q+    ++    ++ P 
Sbjct: 62  EEALELRAGGVKARLLLLEGFFRSTDLPLLVAHDIDTVVHHESQIEMLEQVK---LTKPV 118

Query: 125 A--LQVDTGFNRLGLSLQE-ALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+VD+G +RLG++ ++ A  +        + +   +++H ACAD+P +H   VQ+  
Sbjct: 119 TVWLKVDSGMHRLGVTPEQFATVYARLMACPNIAKPIHLMTHFACADEPDNHYTDVQMAA 178

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQTVVTA 238
           F  L +   G   +LA+S+G L  P       RPGI+LYG +        +H +   +  
Sbjct: 179 FNELTAGLPGFR-TLANSAGALYWPKSQGDWIRPGIALYGVSPVAGDCGTNHGLIPAMNL 237

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            +R+I +R   A + V YG      +D+ + V AIGY DGYP         ++P    G 
Sbjct: 238 VSRLIAVRDHKANQPVGYGCYWTAKQDTRLGVVAIGYGDGYP--------RNAPE---GT 286

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             ++ G  VPI+G+++MDM   D+    + +VGD + ++G D+ +++VA   GT  Y+L+
Sbjct: 287 PVWVNGRRVPIVGRVSMDMLTVDLGQDATDKVGDDVLLWGQDLPVEEVAERIGTIAYELV 346

Query: 359 VRIGTRYA 366
            ++  R A
Sbjct: 347 TKLTPRVA 354


>gi|212212678|ref|YP_002303614.1| alanine racemase, biosynthetic [Coxiella burnetii CbuG_Q212]
 gi|226711037|sp|B6J0J1|ALR_COXB2 RecName: Full=Alanine racemase
 gi|212011088|gb|ACJ18469.1| alanine racemase, biosynthetic [Coxiella burnetii CbuG_Q212]
          Length = 364

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 113/370 (30%), Positives = 186/370 (50%), Gaps = 37/370 (10%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I++TALK+N   + AL+  +   A++K N YG G  ++A AL +A    F V  ++E + 
Sbjct: 8   INVTALKHNLSQIKALAPKSLAWAMIKSNGYGHGLVRVAKALSDANA--FGVACIDEALT 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR    ++ I V+ G +   E   F  + L  VI    Q++   K  +   S    L++D
Sbjct: 66  LREVGIKSPIIVMKGFYNEAELSQFARHRLGAVIHCSDQVSLLKK-TNLTSSLSVWLKID 124

Query: 130 TGFNRLGLSLQEALDF-----THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           TG NRLG S++++        T +S  K +G    +++HLA AD+ +     +Q++RF +
Sbjct: 125 TGMNRLGFSVEQSPAVYNQLKTSSSIQKPIG----LMTHLADADNENKTFTELQIKRFFS 180

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT----------DKINKSHPMQT 234
           +     G   S+ +S+G    PN      RPGI LYG +          +KI K    + 
Sbjct: 181 VTEKMIG-PKSIVNSAGFFAYPNALVDWIRPGIILYGISPFGINYNSFKEKIEKK--FRP 237

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           V+T  A+II I+     + V YG       D  IA+ +IGY DGYP         H+PS 
Sbjct: 238 VMTLSAKIIAIKNRRKNDSVGYGCTWSCPEDMPIAIVSIGYGDGYP--------RHAPS- 288

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTN 354
             G    + G + P++G+++MDM   D+    + +VGD + ++G  + ++ +A  +GT  
Sbjct: 289 --GTPVLLNGKICPLIGRVSMDMIAIDLRSQPNAQVGDDVILWGEGLPVEIIAEKAGTIA 346

Query: 355 YDLLVRIGTR 364
           Y+LL +I  R
Sbjct: 347 YELLCKITQR 356


>gi|29654196|ref|NP_819888.1| alanine racemase, biosynthetic [Coxiella burnetii RSA 493]
 gi|165918546|ref|ZP_02218632.1| alanine racemase [Coxiella burnetii RSA 334]
 gi|81839075|sp|Q83D71|ALR_COXBU RecName: Full=Alanine racemase
 gi|29541462|gb|AAO90402.1| alanine racemase, biosynthetic [Coxiella burnetii RSA 493]
 gi|165917792|gb|EDR36396.1| alanine racemase [Coxiella burnetii RSA 334]
          Length = 364

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 113/370 (30%), Positives = 186/370 (50%), Gaps = 37/370 (10%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I++TALK+N   + AL+  +   A++K N YG G  ++A AL +A    F V  ++E + 
Sbjct: 8   INVTALKHNLSQIKALAPKSLAWAMIKSNGYGHGLVRVAKALSDANA--FGVACIDEALT 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR    ++ I V+ G +   E   F  + L  VI    Q++   K  +   S    L++D
Sbjct: 66  LREVGIKSPIIVMKGFYNEAELSQFARHRLGAVIHCSDQVSLLEK-TNLTSSLSVWLKID 124

Query: 130 TGFNRLGLSLQEALDF-----THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           TG NRLG S++++        T +S  K +G    +++HLA AD+ +     +Q++RF +
Sbjct: 125 TGMNRLGFSVEQSPAVYNQLKTSSSIQKPIG----LMTHLADADNENKTFTELQIKRFFS 180

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT----------DKINKSHPMQT 234
           +     G   S+ +S+G    PN      RPGI LYG +          +KI K    + 
Sbjct: 181 VTEKMIG-PKSIVNSAGFFAYPNALVDWIRPGIILYGISPFGINYNSFKEKIEKK--FRP 237

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           V+T  A+II I+     + V YG       D  IA+ +IGY DGYP         H+PS 
Sbjct: 238 VMTLSAKIIAIKNRRQNDSVGYGCTWSCPEDMPIAIVSIGYGDGYP--------RHAPS- 288

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTN 354
             G    + G + P++G+++MDM   D+    + +VGD + ++G  + ++ +A  +GT  
Sbjct: 289 --GTPVLLNGKICPLIGRVSMDMIAIDLRSQPNAQVGDDVILWGEGLPVEIIAEKAGTIA 346

Query: 355 YDLLVRIGTR 364
           Y+LL +I  R
Sbjct: 347 YELLCKITQR 356


>gi|86606130|ref|YP_474893.1| alanine racemase [Synechococcus sp. JA-3-3Ab]
 gi|86554672|gb|ABC99630.1| alanine racemase [Synechococcus sp. JA-3-3Ab]
          Length = 429

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 115/374 (30%), Positives = 182/374 (48%), Gaps = 27/374 (7%)

Query: 9   LKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           ++ID   L+ N   + A LS +    AVVK NAYG G   +AP    AG +   V ++ E
Sbjct: 60  VEIDAAQLRENLRLLQARLSPDTEIWAVVKANAYGHGARLVAPIALAAGAKGLCVATLAE 119

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMS-CGVSHPYA 125
           G++LR    QA I VL  ++   E +      L   ++   Q+    ++    G   P  
Sbjct: 120 GIELRQAGLQAPILVLGALNTWAELQQAMAARLEVSLTRAEQIPVMRQVARWAGRPVPVH 179

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           + VDTG  RLG+  QEA             +   + SH A AD+P S V + Q  RF  +
Sbjct: 180 VNVDTGMTRLGIPWQEAAAVWGQICRIPELEGCSLFSHFATADEPDSPVMAQQEARFAQV 239

Query: 186 ISHYKGIEASLA-----SSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP-MQTVVTAE 239
           +   +     L      +S+G L+  + H+   R G++LYG +   +   P ++ ++  +
Sbjct: 240 VEQIRQAGDPLPPLHLDNSAGALI--HLHYPRVRLGLALYGLSPAPHLQVPGLRPILRLK 297

Query: 240 ARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGK 299
           AR+  I+   A   VSYG +   +R S IA  AIGYADG P  LSG         +L  +
Sbjct: 298 ARLTHIQTVPAHTGVSYGHRYVTSRPSRIATLAIGYADGIPRRLSG---------WL--R 346

Query: 300 GFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDI-----KLDDVALASGTTN 354
           G+++G ++  +G ITMD  M+D+T+   I+VGD +++ GP +      + D A   GT +
Sbjct: 347 GWVRGSLIQQVGTITMDQCMWDVTERPDIQVGDVVELLGPHLASAGFSIQDWADQLGTIS 406

Query: 355 YDLLVRIGTRYAKF 368
           Y+LL  +  R  + 
Sbjct: 407 YELLCGLSARLPRV 420


>gi|261867673|ref|YP_003255595.1| alanine racemase [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293392262|ref|ZP_06636596.1| alanine racemase [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|261413005|gb|ACX82376.1| alanine racemase [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290952796|gb|EFE02915.1| alanine racemase [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 360

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 115/371 (30%), Positives = 184/371 (49%), Gaps = 32/371 (8%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK+N  ++   +  ++  AVVK NAYG G   ++ A+ N  V  F V  +EE +
Sbjct: 9   KISSVALKHNIQTIKQKAPESKIIAVVKANAYGHGVVFVSSAVENL-VDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
           KLR       I +L G    ++  ++   N+  V+ S  QL     L      +P    L
Sbjct: 68  KLRSNGITKPILLLEGFFSAKDLPVLAVNNIQTVVHSQEQL---DALEQAKTPNPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLE 180
           ++DTG +RLG+ L E      ++F +KL  L  +      +SH + AD+ +      QL 
Sbjct: 125 KIDTGMHRLGVHLDEV-----DAFYQKLKSLPCVDPNIGFVSHFSRADELACGYTEKQLA 179

Query: 181 RFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQTVVTA 238
           RF    +  KG E S+++S GIL   + H    RPGI +YG    +   K + +  V+  
Sbjct: 180 RFLQA-TEGKGGERSISASGGILFWQDAHLDWIRPGIIMYGISPNNTAGKEYGLIPVMNL 238

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            + +I +R+   GE V YGG     +D+ I V AIGY DGYP      D      V+L G
Sbjct: 239 TSSLIAVREHKKGEPVGYGGVWMSDKDTKIGVVAIGYGDGYPR-----DVPEGTPVYLNG 293

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
           +       VPI+GK++MDM   D+      +VGD + ++G ++ ++++A  +G  +Y+L+
Sbjct: 294 R------RVPIVGKVSMDMLTVDLGADSQDKVGDEVILWGKELPIEEIAAITGVISYELI 347

Query: 359 VRIGTRYAKFY 369
            ++  R    Y
Sbjct: 348 TKLTPRVLTEY 358


>gi|67458471|ref|YP_246095.1| alanine racemase [Rickettsia felis URRWXCal2]
 gi|75537059|sp|Q4UNC8|ALR_RICFE RecName: Full=Alanine racemase
 gi|67004004|gb|AAY60930.1| Alanine racemase [Rickettsia felis URRWXCal2]
          Length = 462

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 129/468 (27%), Positives = 195/468 (41%), Gaps = 119/468 (25%)

Query: 9   LKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLG------------------------ 44
           L+I+L+A+KNN+  +  +   +   A VK N YGLG                        
Sbjct: 6   LEINLSAIKNNYLLLQDICKTSLVGAAVKANGYGLGAVQISKALIEENCRHFFVASSEEG 65

Query: 45  -----------------CEK--------------IAPALYN--AGVQDFFVTSVEEGVKL 71
                            CEK              ++   +N  +G+Q  F     +G  +
Sbjct: 66  VNLRKALASWHESVFRHCEKNYTVIRRSNPVKNSVSQNFFNYFSGLQQCFAPR-NDGSSI 124

Query: 72  RLYTPQA-----RIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH-PYA 125
              TP+A      I VL G+       + + NL PV++++ Q+  + K  +      P  
Sbjct: 125 HATTPKALDNDVNILVLNGVFEHDALELIEYNLTPVLNNLKQIEIWQKFSNLKNRLLPCY 184

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTL 185
           L  +TG NRLGL+  E     +N    K   L  IISHLA +++  +  N  QL RF+T 
Sbjct: 185 LHFNTGINRLGLTHNEIEQLINNRDLLKGLDLQYIISHLAVSEEIDNPYNLEQLNRFKTY 244

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP-------------- 231
           + ++  ++ASLA+S GI LG +YHF L RPG +LYG    I+ S+               
Sbjct: 245 LQYFPNVKASLANSGGIFLGQDYHFDLARPGAALYGLNPVIDLSNNLSYKEEFEGDTERR 304

Query: 232 ----------------------------MQTVVTAEARIILIRKALAGELVSYGGQKKLT 263
                                       +Q  VT +A II ++       + Y       
Sbjct: 305 TAAYINVREDSSTGSTYKLPLEGGYSRGLQNPVTLKAPIIHLQNLTLDSHIGYNMTFTTE 364

Query: 264 RDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDIT 323
           RDS+IA   +GYADG+    S             G+ FI G  VPI+G+I+MD+   D+T
Sbjct: 365 RDSVIATLPLGYADGFSRNFSN-----------QGEVFINGRSVPIVGRISMDLINIDVT 413

Query: 324 D--SLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFY 369
           D   L I +G   +I G     D +A   GT  Y++L  +G+RY + Y
Sbjct: 414 DLPPLDIFLGQEAEIIGNYCTPDKIASIIGTIGYEVLTSLGSRYKRIY 461


>gi|296106326|ref|YP_003618026.1| alanine racemase [Legionella pneumophila 2300/99 Alcoy]
 gi|295648227|gb|ADG24074.1| alanine racemase [Legionella pneumophila 2300/99 Alcoy]
          Length = 357

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 106/372 (28%), Positives = 190/372 (51%), Gaps = 39/372 (10%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL I+ +AL +N   +  L+   +  A+VK NAYG G  ++AP L +  ++ F V  +EE
Sbjct: 6   RLVIEPSALLHNLSQIKHLAPGKKVIAMVKANAYGCGVREVAPVL-DGRIEAFGVACLEE 64

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
            + +R    +    +  G+    E  +  + +   ++    QL +   L+   + +P  +
Sbjct: 65  ALAIRALGVETPCILFQGVFSSDELSVAVENDFACILHHAQQLEW---LIKTPLPYPIKI 121

Query: 127 --QVDTGFNRLGLSLQEALDF-----THNSFNKKLGQLSLIISHLACADDPSSHVNSVQL 179
             +V+TG +RLG  + E         T    +K +G    +++HLACAD+P    N  Q+
Sbjct: 122 WVKVNTGMHRLGFKIHELQKVMGALQTCTWVDKNIG----LMTHLACADEPHRPENQQQI 177

Query: 180 ERFRTL-ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSH------PM 232
             F+ + I  ++  + S+A+S+ I+  P+ H  + RPGI LYG +   N++       P+
Sbjct: 178 SLFQEISIPGFR--QRSIANSAAIISFPDSHADVVRPGIMLYGVSPFANQNARDLSLIPV 235

Query: 233 QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP 292
              ++A   I  I    +   V YGG  K  + S I + A GY DGYP  +S    E +P
Sbjct: 236 MRFMSA---ISAIHDNPSFAQVGYGGTWKSDKPSRIGIVAAGYGDGYPRHIS----EKTP 288

Query: 293 SVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGT 352
                   +++G  V I+G+++MDM   D+T+   +E+GD ++++G  + ++ +A ++GT
Sbjct: 289 V-------WVRGREVSIVGRVSMDMLTIDLTEHPDVEIGDEVELWGTHVLVERIAKSAGT 341

Query: 353 TNYDLLVRIGTR 364
             Y+LL +I  R
Sbjct: 342 VGYELLCQISER 353


>gi|238752148|ref|ZP_04613630.1| Alanine racemase 1 [Yersinia rohdei ATCC 43380]
 gi|238709621|gb|EEQ01857.1| Alanine racemase 1 [Yersinia rohdei ATCC 43380]
          Length = 359

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 116/366 (31%), Positives = 187/366 (51%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +  ++  +R  AVVK NAYG G  + A  L +A    + V  + E + 
Sbjct: 8   IDRRALRHNLQQVRRMAPQSRLIAVVKANAYGHGLLETAHTLQDADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHP--YALQ 127
           LR       I +L G    ++  +   N I   + S+ QL     L +  +S P    ++
Sbjct: 66  LRSGGIVKPILLLEGFFAAEDLPVLVANRIETAVHSIEQL---EALEAAELSAPINVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++A  F    S  K + Q   I+SH + AD+P       QL+ F +  
Sbjct: 123 LDTGMHRLGVRPEQAEAFYQRLSDCKNVIQPVNIMSHFSRADEPLIETTRQQLDCFDSFA 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT--DKINKSH-PMQTVVTAEARII 243
           +   G + S+A+S GILL P  H    RPGI LYG +  D+   SH  +   +  ++ +I
Sbjct: 183 TGKPG-KQSIAASGGILLWPEAHRDWVRPGIILYGVSPMDEPYASHFNLLPAMALKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+  AGE V YGG     RD+ + V AIGY DGYP +        +PS   G    I 
Sbjct: 242 AVREHKAGESVGYGGTWVSERDTRLGVVAIGYGDGYPRS--------APS---GTPMLIN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  V I+G+++MDM   D+    + +VGD + ++G ++ ++ +A  +G + Y+L+ ++ +
Sbjct: 291 GREVGIVGRVSMDMISVDLGPDATDKVGDEVLLWGAELPVETIAARTGISAYELITKLTS 350

