RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780335|ref|YP_003064748.1| colicin V production protein [Candidatus Liberibacter asiaticus str. psy62] (156 letters) >gnl|CDD|182773 PRK10845, PRK10845, colicin V production protein; Provisional. Length = 162 Score = 33.2 bits (76), Expect = 0.033 Identities = 28/115 (24%), Positives = 56/115 (48%), Gaps = 4/115 (3%) Query: 3 ITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQ 62 + + D I S+++++ RG E +SL W A + + Y L + F+ + Sbjct: 1 MVWIDYAIIAVIGFSALVSLIRGFVREALSLVTWGCAFFVASHYYTYLSVWFTG-FEDEL 