Query: 364 RYAKFY 369
           R A  Y
Sbjct: 351 RVAMEY 356


>gi|168241390|ref|ZP_02666322.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|168462709|ref|ZP_02696640.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|194451208|ref|YP_002045847.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194409512|gb|ACF69731.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|195633999|gb|EDX52351.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Newport str. SL317]
 gi|205339703|gb|EDZ26467.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
          Length = 356

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIA-----EA 172

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++   SL++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCAYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLNAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|158334044|ref|YP_001515216.1| alanine racemase [Acaryochloris marina MBIC11017]
 gi|158304285|gb|ABW25902.1| alanine racemase, putative [Acaryochloris marina MBIC11017]
          Length = 386

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 120/379 (31%), Positives = 179/379 (47%), Gaps = 30/379 (7%)

Query: 5   EFLRLKIDLTALKNNWHSM-NALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVT 63
           E   + IDL AL+NN   +   L       AVVK + YG G   +A      G     V 
Sbjct: 13  ERAWVNIDLKALENNVRQIKQQLLPQTALMAVVKADGYGHGAVTVAQTALANGATWLGVA 72

Query: 64  SVEEGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSH 122
           ++ EG++LR     A I +L   H  QE + I    L P + S  Q   +S+ +   +  
Sbjct: 73  TILEGIELRQADINAPILILGATHTVQEIEAIVRWQLQPTLCSPEQALIFSRHLQHPL-- 130

Query: 123 PYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL--IISHLACADDPSSHVNSVQLE 180
           P  L+VDTG +RLG   Q+   F    F  +L  L +  I SHLA ADD  S     Q  
Sbjct: 131 PIHLKVDTGMSRLGPIWQQGATFI--EFVSRLPNLKIASIYSHLATADDADSSFMLQQQS 188

Query: 181 RFRTLISHYKGIEASL-----ASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQ 233
           R + ++S  +  +  L     A+S+G L+GP +H+ L R G++LYG        ++  +Q
Sbjct: 189 RLQDVLSRIQAQDIPLPKLHLANSAGTLVGPQFHYDLVRVGLALYGLYPAPHFQQAIALQ 248

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+  +ARI  I+   AG  VSY       +   +AV  IGYADG P +LS   +     
Sbjct: 249 PVMQVKARITQIKTLPAGSGVSYNHTFTTEQPLTVAVVGIGYADGVPRSLSNQMNV---- 304

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALA 349
                   I+G + P +G ITMD  M D++D  +++VG+ + I G D    I  +  A A
Sbjct: 305 -------IIRGRLAPQIGAITMDQLMVDVSDVPNLQVGEVVTILGQDGKASISAETWADA 357

Query: 350 SGTTNYDLLVRIGTRYAKF 368
            GT +Y+++     R  + 
Sbjct: 358 LGTISYEIVCGFKHRLPRI 376


>gi|194442850|ref|YP_002041058.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
 gi|194401513|gb|ACF61735.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Newport str. SL254]
          Length = 356

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 183/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHNSFN-KKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A       +  + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLWAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++   SL++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCAYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++    GE V YGG+  +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSVGERVGYGGRYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|114564506|ref|YP_752020.1| alanine racemase [Shewanella frigidimarina NCIMB 400]
 gi|122298735|sp|Q07XT3|ALR_SHEFN RecName: Full=Alanine racemase
 gi|114335799|gb|ABI73181.1| alanine racemase [Shewanella frigidimarina NCIMB 400]
          Length = 372

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 106/382 (27%), Positives = 186/382 (48%), Gaps = 43/382 (11%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPAL-----------YN 54
           F R +I   AL++N   +  ++ N++  AVVK N YG G   +A  +           Y+
Sbjct: 4   FPRAEISRYALQSNLAQLRLIAPNSKIMAVVKANGYGHGLLNVAECVGLLNYVESVCKYH 63

Query: 55  AGVQDFFVTSVEEGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYS 113
            G   F +  +EE ++LR    + ++ +L G     +   +   N+  V+    QL    
Sbjct: 64  GGADGFGLARLEEALQLREGGVKGKLLLLEGFFRQSDLPTLVSHNIDTVVHHESQLQM-- 121

Query: 114 KLMSCGVSHPYA--LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLA 165
            L +  +  P    +++DTG +R+G SL++      NS  ++L     +      ++H A
Sbjct: 122 -LETIALDKPVTVWIKIDTGMHRIGFSLEQ-----FNSIYQRLLACPQVAKPIHLMTHFA 175

Query: 166 CADDPSSHVNSVQLERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDK 225
           CAD+P + +   Q+  F   +S  +G + +LA+S+G L  P       RPGI+LYG +  
Sbjct: 176 CADEPDNPLTQTQMNAFEQQVSGLEG-DRTLANSAGTLFWPTSQADWVRPGIALYGVSPV 234

Query: 226 INK---SHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLT 282
           +     +H +   +   + +I +R+  AG+ V YG      +D+ + V AIGY DGYP  
Sbjct: 235 VGDRGVNHRLIPAMELVSNLIAVREHKAGDSVGYGASWTAKKDTRLGVVAIGYGDGYP-- 292

Query: 283 LSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIK 342
                  ++P    G   +I G  VPI+G+++MDM   D+       VGD +Q++G  + 
Sbjct: 293 ------RNAPE---GTPVWINGRRVPIVGRVSMDMLTVDLGADAQDNVGDSVQLWGKALA 343

Query: 343 LDDVALASGTTNYDLLVRIGTR 364
           +++VA   GT  Y+L+ ++  R
Sbjct: 344 VEEVAEHIGTIAYELVTKLTPR 365


>gi|238764111|ref|ZP_04625065.1| Alanine racemase 1 [Yersinia kristensenii ATCC 33638]
 gi|238697648|gb|EEP90411.1| Alanine racemase 1 [Yersinia kristensenii ATCC 33638]
          Length = 359

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 114/366 (31%), Positives = 187/366 (51%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +  ++  +R  AVVK NAYG G  + A  L +A    + V  + E + 
Sbjct: 8   IDRRALRHNLQQVRRMAPQSRLIAVVKANAYGHGLLETAHTLQDADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHP--YALQ 127
           LR       I +L G    ++  +   N I   + S+ QL     L +  +S P    ++
Sbjct: 66  LRSGGIVKPILLLEGFFAAEDLPVLVANRIETAVHSIEQL---EALEAANLSAPINVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  ++A  F    S  + + Q   I+SH + AD+P       QL+ F T  
Sbjct: 123 LDTGMHRLGVRPEQAEAFYQRLSACRNIIQPVNIMSHFSRADEPLVDTTRQQLDCFDTFA 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT--DKINKSH-PMQTVVTAEARII 243
           +   G + S+++S GILL P  H    RPGI LYG +  D+   SH  +   +  ++ +I
Sbjct: 183 ADKPG-KQSISASGGILLWPEAHRDWVRPGIILYGVSPMDEPYASHFDLLPAMALKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+  AGE V YGG     RD+ + V AIGY DGYP +        +PS   G   ++ 
Sbjct: 242 AVREHKAGEPVGYGGTWISERDTRLGVVAIGYGDGYPRS--------APS---GTPMWLN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  V I+G+++MDM   D+      +VGD + ++G ++ ++ +A  +G + Y+L+ ++ +
Sbjct: 291 GREVGIVGRVSMDMISVDLGPEAIDKVGDEVLLWGAELPVEKIAARTGISAYELITKLTS 350

Query: 364 RYAKFY 369
           R A  Y
Sbjct: 351 RVAMEY 356


>gi|294139221|ref|YP_003555199.1| alanine racemase [Shewanella violacea DSS12]
 gi|293325690|dbj|BAJ00421.1| alanine racemase, biosynthetic [Shewanella violacea DSS12]
          Length = 358

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 111/371 (29%), Positives = 185/371 (49%), Gaps = 30/371 (8%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSV 65
           F R +I   ALKNN   +  ++  ++  AVVK N YG G   +A  + +A    F +  +
Sbjct: 4   FPRAEISCKALKNNLARLRQIAPASKIMAVVKANGYGHGLLNVAKCIEDA--DGFGLARL 61

Query: 66  EEGVKLRLYTPQARIFVLYGI-HPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP- 123
           EE + LR     +++ +L G   P     +   ++  V+ +  QL     L    +S P 
Sbjct: 62  EEAIALRDGGVTSKLILLEGFFRPVDLTTLVMKDIETVVHNEKQLEM---LEQASLSKPA 118

Query: 124 -YALQVDTGFNRLGLSLQEALDFTHNSFN----KKLGQLSLIISHLACADDPSSHVNSVQ 178
              L++DTG +RLG + ++   F H         ++ +   I+SH ACAD+P +     Q
Sbjct: 119 NVWLKLDTGMHRLGFTPEQ---FEHVYARLLDCPQVAKPIKIMSHFACADEPDNPYTREQ 175

Query: 179 LERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQTV 235
           L  F  L  +  G E +LA+S+G L  P+ H    RPGISLYG +     + K+H +Q  
Sbjct: 176 LNIFNRLAKNLPG-ETTLANSAGTLYWPDSHKDWVRPGISLYGVSPVVGDLGKNHGLQPA 234

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +   +++I IR+  AG+   YG   +   ++ + V AIGY DGYP         ++P   
Sbjct: 235 MELISQLIAIREHKAGDPAGYGCYWRAKEETKLGVVAIGYGDGYP--------RNAPE-- 284

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G   ++ G +VPI+G+++MDM   D+    +  +GD   ++G  + ++ VA   GT  Y
Sbjct: 285 -GTPVWVNGRLVPIVGRVSMDMLTVDLGLDSTDSIGDEAIMWGSALPVEVVAEHIGTIAY 343

Query: 356 DLLVRIGTRYA 366
           +L+ ++  R A
Sbjct: 344 ELVTKLTPRVA 354


>gi|163803116|ref|ZP_02197000.1| alanine racemase [Vibrio sp. AND4]
 gi|159173108|gb|EDP57940.1| alanine racemase [Vibrio sp. AND4]
          Length = 358

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 107/371 (28%), Positives = 185/371 (49%), Gaps = 34/371 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL+AL++N   +   + N++   VVK N YG G   +A    +A    F V  +EE ++
Sbjct: 8   IDLSALQHNLQRVKQQAPNSKVMVVVKANGYGHGLRHVAKHATHADA--FGVARIEEALQ 65

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G +  G   ++   N+  V+    QL   + L    +  P    L+
Sbjct: 66  LRACGVVKPILLLEGFYSLGDLPVLVTNNIQTVVHCEEQL---AALEQADLETPVVVWLK 122

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLER 181
           +D+G +RLG+  ++     ++ F  +L +   +      +SH  CAD+  + + + Q++ 
Sbjct: 123 IDSGMHRLGVRPEQ-----YDEFISRLKECPNVAKPLRYMSHFGCADELDNKITTEQIDL 177

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTA 238
           F +L +  +G E SLA+S+G+L  P       RPGI +YG +   +K  +    + V+T 
Sbjct: 178 FMSLTAGCQG-ERSLAASAGLLAWPQSQLDWVRPGIIMYGVSPFGEKTAQDMGYKPVMTL 236

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           ++ +I +R    G  V YGG     RD+ + V A+GY DGYP T        +P+   G 
Sbjct: 237 KSHLIAVRDVKKGASVGYGGIWTSERDTKVGVIAVGYGDGYPRT--------APN---GT 285

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
              + G  VPI G+++MDM   D+    + +V D   ++G D+ +++VA   GT  Y+L+
Sbjct: 286 PVLVNGRKVPIAGRVSMDMLTVDLGPDATDKVSDEAILWGKDLPVEEVASHIGTIGYELV 345

Query: 359 VRIGTRYAKFY 369
            ++ +R    Y
Sbjct: 346 TKLTSRVEMEY 356


>gi|126659612|ref|ZP_01730742.1| alanine racemase [Cyanothece sp. CCY0110]
 gi|126619058|gb|EAZ89797.1| alanine racemase [Cyanothece sp. CCY0110]
          Length = 402

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 124/387 (32%), Positives = 185/387 (47%), Gaps = 33/387 (8%)

Query: 2   HSNEFLR----LKIDLTALKNNWHSMNAL-SGNARTAAVVKDNAYGLGCEKIAPALYNAG 56
           H +E +R    ++IDL+AL +N   +  L S      AVVK +AYG G   +A     AG
Sbjct: 13  HLSEIIRKRAWVEIDLSALSHNVRQIKQLLSPKTALMAVVKADAYGHGAIAVAQTALQAG 72

Query: 57  VQDFFVTSVEEGVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKL 115
                V ++ EG++LR     A I +L  I+ P +   I   NL P +    Q    S+ 
Sbjct: 73  ASALAVATLGEGIELREAGITAPILILGAINTPEEIAAIAHWNLEPTLCYPEQAMVVSQT 132

Query: 116 MS-CGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL--IISHLACADDPSS 172
           +S C    P  L++DTG +RLG+   +  +F   +  K+L  L+L  + SHLA ADDP  
Sbjct: 133 LSQCEKVLPVHLKLDTGMSRLGIPWHQGTEFV--TLVKQLPYLNLRSVYSHLATADDPDP 190

Query: 173 HVNSVQLERFRTLISHYK--GI---EASLASSSGILLGPNYHFQLTRPGISLYG--GTDK 225
               +Q +RF++ I++ K  GI       A+S+  L+ P  H+ L R G+ LYG      
Sbjct: 191 SHMYLQHKRFKSAIANLKTQGIGPPRLHFANSAATLIAPQLHYDLVRVGLGLYGLYPAPH 250

Query: 226 INKSHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSG 285
           +    P++ V+  +A+I  I+       VSYG Q    R   IAV  IGYADG P  LS 
Sbjct: 251 LRSIVPLKPVLQVKAKITQIKSIPTNTGVSYGYQFVSDRPMKIAVVGIGYADGVPRNLSN 310

Query: 286 LDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----I 341
                        +  I+G  V  +G ITMD  M D++    ++VGD + + G D    I
Sbjct: 311 RL-----------QVLIQGQRVRQIGAITMDQLMLDVSHLRQVKVGDVVTLIGQDGDYEI 359

Query: 342 KLDDVALASGTTNYDLLVRIGTRYAKF 368
             D  A   GT ++++L     R  + 
Sbjct: 360 TADHWARMLGTISWEILCGFKHRLPRI 386


>gi|197247858|ref|YP_002146222.1| alanine racemase [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197211561|gb|ACH48958.1| alanine racemase [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
          Length = 356

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGAILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEAS--LASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++ S  L++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCSYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|167554127|ref|ZP_02347868.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205321605|gb|EDZ09444.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
          Length = 356

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 116/369 (31%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEAS--LASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++ S  L++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCSYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  I  R
Sbjct: 342 ELLCAIAPR 350


>gi|168237864|ref|ZP_02662922.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194736004|ref|YP_002114836.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|194711506|gb|ACF90727.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197289280|gb|EDY28647.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
          Length = 356

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGAILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRTMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++   SL++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCAYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|15893783|ref|NP_347132.1| alanine racemase [Clostridium acetobutylicum ATCC 824]
 gi|20137418|sp|Q97LR2|ALR1_CLOAB RecName: Full=Alanine racemase 1
 gi|15023352|gb|AAK78472.1|AE007563_12 Alanine racemase [Clostridium acetobutylicum ATCC 824]
 gi|325507906|gb|ADZ19542.1| alanine racemase [Clostridium acetobutylicum EA 2018]
          Length = 386

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 118/384 (30%), Positives = 186/384 (48%), Gaps = 45/384 (11%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +IDL  +  N   +   S +     VVK +AYG G   +AP L   G     V  + E V
Sbjct: 11  EIDLDNIAYNMQQIRRCSKSDEIIGVVKADAYGHGAVDVAPVLLENGANRLAVAVISEAV 70

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIP--VISSVPQLTFYSKLMSCGVSHPYALQ 127
           +LR    Q  I +L     G   +    ++I   +  +V    +  KL          L+
Sbjct: 71  ELRKSGIQCPIMIL-----GYTPLSLVDSIIKYSIEQTVFSYDYAEKLSEAARQKNITLR 125

Query: 128 V----DTGFNRLG-LSLQEALDFTHNSFNKKLGQLSLII-----SHLACADDPSSHVNSV 177
           +    DTG  R+G L  +E++   +     K+ +LS II     SH + +D+ +      
Sbjct: 126 IHIALDTGMGRIGFLPTEESVWEVY-----KISKLSNIIIEGIFSHFSTSDETNKEYTYA 180

Query: 178 QLERFRTLISHY--KGIEASL---ASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSH 230
           QL++F    +    K I+ ++    +S+ I+  P  HF+ TRPGI LYG   +++++K+ 
Sbjct: 181 QLKKFEWFYNELRKKNIKINIRHIGNSAAIMELPETHFEATRPGIILYGYYPSNEVDKNK 240

Query: 231 -PMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSE 289
             ++ ++T +  ++ I+K + GE VSYG + K  R+S+IA   +GYADGY   LSG    
Sbjct: 241 LNLKPIMTLKTNVVHIKKMMPGEYVSYGRKFKCERESIIATLPVGYADGYTRMLSG---- 296

Query: 290 HSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGP--DIKL--DD 345
                    K  I G   P++G+I MD  M DITD  S++VGD + I G   D K   DD
Sbjct: 297 -------KAKVIINGNYAPVIGRICMDQCMIDITDLPSVQVGDEVVIMGESDDKKFTADD 349

Query: 346 VALASGTTNYDLLVRIGTRYAKFY 369
           +A   GT NY+++  I  R  + Y
Sbjct: 350 MAEIIGTINYEVICMISKRVPRVY 373


>gi|157372681|ref|YP_001480670.1| alanine racemase [Serratia proteamaculans 568]
 gi|157324445|gb|ABV43542.1| alanine racemase [Serratia proteamaculans 568]
          Length = 359

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 106/364 (29%), Positives = 185/364 (50%), Gaps = 20/364 (5%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +   +  +R  AVVK NAYG G  + A  L +A    + V  + E + 
Sbjct: 8   IDRRALRHNLQQVRRQAPQSRLIAVVKANAYGHGLLETAHTLQDADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR       I +L G    ++  ++   N+   + S+ QL    +  +     P  +++D
Sbjct: 66  LRSGGIVKPILMLEGFFCAEDLPVLVANNIETAVHSIEQLEALEQ-ATLARPVPVWMKLD 124

Query: 130 TGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISH 188
           TG +RLG+  ++A  F    S  + + Q   I+SH + AD+P S     Q++ F +  + 
Sbjct: 125 TGMHRLGVRPEQAEAFYQRLSACRNVVQPVNIMSHFSRADEPESDTTLKQIQCFESFAAG 184

Query: 189 YKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS---HPMQTVVTAEARIILI 245
             G + S+A+S G LL P+ H +  RPGI LYG +         + +Q  +T ++ +I +
Sbjct: 185 KPG-QRSIAASGGTLLWPDAHNEWVRPGIILYGVSPMEGSQGCQYDLQPAMTLKSNLIAV 243

Query: 246 RKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGY 305
           R+  AGE V YGG      D+ + V A+GY DGYP +        +P+   G   ++ G 
Sbjct: 244 REHKAGESVGYGGTWVSAGDTRLGVVAMGYGDGYPRS--------APT---GTPVWLNGR 292

Query: 306 MVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRY 365
            VPI+G+++MDM   D+    + +VGD + ++G  + ++ +A  +G + Y+L+ ++  R 
Sbjct: 293 EVPIVGRVSMDMMSVDLGPEATDKVGDEVVLWGQALPVERIADCTGISAYELITKLTQRV 352

Query: 366 AKFY 369
           +  Y
Sbjct: 353 SMEY 356


>gi|16765143|ref|NP_460758.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56413279|ref|YP_150354.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|167993251|ref|ZP_02574346.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168259965|ref|ZP_02681938.1| alanine racemase [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|197362204|ref|YP_002141841.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|113661|sp|P06191|ALR2_SALTY RecName: Full=Alanine racemase, catabolic
 gi|153939|gb|AAA27054.1| alanine racemase (dadB) (EC 5.1.1.1) [Salmonella enterica subsp.
           enterica serovar Typhimurium]
 gi|16420333|gb|AAL20717.1| alanine racemase 2 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|56127536|gb|AAV77042.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197093681|emb|CAR59151.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
 gi|205328703|gb|EDZ15467.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205350739|gb|EDZ37370.1| alanine racemase [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|261246987|emb|CBG24804.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267993756|gb|ACY88641.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 14028S]
 gi|301158326|emb|CBW17825.1| Alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|312912792|dbj|BAJ36766.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
 gi|321224435|gb|EFX49498.1| Alanine racemase, catabolic [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322616798|gb|EFY13706.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322620391|gb|EFY17257.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322625707|gb|EFY22526.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626157|gb|EFY22967.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322638917|gb|EFY35610.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322640736|gb|EFY37386.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 531954]
 gi|322644122|gb|EFY40667.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649194|gb|EFY45632.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322655353|gb|EFY51661.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322660890|gb|EFY57121.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662812|gb|EFY59019.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322667996|gb|EFY64155.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322674242|gb|EFY70336.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322675403|gb|EFY71477.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322683182|gb|EFY79198.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322686875|gb|EFY82853.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323130076|gb|ADX17506.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|323195234|gb|EFZ80414.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323200174|gb|EFZ85260.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323203827|gb|EFZ88845.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323207381|gb|EFZ92329.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323213735|gb|EFZ98517.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323217366|gb|EGA02085.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323220884|gb|EGA05320.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323227984|gb|EGA12132.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323231387|gb|EGA15500.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323235827|gb|EGA19906.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323240396|gb|EGA24439.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245289|gb|EGA29289.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323249860|gb|EGA33759.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323252850|gb|EGA36686.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323257434|gb|EGA41128.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323263314|gb|EGA46850.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323266762|gb|EGA50248.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323268968|gb|EGA52424.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
 gi|332988689|gb|AEF07672.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. UK-1]
          Length = 356

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++   SL++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCAYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|238912133|ref|ZP_04655970.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Tennessee str. CDC07-0191]
          Length = 356

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++   SL++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCACSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|54293722|ref|YP_126137.1| hypothetical protein lpl0775 [Legionella pneumophila str. Lens]
 gi|81822433|sp|Q5WYG1|ALR_LEGPL RecName: Full=Alanine racemase
 gi|53753554|emb|CAH15009.1| hypothetical protein lpl0775 [Legionella pneumophila str. Lens]
          Length = 357

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 108/372 (29%), Positives = 192/372 (51%), Gaps = 39/372 (10%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL I+ +AL +N   +  L+   +  A+VK NAYG G  ++AP L +  ++ F V  +EE
Sbjct: 6   RLVIEPSALLHNLSQIKHLAPGKKVIAMVKANAYGCGVREVAPVL-DGRIEAFGVACLEE 64

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
            + +R    +    +  G+    E  +  + +   V+    QL +   L+   + +P  +
Sbjct: 65  ALAIRALGVETPCILFQGVFSSDELSVAVENDFACVLHHAKQLEW---LIKTPLPYPIKV 121

Query: 127 --QVDTGFNRLGL---SLQEALDF--THNSFNKKLGQLSLIISHLACADDPSSHVNSVQL 179
             +V+TG +RLG     LQ+ +D   T    +K +G    +++HLACAD+P    N  Q+
Sbjct: 122 WVKVNTGMHRLGFKIHELQKVMDALQTCTWVDKNIG----LMTHLACADEPHRPENQQQI 177

Query: 180 ERFRTL-ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSH------PM 232
             F+ + I  ++  + S+A+S+ I+  P+    + RPGI LYG +   N++       P+
Sbjct: 178 SLFQEISIPGFR--QRSIANSAAIISFPDSQADVVRPGIMLYGVSPFANQNARDLGLIPV 235

Query: 233 QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP 292
              ++A   I  I    +   V YGG  K  + S I + A GY DGYP  +S    E +P
Sbjct: 236 MRFMSA---ISAIHDNPSFAQVGYGGTWKSDKPSRIGIVAAGYGDGYPRHIS----EKTP 288

Query: 293 SVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGT 352
                   +++G  V I+G+++MDM   D+T+   +E+GD ++++G  + ++ +A ++GT
Sbjct: 289 V-------WVRGREVSIVGRVSMDMLTIDLTEHPDVEIGDEVELWGTHVLVERIAKSAGT 341

Query: 353 TNYDLLVRIGTR 364
             Y+LL +I  R
Sbjct: 342 IGYELLCQISER 353


>gi|329894372|ref|ZP_08270242.1| Alanine racemase [gamma proteobacterium IMCC3088]
 gi|328923168|gb|EGG30491.1| Alanine racemase [gamma proteobacterium IMCC3088]
          Length = 354

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 112/361 (31%), Positives = 176/361 (48%), Gaps = 25/361 (6%)

Query: 11  IDLTALKNN--WHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEG 68
           ID+ AL+ N  W   + L   ++   VVK +AYG   + IAPAL N     F V    EG
Sbjct: 9   IDIEALRANALWLKQHCL--GSKLMCVVKADAYGHDLKLIAPALSNIA-DGFAVAHCTEG 65

Query: 69  VKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA-L 126
           ++LR   P A I VL G     E    +  +L   +++  Q+  Y  L       P   +
Sbjct: 66  LELRAINPTAPILVLEGTFDAAELNAAYQHDLTVALTNTWQVRDY--LARPLDQRPTVWV 123

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +VDTG +RLGLS  E      ++   +L Q +++ +H + AD   +   ++QL R   L 
Sbjct: 124 KVDTGMHRLGLSETELNALCRDN---RLPQDTVLFTHFSDADT-DAEKTALQLARLTRLG 179

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIR 246
             +K +  S A+S   L+ PN H    RPG SLYGG+   +    ++ V++   RI  IR
Sbjct: 180 ERHK-LMMSAANSPACLMHPNTHLDWVRPGYSLYGGSPLAHIEDNLRPVMSVYTRIHSIR 238

Query: 247 KALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYM 306
               GE V YG      R S IA   IGYADGYP ++             G K ++    
Sbjct: 239 SLPVGECVGYGSTWCAERASKIATLPIGYADGYPRSIKS-----------GTKVWLHNQF 287

Query: 307 VPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYA 366
            P++G+++MD+   D+TD  + + GD ++++G  + L  +A  +  + Y+++ RI  R  
Sbjct: 288 APVVGRVSMDLLTIDVTDIPAAKAGDLVEVWGQHMTLHALANHNELSGYEIMARIPKRLP 347

Query: 367 K 367
           +
Sbjct: 348 R 348


>gi|52840976|ref|YP_094775.1| hypothetical protein lpg0739 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54296765|ref|YP_123134.1| hypothetical protein lpp0804 [Legionella pneumophila str. Paris]
 gi|81822627|sp|Q5X709|ALR_LEGPA RecName: Full=Alanine racemase
 gi|81823455|sp|Q5ZXJ2|ALR_LEGPH RecName: Full=Alanine racemase
 gi|52628087|gb|AAU26828.1| alanine racemase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|53750550|emb|CAH11952.1| hypothetical protein lpp0804 [Legionella pneumophila str. Paris]
          Length = 357

 Score =  149 bits (377), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 108/372 (29%), Positives = 189/372 (50%), Gaps = 39/372 (10%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL I+ +AL +N   +  L+   +  A+VK NAYG G  ++AP L +  ++ F V  +EE
Sbjct: 6   RLVIEPSALLHNLSQIKHLAPGKKVIAMVKANAYGCGVREVAPVL-DGRIEAFGVACLEE 64

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
            + +R    +    +  G+    E  +  + +   V+    QL +   L+   + +P  +
Sbjct: 65  ALAIRALGVETPCILFQGVFSSDELSVAVENDFACVLHHAQQLEW---LIKTPLPYPIKV 121

Query: 127 --QVDTGFNRLGLSLQEALDF-----THNSFNKKLGQLSLIISHLACADDPSSHVNSVQL 179
             +V+TG +RLG  + E         T    +K +G    +++HLACAD+P    N  Q+
Sbjct: 122 WVKVNTGMHRLGFKIHELQKVMGALQTCTWVDKSIG----LMTHLACADEPHRPENQQQI 177

Query: 180 ERFRTL-ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSH------PM 232
             F+ + I  ++  + S+A+S+ I+  P+    + RPGI LYG +   N++       P+
Sbjct: 178 SLFQEISIPGFR--QRSIANSAAIISFPDSQADVVRPGIMLYGVSPFANQNAHDLGLIPV 235

Query: 233 QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP 292
              ++A   I  I    +   V YGG  K  + S I V A GY DGYP  +S    E +P
Sbjct: 236 MRFMSA---ISAIHDNPSFAQVGYGGTWKSDKPSRIGVVAAGYGDGYPRHIS----EKTP 288

Query: 293 SVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGT 352
                   +++G  V I+G+++MDM   D+T+   IE+GD ++++G  + ++ +A ++GT
Sbjct: 289 V-------WVRGREVSIVGRVSMDMLTIDLTEHPDIEIGDEVELWGTHVLVERIAKSAGT 341

Query: 353 TNYDLLVRIGTR 364
             Y+LL +I  R
Sbjct: 342 VGYELLCQISER 353


>gi|117919166|ref|YP_868358.1| alanine racemase [Shewanella sp. ANA-3]
 gi|254802382|sp|A0KT33|ALR_SHESA RecName: Full=Alanine racemase
 gi|117611498|gb|ABK46952.1| alanine racemase [Shewanella sp. ANA-3]
          Length = 358

 Score =  149 bits (377), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 107/368 (29%), Positives = 183/368 (49%), Gaps = 24/368 (6%)

Query: 6   FLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSV 65
           F R +I  +AL+NN   +   +  ++  AVVK N YG G   +A  L+ A    F +  +
Sbjct: 4   FPRAEISSSALQNNLAVLRQQASRSQVMAVVKANGYGHGLLNVANCLHTA--DGFGLARL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE ++LR    +AR+ +L G     +  ++   ++  V+    Q+     L    +S P 
Sbjct: 62  EEALELRAGGVKARLLLLEGFFRSTDLPLLVAHDIDTVVHHESQIEM---LEQATLSKPV 118

Query: 125 A--LQVDTGFNRLGLSLQEALD-FTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+VD+G +RLG++ ++    +        + +   +++H ACAD+P +H   VQ++ 
Sbjct: 119 TVWLKVDSGMHRLGVTPEQFTQVYARLMACDNVAKPIHLMTHFACADEPENHYTQVQMQT 178

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGG---TDKINKSHPMQTVVTA 238
           F  L +   G   +LA+S+G L  P       RPGI+LYG    T     +H +   +  
Sbjct: 179 FNQLTADLPGFR-TLANSAGALYWPKSQGDWIRPGIALYGVSPVTGDCGANHGLIPAMNL 237

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            +R+I +R   AG+ V YG      +D+ + V AIGY DGYP         ++P    G 
Sbjct: 238 VSRLIAVRDHKAGQPVGYGCYWTAKQDTRLGVVAIGYGDGYP--------RNAPE---GT 286

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             ++ G  VPI+G+++MDM   D+    +  VGD   ++G  + +++VA   GT  Y+L+
Sbjct: 287 PVWVNGRRVPIVGRVSMDMLTVDLGADATDLVGDEALLWGAALPVEEVAEHIGTIAYELV 346

Query: 359 VRIGTRYA 366
            ++  R A
Sbjct: 347 TKLTPRVA 354


>gi|253702117|ref|YP_003023306.1| alanine racemase [Geobacter sp. M21]
 gi|259710067|sp|C6E5Z6|ALR_GEOSM RecName: Full=Alanine racemase
 gi|251776967|gb|ACT19548.1| alanine racemase [Geobacter sp. M21]
          Length = 379

 Score =  149 bits (377), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 114/378 (30%), Positives = 179/378 (47%), Gaps = 30/378 (7%)

Query: 9   LKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           ++IDL AL++N+  +   +       AVVK +AYG G + ++  L   GV  F V  + E
Sbjct: 8   VEIDLAALRHNFSLVQKRVPEGCGLLAVVKADAYGHGFQYVSEELEKLGVDAFAVAFLAE 67

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSV---PQLTFYSKLMSCGVSHPY 124
           GV+LR+      + +L GI+PG+E+ +   N+   + S+     L   +  + C      
Sbjct: 68  GVQLRMSGITRPVLILGGIYPGEERRLIGLNISTALFSLEQAAALDQAALEIKCYRKAHI 127

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACAD--DPSS-HVNSVQLER 181
            L+VDTG  RLG+   E  +F       K  +L  I SH A AD  DP       +Q ER
Sbjct: 128 HLKVDTGMGRLGVPYHEVPEFLAKLKQFKNLELEGIFSHFASADELDPEGIAFTRLQAER 187

Query: 182 FRTLISH-----YKGIEASLASSSGILLGPNYHFQLTRPGISLYGG--TDKINKSHPMQT 234
           F   +       Y      +A+S+ IL     +  L RPGI LYG   +       P Q 
Sbjct: 188 FNAAVEEARRQGYAPSYVHVANSAAILAQDLPYCNLARPGIILYGALPSGDFEGQVPSQP 247

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           V+  ++R+ +++    G  +SYG +   T  +LIA   +GYADGY  +L+          
Sbjct: 248 VMRLKSRVAMLKWVEPGTSISYGRRYVATERALIASVPVGYADGYCRSLTN--------- 298

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD-----IKLDDVALA 349
              G+  I+G    + G + MD  M D+T+   + VGD + + GPD     I  +++A  
Sbjct: 299 --KGEALIRGQRAKVAGTVCMDWIMLDVTNVKGVAVGDDVTLLGPDPMGDCISAEEMAEK 356

Query: 350 SGTTNYDLLVRIGTRYAK 367
           +GT  Y++L  I TR  +
Sbjct: 357 AGTIPYEVLCGIATRRVR 374


>gi|200389510|ref|ZP_03216121.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
 gi|199601955|gb|EDZ00501.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Virchow str. SL491]
          Length = 356

 Score =  149 bits (377), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++   SL++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCAHSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|284006501|emb|CBA71762.1| alanine racemase (biosynthetic) [Arsenophonus nasoniae]
          Length = 361

 Score =  149 bits (377), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 117/367 (31%), Positives = 185/367 (50%), Gaps = 24/367 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I   AL++N   +  ++ ++R  AVVK NAYG G  + A  + +     F V  + E + 
Sbjct: 8   IHRRALRHNLQRVREIASHSRIIAVVKANAYGHGLLETAHTVKDLA-DSFGVARISEAIA 66

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     E  I   + I  V+ S+ QL     L    +  P    ++
Sbjct: 67  LRENGISNPILLLEGFFDLAELPIITRHAIDIVVQSIEQL---ETLEQIKLEKPIKVWMK 123

Query: 128 VDTGFNRLGLSLQEA-LDFTHNSFNKKLGQLSLIISHLACADDPS-SHVNSVQLERFRTL 185
           +DTG +RLG   +EA + +      + + +   I+SH + AD+P      + QL  F   
Sbjct: 124 LDTGMHRLGFRPEEAAISYARLVACQNIQKPINIMSHFSRADEPGLPAATNQQLTCFNVF 183

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQTVVTAEARI 242
           I    G E S+A+S+GILL P  +F   RPGI +YG +    K  K   +  V+T ++ +
Sbjct: 184 IKDKPG-EKSIAASAGILLWPASYFDWVRPGIMMYGASPQEGKQGKDFGLLPVMTLKSNL 242

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
           I IR+  AGE V YGG     +D+ + V AIGY DGYP         ++PS   G    I
Sbjct: 243 IAIRQHKAGEPVGYGGVWVSEQDTNLGVVAIGYGDGYP--------RNAPS---GTPILI 291

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
            G  VPI+G+++MDM   D+    + +VGD   ++G  + +++VA  +G ++Y+LL ++ 
Sbjct: 292 NGRKVPIVGRVSMDMISVDLGVGTNDKVGDEAIMWGDLLPVEEVAAYTGVSDYELLTKLT 351

Query: 363 TRYAKFY 369
           +R A  Y
Sbjct: 352 SRVAMEY 358


>gi|161613692|ref|YP_001587657.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi B str. SPB7]
 gi|168820548|ref|ZP_02832548.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|161363056|gb|ABX66824.1| hypothetical protein SPAB_01417 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|205342561|gb|EDZ29325.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|320085692|emb|CBY95470.1| alanine racemase 2, catabolic [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 356

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEAS--LASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++ S  L++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCSYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|154706770|ref|YP_001424314.1| alanine racemase, biosynthetic [Coxiella burnetii Dugway 5J108-111]
 gi|189027532|sp|A9KFM0|ALR_COXBN RecName: Full=Alanine racemase
 gi|154356056|gb|ABS77518.1| alanine racemase, biosynthetic [Coxiella burnetii Dugway 5J108-111]
          Length = 364

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 112/370 (30%), Positives = 185/370 (50%), Gaps = 37/370 (10%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           I++TALK+N   + AL+  +    ++K N YG G  ++A AL +A    F V  ++E + 
Sbjct: 8   INVTALKHNLSQIKALAPKSLAWVMIKSNGYGHGLVRVAKALSDANA--FGVACIDEALT 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR    ++ I V+ G +   E   F  + L  VI    Q++   K  +   S    L++D
Sbjct: 66  LREVGIKSPIIVMKGFYNEAELSQFARHRLGAVIHCSDQVSLLEK-TNLTSSLSVWLKID 124

Query: 130 TGFNRLGLSLQEALDF-----THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           TG NRLG S++++        T +S  K +G    +++HLA AD+ +     +Q++RF +
Sbjct: 125 TGMNRLGFSVEQSPAVYNQLKTSSSIQKPIG----LMTHLADADNENKTFTELQIKRFFS 180

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT----------DKINKSHPMQT 234
           +     G   S+ +S+G    PN      RPGI LYG +          +KI K    + 
Sbjct: 181 VTEKMIG-PKSIVNSAGFFAYPNALVDWIRPGIILYGISPFGINYNSFKEKIEKK--FRP 237

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           V+T  A+II I+     + V YG       D  IA+ +IGY DGYP         H+PS 
Sbjct: 238 VMTLSAKIIAIKNRRQNDSVGYGCTWSCPEDMPIAIVSIGYGDGYP--------RHAPS- 288

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTN 354
             G    + G + P++G+++MDM   D+    + +VGD + ++G  + ++ +A  +GT  
Sbjct: 289 --GTPVLLNGKICPLIGRVSMDMIAIDLRSQPNAQVGDDVILWGEGLPVEIIAEKAGTIA 346

Query: 355 YDLLVRIGTR 364
           Y+LL +I  R
Sbjct: 347 YELLCKITQR 356


>gi|207856691|ref|YP_002243342.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|206708494|emb|CAR32815.1| Alanine racemase [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
          Length = 356

 Score =  149 bits (376), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEAS--LASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++ S  L++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCSYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLNAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|62180365|ref|YP_216782.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|224583706|ref|YP_002637504.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|62127998|gb|AAX65701.1| alanine racemase 2, catabolic [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224468233|gb|ACN46063.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Paratyphi C strain RKS4594]
 gi|322714840|gb|EFZ06411.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 356

 Score =  149 bits (376), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++   SL++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCAYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++    GE V YGG+  +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSVGERVGYGGRYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|148360608|ref|YP_001251815.1| hypothetical protein LPC_2554 [Legionella pneumophila str. Corby]
 gi|226711052|sp|A5IGG9|ALR_LEGPC RecName: Full=Alanine racemase
 gi|148282381|gb|ABQ56469.1| hypothetical protein LPC_2554 [Legionella pneumophila str. Corby]
          Length = 357

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 107/372 (28%), Positives = 189/372 (50%), Gaps = 39/372 (10%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           RL I+ +AL +N   +  L+   +  A+VK NAYG G  ++AP L +  ++ F V  +EE
Sbjct: 6   RLVIEPSALLHNLSQIKHLAPGKKVIAMVKANAYGCGVREVAPVL-DGRIEAFGVACLEE 64

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
            + +R    +    +  G+    E  +  + +   V+    QL +   L+   + +P  +
Sbjct: 65  ALAIRALGVETPCILFQGVFSSDELSVAVENDFACVLHHAQQLEW---LIKTPLPYPIKV 121

Query: 127 --QVDTGFNRLGLSLQEALDF-----THNSFNKKLGQLSLIISHLACADDPSSHVNSVQL 179
             +V+TG +RLG  + E         T    +K +G    +++HLACAD+P    N  Q+
Sbjct: 122 WVKVNTGMHRLGFKIHELQKVMGALQTCTWVDKSIG----LMTHLACADEPHRPENQQQI 177

Query: 180 ERFRTL-ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSH------PM 232
             F+ + I  ++  + S+A+S+ I+  P+    + RPGI LYG +   N++       P+
Sbjct: 178 SLFQEISIPGFR--QRSIANSAAIISFPDSQADVVRPGIMLYGVSPFANQNAHDLGLIPV 235

Query: 233 QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP 292
              ++A   I  I    +   V YGG  K  + S I V A GY DGYP  +S    E +P
Sbjct: 236 MRFMSA---ISAIHDNPSFAQVGYGGTWKSDKPSRIGVVAAGYGDGYPRHIS----EKTP 288

Query: 293 SVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGT 352
                   +++G  V I+G+++MDM   D+T+   +E+GD ++++G  + ++ +A ++GT
Sbjct: 289 V-------WVRGREVSIVGRVSMDMLTIDLTEHPDVEIGDEVELWGTHVLVERIAKSAGT 341

Query: 353 TNYDLLVRIGTR 364
             Y+LL +I  R
Sbjct: 342 VGYELLCQISER 353


>gi|146305288|ref|YP_001185753.1| alanine racemase [Pseudomonas mendocina ymp]
 gi|145573489|gb|ABP83021.1| alanine racemase [Pseudomonas mendocina ymp]
          Length = 362

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 118/369 (31%), Positives = 186/369 (50%), Gaps = 36/369 (9%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           R  IDL AL++N+     LSG AR  AVVK +AYG G  + A AL  +    F V  +EE
Sbjct: 5   RALIDLDALRHNYQLARELSG-ARALAVVKADAYGHGAVRCAQAL-QSEADGFAVACIEE 62

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPYAL 126
            + LR    +A I +L G     E  + D + L  V+ +  Q+     +    +S P  L
Sbjct: 63  ALALREAGIRAPILLLEGFFEADELALIDQHELWCVVHAQWQI---EAIEQARLSRPLTL 119

Query: 127 --QVDTGFNRLGL---SLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
             ++D+G +R+GL     QEA  +     + K+G++ +++SH A AD+P       QL  
Sbjct: 120 WLKLDSGMHRVGLHPAEYQEA--YRRLLASGKVGKI-VLMSHFARADEPECERTVEQLAV 176

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLT------RPGISLYGGT---DKINKSHPM 232
           F+         E SL +S  +L  P   F+ T      RPGI LYG T       ++  +
Sbjct: 177 FQQ-ARQGLAAEVSLCNSPAVLGWPQL-FEKTGASDWVRPGIMLYGATPFEQAQEQAARL 234

Query: 233 QTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSP 292
           Q V+T E+++I +R+  AGE V YG +    R + + V AIGYADGYP         H+P
Sbjct: 235 QPVMTLESKVISVRELPAGEPVGYGARFVSERPTRVGVVAIGYADGYP--------RHAP 286

Query: 293 SVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGT 352
           +   G    + G +  ++G+++MDM   D+TD     +G  ++++G  +   DVA+A+G+
Sbjct: 287 T---GTPVAVDGQLTRLIGRVSMDMLTVDLTDLPQAGLGSRVELWGKQVLASDVAMAAGS 343

Query: 353 TNYDLLVRI 361
             Y +   +
Sbjct: 344 IPYQIFCNL 352


>gi|149377612|ref|ZP_01895350.1| alanine racemase [Marinobacter algicola DG893]
 gi|149358085|gb|EDM46569.1| alanine racemase [Marinobacter algicola DG893]
          Length = 366

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 105/366 (28%), Positives = 176/366 (48%), Gaps = 22/366 (6%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +ID  AL++N+     L+  AR  AV+K + YG G  ++A AL +   + F V  +EE +
Sbjct: 8   RIDTRALRHNYRLACRLASPARAMAVIKADGYGHGIREVARALASDAPK-FAVACLEEAL 66

Query: 70  KLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA-LQ 127
            +R       + +L G+H  G            V+ S  QL +  +        P   ++
Sbjct: 67  AIREAGVDHPVVLLQGMHSAGDVATCVCEGFEVVVHSGYQLDWLDQ----ADERPTVWVK 122

Query: 128 VDTGFNRLGLSLQEALDFTHNSFNKKLGQ-LSLIISHLACADDPSSHVNSVQLERFRTLI 186
           V+TG NRLG +     D          G+ ++  ++H ACADD S      Q   F   +
Sbjct: 123 VNTGMNRLGFAPSVLADVMARLDTIGAGETVAGFVTHFACADDISRDDTDQQTRVFSEAV 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHP---MQTVVTAEARII 243
             +  +E S ++S+   L     F  TRPGI LYG +  + K+ P   ++ V+T EA + 
Sbjct: 183 VDWPKLEKSASNSAAHFLPAQPSFDWTRPGIMLYGASPTLGKTGPELGLEAVMTLEAPLT 242

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R    GE V YG      +++ + + AIGY DGYP   +G D+            ++ 
Sbjct: 243 AVRTLKPGESVGYGYSWTAIQETRMGIVAIGYGDGYPRH-AGTDT----------PAWVG 291

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  + ++G+++MDM   D+T +     GD ++++G ++ +D+VA  +GT  Y+LL  I  
Sbjct: 292 GNRIRLIGRVSMDMLAVDLTGAPEACPGDLVELWGRNVSVDEVAQHAGTIGYELLTGITA 351

Query: 364 RYAKFY 369
           R  + Y
Sbjct: 352 RVPRLY 357


>gi|94500388|ref|ZP_01306920.1| alanine racemase [Oceanobacter sp. RED65]
 gi|94427423|gb|EAT12401.1| alanine racemase [Oceanobacter sp. RED65]
          Length = 365

 Score =  149 bits (375), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 182/373 (48%), Gaps = 33/373 (8%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N+   ++L+  +++ AVVK NAYG G    A AL    V  F V S++E ++
Sbjct: 9   IDLEALRSNYRLADSLAPQSQSIAVVKANAYGHGAVPCAKAL-EPIVPAFAVASIDEAIE 67

Query: 71  LRLYTPQARIFVLYGIHP-GQEKIIFDTNLIPVISSVPQLTFYS----KLMSCGVSHPYA 125
           LR    +  I +L G    G+ +I  +     +I +   L F      K + C     + 
Sbjct: 68  LREGGIRKPILLLEGPFSFGEVQIASEHEFWLMIENHNHLAFIEQCEHKKLICKPLKCW- 126

Query: 126 LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQL 179
           L++D+G +RLG      + F   +  +KL   S++       +H A AD         Q+
Sbjct: 127 LKMDSGMHRLGF-----MPFEIAAIYQKLKSTSIVHDEIVVATHFATADVEGDAFVKEQI 181

Query: 180 ERFRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSH---PMQTVV 236
           + F   IS   G   SL +S+G++  P  H    RPG  LYG +      H    +Q+V+
Sbjct: 182 DCFNEAISGL-GCLTSLCNSAGVMAWPQAHGSWNRPGFMLYGASPFELPQHNDKTLQSVM 240

Query: 237 TAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFL 296
           T ++++I +R    GE V YG      RDS IA   +GY DGYP         H+ +   
Sbjct: 241 TLQSKVISVRNVKKGEAVGYGKTWIAQRDSRIATVTVGYGDGYP--------RHAKN--- 289

Query: 297 GGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYD 356
           G    +      + G+++MDM   D+TD  S+ +GD +  +G D+ +++VA  SGT  Y+
Sbjct: 290 GTPILVNNQRCKLAGRVSMDMITVDVTDVGSVNIGDDVICWGKDLPINEVAHYSGTIGYE 349

Query: 357 LLVRIGTRYAKFY 369
           L+ R+  R ++ Y
Sbjct: 350 LMTRMPLRPSRIY 362


>gi|3913032|sp|O30746|ALR2_KLEAE RecName: Full=Alanine racemase, catabolic
 gi|2360966|gb|AAC38140.1| alanine racemase [Klebsiella aerogenes]
          Length = 356

 Score =  149 bits (375), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 113/369 (30%), Positives = 178/369 (48%), Gaps = 42/369 (11%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL+ N   +   +  +R  AV KDNAYG G  ++  AL  A    F + ++EE + 
Sbjct: 9   IDLLALRQNLQIVRRAAPGSRLWAVDKDNAYGHGVARVWSALSAA--DGFALLNLEEAIL 66

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--LQV 128
           LR    +  I +L G     E  + D   +P  +SV        L    +  P    L+V
Sbjct: 67  LREQGWKGPILLLEGFFHADELAVLDQYRLP--TSVHSNWQIKALQQAKLRAPLDIYLKV 124

Query: 129 DTGFNRLGLSLQEALDFTHNSFNK-----KLGQLSLIISHLACADDPSSHVNSVQLERFR 183
           ++G NRLG   +      H  + +      +G+++L+ SH A A++P   V     E  R
Sbjct: 125 NSGMNRLGFMPER----VHTVWQQLRAISNVGEMTLM-SHFAEAENPQGIV-----EPMR 174

Query: 184 TLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQTV 235
            +    +G++   SLA+S+  L  P  HF   RPGI LYG +      D  N    ++ V
Sbjct: 175 RIEQAAEGLDCPRSLANSAATLWHPEAHFDWVRPGIVLYGASPSGQWQDIANTG--LKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++    GE + YGG  + T++  I + A GYADGYP          +PS  
Sbjct: 233 MTLRSEIIGVQNLRPGEAIGYGGLYRTTQEQRIGIVACGYADGYPRV--------APS-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G+++MDM   D+T      +G  ++++G +IK+DDVA +SGT  Y
Sbjct: 283 -GTPVLVDGVRTTTVGRVSMDMLAVDLTPCPQAGIGAPVELWGKEIKIDDVAASSGTVGY 341

Query: 356 DLLVRIGTR 364
           +L+  +  R
Sbjct: 342 ELMCALAPR 350


>gi|119471275|ref|ZP_01613778.1| alanine racemase 1, PLP-binding, biosynthetic [Alteromonadales
           bacterium TW-7]
 gi|119445741|gb|EAW27024.1| alanine racemase 1, PLP-binding, biosynthetic [Alteromonadales
           bacterium TW-7]
          Length = 359

 Score =  149 bits (375), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 110/367 (29%), Positives = 185/367 (50%), Gaps = 23/367 (6%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +I+LTAL +N   +   + N++  AV+K NAYG G  KIA  L +A    F V  ++E +
Sbjct: 7   EINLTALAHNLAQVKRFAPNSKVMAVLKANAYGHGLVKIAQHLNDADA--FAVARIDEAL 64

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQV 128
            LR       I +L G     +  I+   N   +I    QL    +         + L+V
Sbjct: 65  ALRAGGLTKPIVLLEGFFNKDDLPILLANNFQTIIHDEYQLAALEEAELEAPLLCW-LKV 123

Query: 129 DTGFNRLGLSLQEALDFTHNSFNKKLGQLSLI--ISHLACADDPSSHVNSVQLERFRTLI 186
           +TG +RLG++  E  D  +    K     + +  ++H ACADD ++   + Q+ +F  L+
Sbjct: 124 NTGMHRLGIA-PEQFDEFYKRLQKTPNANNTVNLMTHFACADDVNNTKTAQQISQFDCLV 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKIN---KSHPMQTVVTAEARII 243
           ++       L++S+GI+  PN H    RPG+ LYG +   N   + H ++ V+    R+I
Sbjct: 183 NNINQAHC-LSNSAGIIAWPNAHGDWVRPGLMLYGVSPMANALGEQHQLKPVMRLTTRVI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R   A E V YGG+ K  + + +AV A+GY DGYP       ++    V +G + +  
Sbjct: 242 AVRHVPANEAVGYGGRWKSDKATQLAVVAMGYGDGYP-----RHAKEGTPVVIGKQRY-- 294

Query: 304 GYMVPILGKITMDMTMFDI-TDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIG 362
                I+G + MDM   DI  +  +I+VGD + ++GP++ ++++A  + T  Y+LL  I 
Sbjct: 295 ----GIVGSVAMDMISVDIGQNEHNIKVGDRVTMWGPELPVEEIAQCADTIPYELLCNIT 350

Query: 363 TRYAKFY 369
            R +  Y
Sbjct: 351 PRVSYEY 357


>gi|307823471|ref|ZP_07653700.1| alanine racemase [Methylobacter tundripaludum SV96]
 gi|307735456|gb|EFO06304.1| alanine racemase [Methylobacter tundripaludum SV96]
          Length = 362

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 105/364 (28%), Positives = 179/364 (49%), Gaps = 30/364 (8%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ++L A+++N   + + + +A+  AV+K N YG G  +IA AL  A    F V  V+EG++
Sbjct: 9   VNLDAVQHNLSKVRSCAPDAKVMAVIKANGYGHGMLRIAEALQQADA--FAVARVDEGIR 66

Query: 71  LRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVD 129
           LR    + RI VL G    +E   +    L  V+ S+ QL  +      G    + L++D
Sbjct: 67  LRKAGFKHRIAVLEGFTCAEELDELLHYQLDAVVHSLTQLEIFEAETKSGTCAVW-LKLD 125

Query: 130 TGFNRLGLSLQEALDFTHNSFNKKLGQLSLI------ISHLACADDPSSHVNSVQLERFR 183
           +G NRLG   +E      +S  ++L Q +L+      ++H A ADD +      Q+  F 
Sbjct: 126 SGMNRLGFKAKE-----FDSVYQRLTQCALVKQPISLMTHFASADDINDDKTLRQINLFN 180

Query: 184 TLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTAEA 240
             IS Y G E S+A+S+GIL          RPG+ L+G +   D   +   ++ V+   +
Sbjct: 181 ETISGYSG-ERSMANSAGILGWEQSLTDWVRPGVMLHGISPFPDSTGRQLGLRPVMELHS 239

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
           R+I +++   G+ V YGG     + + + V AIGY DGYP               +G   
Sbjct: 240 RLIAVKQIEVGDTVGYGGSWICEKPTTLGVVAIGYGDGYPRYAK-----------VGTPV 288

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
            + G  VP++G+++MDM   D+      + GD + ++G  + ++++A  + T  Y L+  
Sbjct: 289 LVNGRRVPLIGRVSMDMITVDLETEGHAKPGDLVTLWGEGLPVEEIARCADTIPYTLVCG 348

Query: 361 IGTR 364
           +  R
Sbjct: 349 VTQR 352


>gi|205352531|ref|YP_002226332.1| D-amino acid dehydrogenase-Alanine racemase fusion protein
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205272312|emb|CAR37191.1| D-amino acid dehydrogenase-Alanine racemase fusion protein
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|326627589|gb|EGE33932.1| D-amino acid dehydrogenase-Alanine racemase fusion protein
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
          Length = 793

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 442 IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 498

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 499 EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 555

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 556 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 609

Query: 182 FRTLISHYKGIEAS--LASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++ S  L++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 610 MRRIALATEGLQCSYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 669

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 670 MTLSSEIIGVQTLNAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 719

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 720 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 778

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 779 ELLCAVAPR 787


>gi|226326592|ref|ZP_03802110.1| hypothetical protein PROPEN_00442 [Proteus penneri ATCC 35198]
 gi|225205017|gb|EEG87371.1| hypothetical protein PROPEN_00442 [Proteus penneri ATCC 35198]
          Length = 363

 Score =  149 bits (375), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 115/363 (31%), Positives = 180/363 (49%), Gaps = 25/363 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N+  +   + ++   AVVK NAYG G  + A  L +     F V  + E + 
Sbjct: 8   IDRRALRHNFQHVRDYAPHSHLIAVVKANAYGHGLLETAYTLMD-NADCFGVARIGEALT 66

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHPYA--LQ 127
           LR       I +L G     +  I   N I  V+ S  QL     L    +  P    ++
Sbjct: 67  LRSGGIVKPILLLEGFFDIADLPILVVNHIETVVHSQEQL---EALEQANLDEPVKVWMK 123

Query: 128 VDTGFNRLGLSLQEALDF-THNSFNKKLGQLSLIISHLACADDPS-SHVNSVQLERFRTL 185
           +DTG +RLG+  ++A  F    S  K + Q   I+SH + AD+P        Q+  F+  
Sbjct: 124 IDTGMHRLGIRPEDAQAFYLRLSACKNVQQPVNIVSHFSRADEPDVPEATQKQISLFQDF 183

Query: 186 ISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTVVTAEAR 241
           I    G + S+++S+GIL  P  H+Q  RPGI  YG    G ++  K   +   +T +  
Sbjct: 184 IQDKAG-DKSISASAGILFWPQVHYQWVRPGIITYGISPTGDERTGKDFGLTPAMTLKTS 242

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +RK  AGE V YGG     +D+ + V AIGY DGYP +        +PS   G   +
Sbjct: 243 LIAVRKHKAGEPVGYGGTWVSEKDTYLGVIAIGYGDGYPRS--------APS---GTPVW 291

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           I G  VPI+G+++MDM   D+   L   VGD   ++G  + ++++A  SG + Y+L+ ++
Sbjct: 292 INGRKVPIVGRVSMDMISVDLGTELIDSVGDEAILWGDVLPVEEIAKYSGISAYELITKL 351

Query: 362 GTR 364
            +R
Sbjct: 352 TSR 354


>gi|218553745|ref|YP_002386658.1| alanine racemase [Escherichia coli IAI1]
 gi|218360513|emb|CAQ98069.1| alanine racemase 2, PLP-binding [Escherichia coli IAI1]
          Length = 356

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 182/371 (49%), Gaps = 38/371 (10%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL ALK N   +   + +AR  +VVK NAYG G E+I  AL   G  D F + ++
Sbjct: 5   IQASLDLQALKQNLSIVRQAAPHARVWSVVKANAYGHGIERIWSAL---GATDGFALLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    + +I +L G    Q+  I+D + L   + S  QL     L +  +  P 
Sbjct: 62  EEAITLRERGWKGQILMLEGFFHAQDLEIYDQHRLTTCVHSNWQL---KALQNARLKAPL 118

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+V++G NRLG      L           +G+++L+ SH A A+ P     S  + R
Sbjct: 119 DIYLKVNSGMNRLGFQPDRVLTVWQQLRAMANVGEMTLM-SHFAEAEHPDG--ISSAMAR 175

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQ 233
                   +G+E   SL++S+  L  P  HF   RPGI LYG +      D  N    ++
Sbjct: 176 IE---QAAEGLECRRSLSNSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTG--LR 230

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  + II ++   AGE V YGG+     +  I + A GYADGYP         H+P+
Sbjct: 231 PVMTLSSEIIGVQTLKAGERVGYGGRYTARDEQRIGIVAAGYADGYP--------RHAPT 282

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTT 353
              G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT 
Sbjct: 283 ---GTPVLVDGVRTMTVGAVSMDMLAVDLTPCPQAGIGTPVELWGKEIKIDDVAAAAGTV 339

Query: 354 NYDLLVRIGTR 364
            Y+L+  +  R
Sbjct: 340 GYELMCALALR 350


>gi|197263989|ref|ZP_03164063.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197242244|gb|EDY24864.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
          Length = 356

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 181/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEAS--LASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++ S  L++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCSYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+       +G  ++++G +IK+DDVA ASGT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLMPCPQAGIGTPVELWGKEIKVDDVASASGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|213970669|ref|ZP_03398794.1| alanine racemase, catabolic [Pseudomonas syringae pv. tomato T1]
 gi|301382556|ref|ZP_07230974.1| alanine racemase [Pseudomonas syringae pv. tomato Max13]
 gi|302063077|ref|ZP_07254618.1| alanine racemase [Pseudomonas syringae pv. tomato K40]
 gi|302133576|ref|ZP_07259566.1| alanine racemase [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213924503|gb|EEB58073.1| alanine racemase, catabolic [Pseudomonas syringae pv. tomato T1]
          Length = 357

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 115/370 (31%), Positives = 181/370 (48%), Gaps = 26/370 (7%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           R  IDL AL++N+      SG  R  AV+K +AYG G   +A AL  A    F V  +EE
Sbjct: 5   RALIDLQALRHNYRLARDSSGG-RALAVIKADAYGHGAVHVAQAL-EAQADGFAVACIEE 62

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
            ++LR    +A I +L G     E  +I + +L  V+ ++ QL    +    G      L
Sbjct: 63  ALELRAAGIRAPILLLEGFFEADELALIVEHDLWTVVHAIWQLEAIEQAQP-GKPLTVWL 121

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           ++DTG +R+GL   E                 +++SH +CAD+ +S  +  Q+  F    
Sbjct: 122 KLDTGMHRVGLHPSEYRAAYQRLLATGKVPRVVLMSHFSCADELNSACSDQQVAVFE--- 178

Query: 187 SHYKGI--EASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM----QTVVTAEA 240
           +  +G+  E SL +S  ++  PN     +R GI LYG T   +++ P+    Q V+T E+
Sbjct: 179 AARQGLVAETSLKNSPAVMGWPNIPSDWSRTGIMLYGAT-PFDQTQPLAERLQPVMTLES 237

Query: 241 RIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKG 300
           ++I +R+  AGE V YG      R   I V A+GYADGYP         H+P+   G   
Sbjct: 238 KVISVRELPAGEAVGYGATFVSERPLRIGVVAMGYADGYP--------RHAPT---GTPV 286

Query: 301 FIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVR 360
            I G    +LG+++MDM   D+TD     +G  +Q++G  +   +VA  +GT  Y +   
Sbjct: 287 LIDGQRSRLLGRVSMDMLCVDLTDVPQAGLGSRVQLWGKGVLASEVATQAGTIPYQIFCN 346

Query: 361 IGTRYAKFYT 370
           +  R  + Y+
Sbjct: 347 L-RRVPRIYS 355


>gi|198244745|ref|YP_002215339.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|197939261|gb|ACH76594.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Dublin str. CT_02021853]
 gi|326623083|gb|EGE29428.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
          Length = 356

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 182/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRVMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEAS--LASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++ S  L++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCSYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   +GE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLNSGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|87300882|ref|ZP_01083724.1| alanine racemase [Synechococcus sp. WH 5701]
 gi|87284753|gb|EAQ76705.1| alanine racemase [Synechococcus sp. WH 5701]
          Length = 403

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 115/385 (29%), Positives = 188/385 (48%), Gaps = 28/385 (7%)

Query: 1   MHSNEFLRLKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD 59
           +H  +   +++D TA+++N  ++   L+ ++   AVVK + YG G   +A A    G   
Sbjct: 21  LHPRQRAWVEVDETAIEHNARALGRWLAPDSSLMAVVKADGYGHGAAPVARAAMAGGATS 80

Query: 60  FFVTSVEEGVKLRLYTPQARIFVLYG-IHPGQEKIIFDTNLIPVISSVPQLTFYSKLMS- 117
             V +++EG++LR    +A + V+   IHP + +   + +L+P IS + +      L S 
Sbjct: 81  LGVATLQEGIELRQAGLEAPVLVMGNLIHPEELRSCLEWDLMPTISGMREALLCQNLASG 140

Query: 118 CGVSHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDP---SSHV 174
            G S    L++DTG  RLG+   + +             L+ + SHLA AD P      +
Sbjct: 141 SGRSMALHLKLDTGMARLGVDWGDGVRLLQALLGLDAVLLAGVYSHLADADAPDPGGGGL 200

Query: 175 NSVQLERFRTLISHYKGIEAS-----LASSSGILLGPNYHFQLTRPGISLYGGTDKINKS 229
            ++Q +RF +++     +  +     LA+S+G L     H+ L R G++LYG     + S
Sbjct: 201 TALQQQRFESVLRGAGELGLATGVRHLANSAGTLRCRRLHYDLVRVGLALYGQAPAEHLS 260

Query: 230 H--PMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLD 287
           H  P+Q  ++  AR+ LIR+  AG  VSYG +    R S +AV  IGYADG P  LS   
Sbjct: 261 HTVPLQPAMSVRARVCLIREVPAGVGVSYGHRYTTRRPSRLAVVTIGYADGVPRLLS--- 317

Query: 288 SEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKL 343
             +   V   G+   +      +G ITMD  + D T++  +EVG  + + G D    I  
Sbjct: 318 --NQLEVLFAGRRLAQ------VGAITMDQLLIDATEAPQLEVGSVVTLLGDDGGERITP 369

Query: 344 DDVALASGTTNYDLLVRIGTRYAKF 368
            D A ASGT  +++L     R  + 
Sbjct: 370 QDWAQASGTIPWEILCGFKHRLPRL 394


>gi|16760692|ref|NP_456309.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. CT18]
 gi|29141550|ref|NP_804892.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|213162931|ref|ZP_03348641.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. E00-7866]
 gi|213420203|ref|ZP_03353269.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. E01-6750]
 gi|213426623|ref|ZP_03359373.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213648191|ref|ZP_03378244.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|20137367|sp|Q8Z688|ALR2_SALTI RecName: Full=Alanine racemase, catabolic
 gi|25291652|pir||AC0723 alanine racemase [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16502989|emb|CAD05485.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29137177|gb|AAO68741.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
          Length = 356

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 181/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++   SL++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCAYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
            LL  +  R
Sbjct: 342 GLLCAVAPR 350


>gi|213026678|ref|ZP_03341125.1| alanine racemase [Salmonella enterica subsp. enterica serovar Typhi
           str. 404ty]
          Length = 356

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 181/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++   SL++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCAYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
            LL  +  R
Sbjct: 342 GLLCAVAPR 350


>gi|204927774|ref|ZP_03218975.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
 gi|204323116|gb|EDZ08312.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Javiana str. GA_MM04042433]
          Length = 356

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 181/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGAILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   +            + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERVQTVWQQLRTMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++   SL++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCAYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++   AGE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSAGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|17229950|ref|NP_486498.1| alanine racemase [Nostoc sp. PCC 7120]
 gi|17131550|dbj|BAB74157.1| alanine racemase [Nostoc sp. PCC 7120]
          Length = 401

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 118/378 (31%), Positives = 178/378 (47%), Gaps = 33/378 (8%)

Query: 9   LKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           ++IDL AL +N   +   LS   +  AVVK +AYG G   +A     AG     V +V E
Sbjct: 34  VEIDLEALSHNVQQLKQFLSPRTQLMAVVKADAYGHGAVTVAQTALQAGASCLGVATVPE 93

Query: 68  GVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH---- 122
           G++LR    QA I +L   H P Q + I    L   I S  Q   +S  +   + H    
Sbjct: 94  GIQLREAGIQAPILILGATHTPEQIQAIAQWQLQATIGSPKQALIFSNTLET-IQHDSPI 152

Query: 123 PYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL--IISHLACADDPSSHVNSVQLE 180
           P  +++DTG +RLG + Q+A +F      ++L  L +  + SHLA AD P   +   Q  
Sbjct: 153 PVHIKLDTGMSRLGTNWQQAGEFVQ--LVERLPHLDIASVYSHLATADSPDPGIMEEQHR 210

Query: 181 RFRTLISHYK--GIEAS---LASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQ 233
           RF   I+  K  GI+     LA+S+  L  P  H+ + R G+++YG      +     ++
Sbjct: 211 RFEEAIAQIKTLGIKIPSLHLANSAATLADPRLHYDMVRVGLAVYGLYPAPHLQNKISLK 270

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+  +ARI  ++   AG  VSYG Q     +  +AV +IGYADG P  LS         
Sbjct: 271 PVIQVQARITHVKTIAAGTGVSYGHQFIAPHEMRLAVVSIGYADGVPRNLSN-------- 322

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALA 349
                +  I+G  VP +G ITMD  M D +    ++ G+ + + G      I  DD A A
Sbjct: 323 ---KMQVLIRGQRVPQIGAITMDQLMIDASALPDLQEGEIVTLLGKQGKEKITADDWAEA 379

Query: 350 SGTTNYDLLVRIGTRYAK 367
             T ++++L     R  +
Sbjct: 380 LNTISWEVLCGFKHRLPR 397


>gi|20137211|sp|Q8YU96|ALR_ANASP RecName: Full=Alanine racemase
          Length = 386

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 118/378 (31%), Positives = 178/378 (47%), Gaps = 33/378 (8%)

Query: 9   LKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           ++IDL AL +N   +   LS   +  AVVK +AYG G   +A     AG     V +V E
Sbjct: 19  VEIDLEALSHNVQQLKQFLSPRTQLMAVVKADAYGHGAVTVAQTALQAGASCLGVATVPE 78

Query: 68  GVKLRLYTPQARIFVLYGIH-PGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSH---- 122
           G++LR    QA I +L   H P Q + I    L   I S  Q   +S  +   + H    
Sbjct: 79  GIQLREAGIQAPILILGATHTPEQIQAIAQWQLQATIGSPKQALIFSNTLET-IQHDSPI 137

Query: 123 PYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSL--IISHLACADDPSSHVNSVQLE 180
           P  +++DTG +RLG + Q+A +F      ++L  L +  + SHLA AD P   +   Q  
Sbjct: 138 PVHIKLDTGMSRLGTNWQQAGEFVQ--LVERLPHLDIASVYSHLATADSPDPGIMEEQHR 195

Query: 181 RFRTLISHYK--GIEAS---LASSSGILLGPNYHFQLTRPGISLYG--GTDKINKSHPMQ 233
           RF   I+  K  GI+     LA+S+  L  P  H+ + R G+++YG      +     ++
Sbjct: 196 RFEEAIAQIKTLGIKIPSLHLANSAATLADPRLHYDMVRVGLAVYGLYPAPHLQNKISLK 255

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+  +ARI  ++   AG  VSYG Q     +  +AV +IGYADG P  LS         
Sbjct: 256 PVIQVQARITHVKTIAAGTGVSYGHQFIAPHEMRLAVVSIGYADGVPRNLSN-------- 307

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD----IKLDDVALA 349
                +  I+G  VP +G ITMD  M D +    ++ G+ + + G      I  DD A A
Sbjct: 308 ---KMQVLIRGQRVPQIGAITMDQLMIDASALPDLQEGEIVTLLGKQGKEKITADDWAEA 364

Query: 350 SGTTNYDLLVRIGTRYAK 367
             T ++++L     R  +
Sbjct: 365 LNTISWEVLCGFKHRLPR 382


>gi|168233845|ref|ZP_02658903.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
 gi|194471678|ref|ZP_03077662.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|194458042|gb|EDX46881.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CVM29188]
 gi|205332109|gb|EDZ18873.1| alanine racemase [Salmonella enterica subsp. enterica serovar
           Kentucky str. CDC 191]
          Length = 356

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 114/369 (30%), Positives = 181/369 (49%), Gaps = 34/369 (9%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL  +K N   +   +  AR  +VVK NAYG G E++  AL   G  D F + ++
Sbjct: 5   IQASLDLQVMKQNLAIVRRAAPEARVWSVVKANAYGHGIERVWSAL---GATDGFAMLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+   +DT  L   I S  QL     L +  ++ P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEAYDTYRLTTCIHSNWQL---KALQNARLNAPL 118

Query: 125 AL--QVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
            +  +V++G NRLG   + A          + +G+++L+ SH A AD P         E 
Sbjct: 119 DIYVKVNSGMNRLGFQPERAQTVWQQLRAMRNVGEMTLM-SHFAQADHPEGIG-----EA 172

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYG----GTDKINKSHPMQTV 235
            R +    +G++   SL++S+  L  P  H+   RPGI LYG    G  +      ++ V
Sbjct: 173 MRRIALATEGLQCAYSLSNSAATLWHPQAHYDWVRPGIILYGASPSGQWRDIADTGLKPV 232

Query: 236 VTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVF 295
           +T  + II ++    GE V YGG   +T++  I + A GYADGYP         H+P+  
Sbjct: 233 MTLSSEIIGVQTLSVGERVGYGGGYSVTQEQRIGIVAAGYADGYP--------RHAPT-- 282

Query: 296 LGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNY 355
            G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT  Y
Sbjct: 283 -GTPVLVDGIRTRTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKVDDVASAAGTLGY 341

Query: 356 DLLVRIGTR 364
           +LL  +  R
Sbjct: 342 ELLCAVAPR 350


>gi|260867595|ref|YP_003233997.1| alanine racemase 2, PLP-binding [Escherichia coli O111:H- str.
           11128]
 gi|257763951|dbj|BAI35446.1| alanine racemase 2, PLP-binding [Escherichia coli O111:H- str.
           11128]
 gi|323179296|gb|EFZ64866.1| alanine racemase [Escherichia coli 1180]
          Length = 356

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 182/371 (49%), Gaps = 38/371 (10%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL ALK N   +   + +AR  +VVK NAYG G E+I  AL   G  D F + ++
Sbjct: 5   IQASLDLQALKQNLSIVRQAAPHARVWSVVKANAYGHGIERIWSAL---GATDGFALLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+  I+D + L   + S  QL     L +  +  P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEIYDQHRLTTCVHSNWQL---KALQNARLKAPL 118

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+V++G NRLG      L           +G+++L+ SH A A+ P     S  + R
Sbjct: 119 DIYLKVNSGMNRLGFQPDRVLTVWQQLRAMANVGEMTLM-SHFAEAEHPDG--ISSAMAR 175

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQ 233
              +    +G+E   SL++S+  L  P  HF   RPGI LYG +      D  N    ++
Sbjct: 176 IEQVA---EGLECRRSLSNSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTG--LR 230

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  + II ++   AGE V YGG+     +  I + A GYADGYP         H+P+
Sbjct: 231 PVMTLSSEIIGVQTLKAGERVGYGGRYTARDEQRIGIVAAGYADGYP--------RHAPT 282

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTT 353
              G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT 
Sbjct: 283 ---GTPVLVDGVRTMTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKIDDVAAAAGTV 339

Query: 354 NYDLLVRIGTR 364
            Y+L+  +  R
Sbjct: 340 GYELMCALALR 350


>gi|197119823|ref|YP_002140250.1| alanine racemase [Geobacter bemidjiensis Bem]
 gi|254802364|sp|B5EBG2|ALR_GEOBB RecName: Full=Alanine racemase
 gi|197089183|gb|ACH40454.1| alanine racemase [Geobacter bemidjiensis Bem]
          Length = 379

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 113/378 (29%), Positives = 177/378 (46%), Gaps = 30/378 (7%)

Query: 9   LKIDLTALKNNWHSMNA-LSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           ++IDL AL++N+  +   +       AVVK +AYG G + ++  L   GV  F V  + E
Sbjct: 8   VEIDLAALRHNFSLVQKRVPEGCGLLAVVKADAYGHGFQYVSEELEKLGVDAFAVAFLAE 67

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSV---PQLTFYSKLMSCGVSHPY 124
           GV+LR+      + +L GI+PG+E+     N+   + S+     L   +  + C      
Sbjct: 68  GVQLRMSGITRPVLILGGIYPGEERRCIGLNISTALFSLEQAAALDQAALEIKCYRKAHI 127

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACAD--DPSS-HVNSVQLER 181
            L+VDTG  RLG+   E  +F       K  +L  I SH A AD  DP       +Q ER
Sbjct: 128 HLKVDTGMGRLGVPYHEVPEFLAKLKQFKNLELEGIFSHFASADELDPEGIAFTKLQAER 187

Query: 182 FRTLISH-----YKGIEASLASSSGILLGPNYHFQLTRPGISLYGG--TDKINKSHPMQT 234
           F   +       Y      +A+S+ IL     +  L RPGI LYG   +       P Q 
Sbjct: 188 FNAAVEEARRQGYAPTYVHVANSAAILTQDLPYCNLARPGIILYGALPSGDFEGQVPSQP 247

Query: 235 VVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSV 294
           V+  ++R+ +++    G  +SYG +      +LIA   +GYADGY  +L+          
Sbjct: 248 VMRLKSRVAMLKWVEPGTSISYGRRYVAAERALIASVPVGYADGYCRSLTN--------- 298

Query: 295 FLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD-----IKLDDVALA 349
              G+  I+G    + G + MD  M D+T+   + VGD + + GPD     I  +++A  
Sbjct: 299 --KGEALIRGQRAKVAGTVCMDWIMLDVTNVKGVAVGDDVTLLGPDPMGDCISAEEMAEK 356

Query: 350 SGTTNYDLLVRIGTRYAK 367
           +GT  Y++L  I TR  +
Sbjct: 357 AGTIPYEVLCGIATRRVR 374


>gi|323187415|gb|EFZ72724.1| alanine racemase [Escherichia coli RN587/1]
          Length = 356

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 117/371 (31%), Positives = 181/371 (48%), Gaps = 38/371 (10%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL ALK N   +   + +AR  +VVK NAYG G E+I  AL   G  D F + ++
Sbjct: 5   IQASLDLQALKQNLSIVRQAAPHARVWSVVKANAYGHGIERIWSAL---GATDGFALLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+  I+D + L   + S  QL     L +  +  P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEIYDQHRLTTCVHSNWQL---KALQNARLKAPL 118

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+V++G NRLG      L           +G+++L+ SH A A+ P     ++    
Sbjct: 119 DIYLKVNSGMNRLGFQPDRVLTVWQQLRAMANVGEMTLM-SHFAEAEHPDGISGAMA--- 174

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQ 233
              +    +G+E   SLA+S+  L  P  HF   RPGI LYG +      D  N    ++
Sbjct: 175 --RIEQAAEGLECRRSLANSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTG--LR 230

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  + II ++   AGE V YGG+     +  I + A GYADGYP         H+P+
Sbjct: 231 PVMTLSSEIIGVQTLKAGERVGYGGRYTARDEQRIGIVAAGYADGYP--------RHAPT 282

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTT 353
              G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT 
Sbjct: 283 ---GTPVLVDGVRTMTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKIDDVAAAAGTV 339

Query: 354 NYDLLVRIGTR 364
            Y+L+  +  R
Sbjct: 340 GYELMCALALR 350


>gi|331652220|ref|ZP_08353239.1| alanine racemase [Escherichia coli M718]
 gi|331050498|gb|EGI22556.1| alanine racemase [Escherichia coli M718]
          Length = 356

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 181/371 (48%), Gaps = 38/371 (10%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL ALK N   +   + +AR  +VVK NAYG G E+I  AL   G  D F + ++
Sbjct: 5   IQASLDLQALKQNLSIVRQAATHARVWSVVKANAYGHGIERIWSAL---GATDGFALLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+  I+D + L   + S  QL     L +  +  P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEIYDQHRLTTCVHSNWQL---KALQNARLKAPL 118

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+V++G NRLG      L           +G+++L+ SH A A+ P     S  + R
Sbjct: 119 DIYLKVNSGMNRLGFQPDRVLTVWQQLRAMANVGEMTLM-SHFAEAEHPDG--ISSAMAR 175

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQ 233
                   +G+E   SL++S+  L  P  HF   RPGI LYG +      D  N    ++
Sbjct: 176 IE---QAAEGLECRRSLSNSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTG--LR 230

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  + II ++   AGE V YGG+     +  I + A GYADGYP         H+P+
Sbjct: 231 PVMTLSSEIIGVQTLKAGERVGYGGRYTARDEQRIGIVAAGYADGYP--------RHAPT 282

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTT 353
              G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT 
Sbjct: 283 ---GTPVLVDGVRTMTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKIDDVAAAAGTV 339

Query: 354 NYDLLVRIGTR 364
            Y+L+  +  R
Sbjct: 340 GYELMCSLALR 350


>gi|15602278|ref|NP_245350.1| alanine racemase [Pasteurella multocida subsp. multocida str. Pm70]
 gi|20137233|sp|Q9CNL5|ALR_PASMU RecName: Full=Alanine racemase
 gi|12720664|gb|AAK02497.1| Alr [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 360

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 113/371 (30%), Positives = 187/371 (50%), Gaps = 32/371 (8%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           KI   ALK+N  ++   +  ++  AVVK NAYG G   ++ A+    V  F V  +EE +
Sbjct: 9   KISSVALKHNIQTIKQKAPQSKIIAVVKANAYGHGVVFVSAAVEEL-VDCFGVARLEEAL 67

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYA--L 126
            LR       I +L G    ++  +I   N+  V+ +V QL     L +  V +P    L
Sbjct: 68  SLRSNGITKPILLLEGFFCDKDLPVIAINNIQTVVHNVEQL---EALKAAKVPNPIKVWL 124

Query: 127 QVDTGFNRLGLSLQEALDFTH-----NSFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
           ++DTG +RLG++L++   F        + + ++G     +SH + AD+       +QL R
Sbjct: 125 KIDTGMHRLGVALEDVEYFYQALRDSENVDPQIG----FVSHFSRADELECDYTKLQLTR 180

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKIN---KSHPMQTVVTA 238
           F     +  G E S+A+S GIL   + H    RPGI +YG    IN   + + +  V+T 
Sbjct: 181 FLNATQNKAG-EKSIAASGGILFWESSHLDWIRPGIIMYG-ISPINVPAQEYDLTPVMTL 238

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
            + +I I++   GE V YGG     +D+ I V AIGY DGYP  +        P+   G 
Sbjct: 239 TSSLIAIKQHKKGEPVGYGGIWVSDKDTKIGVVAIGYGDGYPRDI--------PT---GT 287

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
             ++ G  VPI+G+++MDM   D+      +VGD + ++G ++ ++++A  SG  +Y+L+
Sbjct: 288 PVYLNGRRVPIVGRVSMDMLTVDLGAEAQDKVGDEVILWGKELPIEEIADISGVISYELI 347

Query: 359 VRIGTRYAKFY 369
            ++  R    Y
Sbjct: 348 TKLTPRVLTEY 358


>gi|83644553|ref|YP_432988.1| alanine racemase [Hahella chejuensis KCTC 2396]
 gi|123534099|sp|Q2SLB1|ALR_HAHCH RecName: Full=Alanine racemase
 gi|83632596|gb|ABC28563.1| alanine racemase [Hahella chejuensis KCTC 2396]
          Length = 374

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 113/382 (29%), Positives = 187/382 (48%), Gaps = 39/382 (10%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           R  IDL AL++N   +N+++ NAR AAV+K +AYG G  +IA AL     +   V   +E
Sbjct: 5   RALIDLDALRHNIRLLNSIAHNARCAAVIKADAYGHGAVEIARALKGEAPK-LAVACYDE 63

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDT----NLIPVISSVPQLTFYSKLMSCGVSHP 123
            V LR       + VL G +  +E  + D+    ++  V+  + QL   S++     + P
Sbjct: 64  AVSLREAGVTTPLLVLEGFYSSEE--LADSTRWCDIEWVVHDMEQLDMLSEVAPLRKAGP 121

Query: 124 YA------LQVDTGFNRLGLSLQEALDFTHNSFNKKLGQ---LSLI--ISHLACADDPSS 172
            +      ++++TG NRLGL L +     H    +KL Q   LS+I  ++H ACAD+  S
Sbjct: 122 DSTRMQTWIKLNTGMNRLGLPLNK---LAH--VAEKLQQFPGLSVIGLMTHFACADELDS 176

Query: 173 HVNSVQLERFRTLI--SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKIN 227
            +   Q   F+  +  +   G   S A+S+ +L  P  H    RPGI++YG +   DK  
Sbjct: 177 LLQQRQWRAFQAGMQAAGANGWSYSSANSAALLQYPETHLDWVRPGIAMYGASPMADKTG 236

Query: 228 KSHPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLD 287
               ++ V+T E+R+I  R+  AG+ + YG        + + V A+GY DGYP  +    
Sbjct: 237 ADFGLKPVMTFESRLIATRELQAGDSIGYGAAWTADAPTRMGVVAVGYGDGYPRQMQN-- 294

Query: 288 SEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVA 347
                    G    + G    I+G+++MDM   DI+      +G  ++++G  +  D+VA
Sbjct: 295 ---------GAPVAVCGKRTKIIGRVSMDMLTVDISHIPEARIGSEVELWGGTVSADEVA 345

Query: 348 LASGTTNYDLLVRIGTRYAKFY 369
             + T +Y L   + +R  + Y
Sbjct: 346 GYASTISYTLFTGMTSRVPRVY 367


>gi|215486418|ref|YP_002328849.1| alanine racemase [Escherichia coli O127:H6 str. E2348/69]
 gi|312966424|ref|ZP_07780646.1| alanine racemase [Escherichia coli 2362-75]
 gi|215264490|emb|CAS08857.1| alanine racemase 2, PLP-binding [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312288877|gb|EFR16775.1| alanine racemase [Escherichia coli 2362-75]
          Length = 356

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 117/371 (31%), Positives = 181/371 (48%), Gaps = 38/371 (10%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL ALK N   +   +  AR  +VVK NAYG G E+I  AL   G  D F + ++
Sbjct: 5   IQASLDLQALKQNLSIVRQAAPYARVWSVVKANAYGHGIERIWSAL---GATDGFALLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+  I+D + L   + S  QL     L +  +  P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEIYDQHRLTTCVHSNWQL---KALQNARLKAPL 118

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+V++G NRLG      L           +G+++L+ SH A A+ P     ++    
Sbjct: 119 DIYLKVNSGMNRLGFQPDRVLTVWQQLRAMANVGEMTLM-SHFAEAEHPDGISGAMA--- 174

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQ 233
              +    +G+E   SLA+S+  L  P  HF   RPGI LYG +      D  N    ++
Sbjct: 175 --RIEQAAEGLECRRSLANSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTG--LR 230

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  + II ++   AGE V YGG+     +  I + A GYADGYP         H+P+
Sbjct: 231 PVMTLSSEIIGVQTLKAGERVGYGGRYTARDEQRIGIVAAGYADGYP--------RHAPT 282

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTT 353
              G    + G +   +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT 
Sbjct: 283 ---GTPVLVDGVLTMTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKIDDVAAAAGTV 339

Query: 354 NYDLLVRIGTR 364
            Y+L+  +  R
Sbjct: 340 GYELMCALALR 350


>gi|90417095|ref|ZP_01225023.1| alanine racemase [marine gamma proteobacterium HTCC2207]
 gi|90331111|gb|EAS46367.1| alanine racemase [marine gamma proteobacterium HTCC2207]
          Length = 358

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 110/366 (30%), Positives = 178/366 (48%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           IDL AL++N+    +L+  ++T  +VK NAYG G  K++ AL +     F V  +EE ++
Sbjct: 9   IDLQALRHNYELAQSLAPKSKTIPMVKANAYGHGAIKVSQALSDIA-PAFGVACIEEALE 67

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YALQV 128
           LR    +  I +L G     E  +  T    V+    Q      +++  ++ P    L V
Sbjct: 68  LRDTGIKQPILLLEGTFEATELKLAATKGFWVMVENHQQK--EAILNADLALPLNVWLGV 125

Query: 129 DTGFNRLGLSLQEALDF--THNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           DTG +RLG    E  D   T NS ++ + Q  +  SH ACAD+  S     Q++ F+   
Sbjct: 126 DTGMHRLGFQPGEIADIYKTLNS-SRNISQPIVFTSHFACADNLDSDSTLKQIQTFKAC- 183

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTD---KINKSHPMQTVVTAEARII 243
           +    ++ SLA+S+ IL  P    +  RPG  LYG +        +  ++ V++ E+ +I
Sbjct: 184 APVTALQ-SLANSAAILAWPKAQREWQRPGYMLYGNSPFAVAQENADQLKPVMSFESAVI 242

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R   AGE V Y       R+S IA   +GY DGYP            +   G    I 
Sbjct: 243 SLRTIAAGESVGYTANWTAERESTIATITVGYGDGYPR-----------NAINGTPVLIN 291

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G   P++G+++MDM   D+T    + +GD   ++GP++ +++VA    T  Y+LL R+  
Sbjct: 292 GIRCPLVGRVSMDMITVDVTALSEVAIGDKAVLWGPELPVNEVASYCDTIGYELLTRMPE 351

Query: 364 RYAKFY 369
           R  + Y
Sbjct: 352 RVPRVY 357


>gi|332759341|gb|EGJ89649.1| alanine racemase [Shigella flexneri 2747-71]
 gi|332767413|gb|EGJ97607.1| alanine racemase [Shigella flexneri 2930-71]
          Length = 356

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 181/371 (48%), Gaps = 38/371 (10%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL ALK N   +   + +AR  +VVK NAYG G E+I  AL   G  D F + ++
Sbjct: 5   IQASLDLQALKQNLSIVRQAAPHARVWSVVKANAYGHGIERIWSAL---GATDGFALLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+  I+D + L   + S  QL     L +  +  P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEIYDQHRLTTCVHSNWQL---KALQNARLKAPL 118

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+V++G NRLG      L           +G+++L+ SH A A+ P     S  + R
Sbjct: 119 DIYLKVNSGMNRLGFQSDRVLTVWQQLRAMANVGEMTLM-SHFAEAEHPDG--ISGAMAR 175

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQ 233
                   +G+E   SL++S+  L  P  HF   RPGI LYG +      D  N    ++
Sbjct: 176 IE---QAAEGLECRRSLSNSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTG--LR 230

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  + II ++   AGE V YGG+     +  I + A GYADGYP         H+P+
Sbjct: 231 PVMTLSSEIIGVQTLKAGERVGYGGRYTACDEQRIGIVAAGYADGYP--------RHAPT 282

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTT 353
              G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT 
Sbjct: 283 ---GAPVLVDGVRTMTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKIDDVAAAAGTV 339

Query: 354 NYDLLVRIGTR 364
            Y+L+  +  R
Sbjct: 340 GYELMCALALR 350


>gi|24112577|ref|NP_707087.1| alanine racemase [Shigella flexneri 2a str. 301]
 gi|30062707|ref|NP_836878.1| alanine racemase [Shigella flexneri 2a str. 2457T]
 gi|24051477|gb|AAN42794.1| alanine racemase 2 [Shigella flexneri 2a str. 301]
 gi|30040955|gb|AAP16685.1| alanine racemase 2 [Shigella flexneri 2a str. 2457T]
 gi|281600603|gb|ADA73587.1| Alanine racemase [Shigella flexneri 2002017]
 gi|313649368|gb|EFS13799.1| alanine racemase [Shigella flexneri 2a str. 2457T]
 gi|332760272|gb|EGJ90562.1| alanine racemase [Shigella flexneri K-671]
 gi|333019431|gb|EGK38714.1| alanine racemase [Shigella flexneri K-304]
          Length = 356

 Score =  147 bits (371), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 116/371 (31%), Positives = 181/371 (48%), Gaps = 38/371 (10%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL ALK N   +   + +AR  +VVK NAYG G E+I  AL   G  D F + ++
Sbjct: 5   IQASLDLQALKQNLSIVRQAAPHARVWSVVKANAYGHGIERIWSAL---GATDGFALLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+  I+D + L   + S  QL     L +  +  P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEIYDQHRLTTCVHSNWQL---KALQNARLKAPL 118

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+V++G NRLG      L           +G+++L+ SH A A+ P     ++    
Sbjct: 119 DIYLKVNSGMNRLGFQSDRVLTVWQQLRAMANVGEMTLM-SHFAEAEHPDGISGAMA--- 174

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQ 233
              +    +G+E   SL++S+  L  P  HF   RPGI LYG +      D  N    ++
Sbjct: 175 --RIEQAAEGLECRRSLSNSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTG--LR 230

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  + II ++   AGE V YGG+     +  I + A GYADGYP         H+P+
Sbjct: 231 PVMTLSSEIIGVQTLKAGERVGYGGRYTARDEQRIGIVAAGYADGYP--------RHAPT 282

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTT 353
              G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT 
Sbjct: 283 ---GAPVLVDGVRTMTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKIDDVAAAAGTV 339

Query: 354 NYDLLVRIGTR 364
            Y+L+  +  R
Sbjct: 340 GYELMCALALR 350


>gi|149907726|ref|ZP_01896473.1| alanine racemase [Moritella sp. PE36]
 gi|149809396|gb|EDM69325.1| alanine racemase [Moritella sp. PE36]
          Length = 357

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 111/368 (30%), Positives = 182/368 (49%), Gaps = 26/368 (7%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +I L +L++N   +  ++ +++  AVVK NAYG G   +A AL +  V  F V  VEE +
Sbjct: 7   EICLQSLQHNVQQIKNIAPHSKIMAVVKANAYGHGLLAVASALTD--VDAFAVARVEEAL 64

Query: 70  KLRLYTPQARIFVLYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHP--YALQ 127
            LR       I +L G     E  I   N I     + Q     +L    +  P    L+
Sbjct: 65  TLRSGGIVKPILLLEGFFSTDELPILVANNIQTSVHIEQQ--LDELEQADLEAPIHVWLK 122

Query: 128 VDTGFNRLGL---SLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
           +DTG +RLG+   + + A++   N  N  + Q + +++H +CAD+    +   Q+  F  
Sbjct: 123 MDTGMHRLGIRPDNCKRAIERLKN--NPNVVQPARLMTHFSCADEADPSITQRQINIFDE 180

Query: 185 LISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKS---HPMQTVVTAEAR 241
           L++  +G E S+A+S+G+L  P+ H    RPGI LYG +  I  +   H ++ V+T    
Sbjct: 181 LVAGEEG-EHSIANSAGVLAWPSAHRDWIRPGIMLYGVSPMIGATAVEHDLKPVMTLTTD 239

Query: 242 IILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGF 301
           +I +     GE   YGG    + D+ + V A+GY DGYP     +  E +P         
Sbjct: 240 LIAVHDIKKGETTGYGGIWSASTDTRLGVVAVGYGDGYPR----MAPEGTPV-------L 288

Query: 302 IKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRI 361
           I G +VPI+G+++MDM   D+      +VGD + ++G  +  + VA   GT  Y+L+ ++
Sbjct: 289 INGRIVPIVGRVSMDMLTVDLGVDCQDKVGDKVIMWGAGLPAELVAEHIGTIAYELVTKL 348

Query: 362 GTRYAKFY 369
             R    Y
Sbjct: 349 TQRVTLKY 356


>gi|302184903|ref|ZP_07261576.1| alanine racemase [Pseudomonas syringae pv. syringae 642]
          Length = 357

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 120/374 (32%), Positives = 186/374 (49%), Gaps = 34/374 (9%)

Query: 8   RLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEE 67
           R  IDL AL++N+      SG  +  AVVK +AYG G  ++A AL  A    F V  +EE
Sbjct: 5   RAFIDLQALRHNYQLARENSGG-KALAVVKADAYGHGAVRVAQAL-EAQADGFAVACIEE 62

Query: 68  GVKLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYAL 126
            ++LR    +A + +L G     E  +I + +L  V+ +  QL    +    G      L
Sbjct: 63  ALELRAAGIRAPVLLLEGFFEADELALIVEHDLWTVVHATWQLEAIEQ-AHLGKPITVWL 121

Query: 127 QVDTGFNRLGLSLQEALDFTHNSFNKKL--GQLSLII--SHLACADDPSSHVNSVQLERF 182
           ++DTG +R+GL   E       ++ + L  G+++ I+  SH + AD+ +S  +  QL  F
Sbjct: 122 KLDTGMHRVGLHPHE----YQAAYQRLLATGKVARIVLMSHFSRADELNSGCSDEQLAVF 177

Query: 183 RTLISHYKGI--EASLASSSGILLGPNYHFQLTRPGISLYGGTDKINKSHPM----QTVV 236
            T     KG+  E SL +S  +L  P      +RPGI LYG T    + HP+    Q V+
Sbjct: 178 ETF---RKGLAAETSLKNSPAVLGWPQIPSDWSRPGIMLYGAT-PFEQVHPLADRLQPVM 233

Query: 237 TAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFL 296
           T E++II +R+   GE V YG      R S I V A+GYADGYP         H+P+   
Sbjct: 234 TLESKIISVRELPVGEPVGYGATFVCDRPSRIGVVAMGYADGYP--------RHAPT--- 282

Query: 297 GGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYD 356
           G    I G    +LG+++MDM   D+TD     +G  ++++G  +   +VA  + T  Y+
Sbjct: 283 GTPVQIDGQPSRLLGRVSMDMLCVDLTDVPKAGLGSRVELWGKQVLASEVAQGAETIPYE 342

Query: 357 LLVRIGTRYAKFYT 370
           +   +  R  + Y+
Sbjct: 343 IFCNL-RRVPRIYS 355


>gi|191168521|ref|ZP_03030307.1| alanine racemase [Escherichia coli B7A]
 gi|309794276|ref|ZP_07688700.1| alanine racemase [Escherichia coli MS 145-7]
 gi|190901419|gb|EDV61182.1| alanine racemase [Escherichia coli B7A]
 gi|308122181|gb|EFO59443.1| alanine racemase [Escherichia coli MS 145-7]
          Length = 356

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 181/371 (48%), Gaps = 38/371 (10%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL ALK N   +   + +AR  +VVK NAYG G E+I  AL   G  D F + ++
Sbjct: 5   IQASLDLQALKQNLSIVRQAAPHARVWSVVKANAYGHGIERIWSAL---GATDGFALLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDTN-LIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+  I+D + L   + S  QL     L +  +  P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEIYDQHRLTTCVHSNWQL---KALQNARLKAPL 118

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+V++G NRLG      L           +G+++L+ SH A A+ P     S  + R
Sbjct: 119 DIYLKVNSGMNRLGFQPDRVLTVWQQLRAMANVGEMTLM-SHFAEAEHPDG--ISSAMAR 175

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQ 233
                   +G+E   SL++S+  L  P  HF   RPGI LYG +      D  N    ++
Sbjct: 176 IE---QAAEGLECRRSLSNSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTG--LR 230

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  + II ++   AGE V YGG+     +  I + A GYADGYP         H+P+
Sbjct: 231 PVMTLSSEIIGVQTLKAGERVGYGGRYTARDEQRIGIVAAGYADGYP--------RHAPT 282

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTT 353
              G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT 
Sbjct: 283 ---GTPVLVDGVRTMTVGAVSMDMLAVDLTPCPQAGIGTPVELWGKEIKIDDVAAAAGTV 339

Query: 354 NYDLLVRIGTR 364
            Y+L+  +  R
Sbjct: 340 GYELMCALALR 350


>gi|238782924|ref|ZP_04626952.1| Alanine racemase 1 [Yersinia bercovieri ATCC 43970]
 gi|238716127|gb|EEQ08111.1| Alanine racemase 1 [Yersinia bercovieri ATCC 43970]
          Length = 359

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 114/366 (31%), Positives = 182/366 (49%), Gaps = 24/366 (6%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVK 70
           ID  AL++N   +  ++  +R  AVVK NAYG G  + A  L +A    + V  + E + 
Sbjct: 8   IDRRALRHNLQQVRRMAPQSRLIAVVKANAYGHGLLETAHTLQDADC--YGVARIGEALM 65

Query: 71  LRLYTPQARIFVLYGIHPGQEKIIFDTNLIP-VISSVPQLTFYSKLMSCGVSHP--YALQ 127
           LR       I +L G    ++  I   N I   I S+ QL     L +  +  P    ++
Sbjct: 66  LRSGGIVKPILLLEGFFAAEDLPILVANRIETAIHSIEQL---EALEAADLPAPINVWMK 122

Query: 128 VDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLI 186
           +DTG +RLG+  + A       S  + + Q   I+SH + AD+P       QL  F    
Sbjct: 123 LDTGMHRLGVRPEHAPALYQRLSTCRNVIQPVNIMSHFSRADEPQVETTRQQLSCFDAFA 182

Query: 187 SHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT--DKINKSH-PMQTVVTAEARII 243
           +   G + S+A+S GILL P  H    RPGI LYG +  D+   SH  +   +  ++ +I
Sbjct: 183 ADKPG-KQSIAASGGILLWPEAHRDWVRPGIILYGVSPLDEPYASHFNLLPAMALKSSLI 241

Query: 244 LIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIK 303
            +R+  AGE V YGG     RD+ + V AIGY DGYP +        +PS   G   ++ 
Sbjct: 242 AVREHKAGEPVGYGGTWISERDTRLGVVAIGYGDGYPRS--------APS---GTPMWVN 290

Query: 304 GYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGT 363
           G  V I+G+++MDM   D+      +VGD + ++G ++ ++ +A  +G + Y+L+ ++ +
Sbjct: 291 GREVCIVGRVSMDMISVDLGPDAHDKVGDEVLLWGAELPVERIAACTGISAYELITKLTS 350

Query: 364 RYAKFY 369
           R A  Y
Sbjct: 351 RVAMEY 356


>gi|283851833|ref|ZP_06369110.1| alanine racemase [Desulfovibrio sp. FW1012B]
 gi|283572749|gb|EFC20732.1| alanine racemase [Desulfovibrio sp. FW1012B]
          Length = 373

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 118/377 (31%), Positives = 180/377 (47%), Gaps = 31/377 (8%)

Query: 3   SNEFLRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFV 62
           ++ +LR ++ L  +  N+  +  L G  R  AV+K +AYG G  + A  L  AG   F V
Sbjct: 4   AHNYLRTRVRLDHIAANYKRLAGLGG--RVLAVIKADAYGHGLLETARVLTGAGCDGFAV 61

Query: 63  TSVEEGVKLRLYTPQARIFVLYG-IHPGQEKIIFDTNLIPVISSVPQLT-FYSKLMSCGV 120
            SV EG  LR   P+A I  L G + P  + +I   ++IP I    QL     +     V
Sbjct: 62  GSVAEGAALRAAIPRAAIVSLLGPVLPEDDAMILGHSIIPFIHDFGQLERLAGRAARKRV 121

Query: 121 SHPYALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHV-NSVQL 179
               AL+ DTG  RLG    +  +      +    +++++ SHLA ADDP++    + Q 
Sbjct: 122 KARVALKFDTGMARLGFVEADVPELLKRLEDMPAIEVAMVGSHLATADDPAAFAFVAEQG 181

Query: 180 ERFRTLISHYK----GIEASLASSSGILL-GPNYHFQLTRPGISLYG-----GTDKINKS 229
           E F  + +  +      E SL +S+GI+     + F+  R GI+LYG     GTD+    
Sbjct: 182 EGFGRICAALRRAGLAFEGSLCNSAGIMAHADRFGFETRRAGIALYGVNPFLGTDRETLG 241

Query: 230 HPMQTVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSE 289
             +   +    RI+ +    AG  VSYG      RD  +AV A GYAD Y   LS     
Sbjct: 242 QGLVAAMETVTRIVSVHDVAAGRSVSYGRTFTAERDMRVAVVAAGYADAYSRGLS----- 296

Query: 290 HSPSVFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIF---GPD-IKLDD 345
           ++ ++ L GK       VPI+G++ M +T  D+T  ++   GD I +    GP+ +  +D
Sbjct: 297 NAGAMCLAGK------RVPIVGRVCMQLTAVDVT-GIACAPGDVIHLLGGQGPEAVTAND 349

Query: 346 VALASGTTNYDLLVRIG 362
           VA   GT  Y++L   G
Sbjct: 350 VAGWWGTIPYEVLCLFG 366


>gi|323977248|gb|EGB72335.1| alanine racemase [Escherichia coli TW10509]
          Length = 356

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 116/371 (31%), Positives = 180/371 (48%), Gaps = 38/371 (10%)

Query: 7   LRLKIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQD-FFVTSV 65
           ++  +DL ALK N   +   + +AR  +VVK NAYG G E+I  AL   G  D F + ++
Sbjct: 5   IQASLDLQALKQNLSIVRQAAPHARVWSVVKANAYGHGIERIWSAL---GATDGFALLNL 61

Query: 66  EEGVKLRLYTPQARIFVLYGIHPGQEKIIFDT-NLIPVISSVPQLTFYSKLMSCGVSHPY 124
           EE + LR    +  I +L G    Q+  I+D   L   + S  QL     L +  +  P 
Sbjct: 62  EEAITLRERGWKGPILMLEGFFHAQDLEIYDQYRLTTCVHSNWQL---KALQNARLKAPL 118

Query: 125 A--LQVDTGFNRLGLSLQEALDFTHN-SFNKKLGQLSLIISHLACADDPSSHVNSVQLER 181
              L+V++G NRLG      L           +G+++L+ SH A A+ P     ++    
Sbjct: 119 DIYLKVNSGMNRLGFQPDRVLTVWQQLRAMANVGEMTLM-SHFAEAEHPEGIAGAMA--- 174

Query: 182 FRTLISHYKGIEA--SLASSSGILLGPNYHFQLTRPGISLYGGT------DKINKSHPMQ 233
              +    +G+E   SL++S+  L  P  HF   RPGI LYG +      D  N    ++
Sbjct: 175 --RIEQAAEGLECRRSLSNSAATLWHPEAHFDWVRPGIILYGASPSGQWRDIANTG--LR 230

Query: 234 TVVTAEARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPS 293
            V+T  + II ++   AGE V YGG+     +  I + A GYADGYP         H+P+
Sbjct: 231 PVMTLSSEIIGVQTLKAGERVGYGGRYTARDEQRIGIVAAGYADGYP--------RHAPT 282

Query: 294 VFLGGKGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTT 353
              G    + G     +G ++MDM   D+T      +G  ++++G +IK+DDVA A+GT 
Sbjct: 283 ---GTPVLVDGVRTMTVGTVSMDMLAVDLTPCPQAGIGTPVELWGKEIKIDDVAAAAGTV 339

Query: 354 NYDLLVRIGTR 364
            Y+L+  +  R
Sbjct: 340 GYELMCALALR 350


>gi|94985480|ref|YP_604844.1| alanine racemase [Deinococcus geothermalis DSM 11300]
 gi|166967411|sp|Q1IYK9|ALR_DEIGD RecName: Full=Alanine racemase
 gi|94555761|gb|ABF45675.1| alanine racemase [Deinococcus geothermalis DSM 11300]
          Length = 355

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 117/366 (31%), Positives = 175/366 (47%), Gaps = 35/366 (9%)

Query: 11  IDLTALKNNWHSMNALSGNARTAAV--VKDNAYGLGCEKIAP-ALYNAGVQDFFVTSVEE 67
           I  +AL++N   + AL+  A T  +  VK +AYG G E +A  A  +  V  F V    E
Sbjct: 12  ISESALRSN---LTALARQAGTQLLLPVKADAYGHGMEIVARLAARHPAVWGFAVAVPRE 68

Query: 68  GVKLRLYTPQARIFVLYGIHPGQEKIIFDTNL---IPVISSVPQLTFYSKLMSCGVSHPY 124
              L        I +L    P  E++    +L   +PV S    L     L +   +H  
Sbjct: 69  AATLAALGLGKPILLL--TPPTLEEMGPLADLGVRLPVAS----LAEAEALPAHARAH-- 120

Query: 125 ALQVDTGFNRLGLSLQEALDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRT 184
            L+VDTG NRLG   +EA+        +  G L    +H A AD+P       Q  RF+ 
Sbjct: 121 -LKVDTGMNRLGARPEEAVRVGQRLAER--GLLEGAYTHFATADEPDLSFARQQFARFQE 177

Query: 185 LISHYKGIEASLASSSGIL-LGPNYHFQLTRPGISLYG-GTDKINKSHPMQTVVTAEARI 242
           +++    + A  A+  G+L  GP     L RPG++ YG     +    P+  V+T +AR+
Sbjct: 178 VLAALPPVLAHAANGGGVLSFGPLPSLSLARPGLASYGFAPAHLRGVAPLTPVMTLQARV 237

Query: 243 ILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFI 302
             +     GE VSYGG  + TR +++A   IGYADGYP   +G                +
Sbjct: 238 THVHAVYPGESVSYGGLWRATRKTIVATVGIGYADGYPRNATGKACV-----------LV 286

Query: 303 KGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPD-IKLDDVALASGTTNYDLLVRI 361
           +G   P+LG+I MD  M D+TD L + VGD+++++G D I + DVA   GT  Y++L  +
Sbjct: 287 RGECRPVLGRICMDQCMVDVTD-LEVRVGDWVEVWGTDKITVTDVAAWGGTVEYEVLTGL 345

Query: 362 GTRYAK 367
           G R  +
Sbjct: 346 GARVER 351


>gi|323144440|ref|ZP_08079044.1| alanine racemase [Succinatimonas hippei YIT 12066]
 gi|322415779|gb|EFY06509.1| alanine racemase [Succinatimonas hippei YIT 12066]
          Length = 359

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 114/366 (31%), Positives = 178/366 (48%), Gaps = 30/366 (8%)

Query: 10  KIDLTALKNNWHSMNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGV 69
           +I+  ALKNN   +      ++  AVVK NAYG G  ++A ALY   V  F V  ++E +
Sbjct: 7   EINTQALKNNIDIIKTYVPGSKIVAVVKANAYGHGLYQVASALYEK-VDAFAVARLDEAL 65

Query: 70  KLRLYTPQARIFVLYGIHPGQE-KIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQV 128
            LR    +  I +L G    ++   I  + +   +  + QL    +       H + L++
Sbjct: 66  NLREQGIKKPIILLEGFFNEEDLPFIARSEIYTAVHDMEQLEAIERAKVEKPLHCW-LKI 124

Query: 129 DTGFNRLG------LSLQEALDFTHNSFNKKLGQLSLIISHLACADDPS-SHVNSVQLER 181
           D G +RLG      L+++E L+   N   K +G    +ISHL+ AD P+ +  N  Q+  
Sbjct: 125 DIGMHRLGADPQDVLNMKERLEKCPNVL-KPIG----LISHLSVADTPTETDYNIAQINY 179

Query: 182 FRTLISHYKGIEASLASSSGILLGPNYHFQLTRPGISLYGGT---DKINKSHPMQTVVTA 238
           FR    H+ G +  L++S+GIL  P+ H    RPGI +YG +   DK+     ++ V+T 
Sbjct: 180 FRETAKHFSG-DLCLSNSAGILAWPDSHTPWVRPGIIMYGISPFEDKVGSDFGLKPVMTL 238

Query: 239 EARIILIRKALAGELVSYGGQKKLTRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGG 298
           ++ II IRK   G  V YG       D+ I + A GY DGYP          +P+   G 
Sbjct: 239 KSSIIAIRKVKKGAKVGYGAAWTAPYDTTIGIVATGYGDGYPRV--------APN---GT 287

Query: 299 KGFIKGYMVPILGKITMDMTMFDITDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLL 358
              I G  VP  G + MDM   D+  +   +VGD   ++G  + ++ +A   GT  Y+L+
Sbjct: 288 PVLINGKYVPTAGHVCMDMMFVDLGLNSQDKVGDEAILWGKGLPVEKIAKLCGTIPYELV 347

Query: 359 VRIGTR 364
            R+  R
Sbjct: 348 CRVMPR 353


>gi|157157280|ref|YP_001462440.1| alanine racemase [Escherichia coli E24377A]
 gi|193066540|ref|ZP_03047582.1| alanine racemase [Escherichia coli E22]
 gi|193071186|ref|ZP_03052109.1| alanine racemase [Escherichia coli E110019]
 gi|194425883|ref|ZP_03058439.1| alanine racemase [Escherichia coli B171]
 gi|194434909|ref|ZP_03067154.1| alanine racemase [Shigella dysenteriae 1012]
 gi|209918429|ref|YP_002292513.1| alanine racemase [Escherichia coli SE11]
 gi|218694704|ref|YP_002402371.1| alanine racemase [Escherichia coli 55989]
 gi|218700229|ref|YP_002407858.1| alanine racemase [Escherichia coli IAI39]
 gi|218704705|ref|YP_002412224.1| alanine racemase [Escherichia coli UMN026]
 gi|256018560|ref|ZP_05432425.1| alanine racemase [Shigella sp. D9]
 gi|260843482|ref|YP_003221260.1| alanine racemase 2, PLP-binding [Escherichia coli O103:H2 str.
           12009]
 gi|260854851|ref|YP_003228742.1| alanine racemase 2, PLP-binding [Escherichia coli O26:H11 str.
           11368]
 gi|293404725|ref|ZP_06648717.1| alr [Escherichia coli FVEC1412]
 gi|298380368|ref|ZP_06989967.1| alr [Escherichia coli FVEC1302]
 gi|300816877|ref|ZP_07097097.1| alanine racemase [Escherichia coli MS 107-1]
 gi|300821043|ref|ZP_07101192.1| alanine racemase [Escherichia coli MS 119-7]
 gi|300896564|ref|ZP_07115085.1| alanine racemase [Escherichia coli MS 198-1]
 gi|300906907|ref|ZP_07124581.1| alanine racemase [Escherichia coli MS 84-1]
 gi|300920384|ref|ZP_07136819.1| alanine racemase [Escherichia coli MS 115-1]
 gi|300921848|ref|ZP_07138005.1| alanine racemase [Escherichia coli MS 182-1]
 gi|301305555|ref|ZP_07211646.1| alanine racemase [Escherichia coli MS 124-1]
 gi|301327101|ref|ZP_07220381.1| alanine racemase [Escherichia coli MS 78-1]
 gi|307310056|ref|ZP_07589706.1| alanine racemase [Escherichia coli W]
 gi|331662583|ref|ZP_08363506.1| alanine racemase [Escherichia coli TA143]
 gi|331667571|ref|ZP_08368435.1| alanine racemase [Escherichia coli TA271]
 gi|331676966|ref|ZP_08377662.1| alanine racemase [Escherichia coli H591]
 gi|331682674|ref|ZP_08383293.1| alanine racemase [Escherichia coli H299]
 gi|332279622|ref|ZP_08392035.1| alanine racemase [Shigella sp. D9]
 gi|157079310|gb|ABV19018.1| alanine racemase [Escherichia coli E24377A]
 gi|192925819|gb|EDV80471.1| alanine racemase [Escherichia coli E22]
 gi|192955518|gb|EDV85998.1| alanine racemase [Escherichia coli E110019]
 gi|194415938|gb|EDX32204.1| alanine racemase [Escherichia coli B171]
 gi|194416842|gb|EDX32966.1| alanine racemase [Shigella dysenteriae 1012]
 gi|209911688|dbj|BAG76762.1| alanine racemase [Escherichia coli SE11]
 gi|218351436|emb|CAU97144.1| alanine racemase 2, PLP-binding [Escherichia coli 55989]
 gi|218370215|emb|CAR18011.1| alanine racemase 2, PLP-binding [Escherichia coli IAI39]
 gi|218431802|emb|CAR12687.1| alanine racemase 2, PLP-binding [Escherichia coli UMN026]
 gi|257753500|dbj|BAI25002.1| alanine racemase 2, PLP-binding [Escherichia coli O26:H11 str.
           11368]
 gi|257758629|dbj|BAI30126.1| alanine racemase 2, PLP-binding [Escherichia coli O103:H2 str.
           12009]
 gi|291426933|gb|EFE99959.1| alr [Escherichia coli FVEC1412]
 gi|298277810|gb|EFI19324.1| alr [Escherichia coli FVEC1302]
 gi|300359593|gb|EFJ75463.1| alanine racemase [Escherichia coli MS 198-1]
 gi|300401340|gb|EFJ84878.1| alanine racemase [Escherichia coli MS 84-1]
 gi|300412600|gb|EFJ95910.1| alanine racemase [Escherichia coli MS 115-1]
 gi|300421774|gb|EFK05085.1| alanine racemase [Escherichia coli MS 182-1]
 gi|300526342|gb|EFK47411.1| alanine racemase [Escherichia coli MS 119-7]
 gi|30053065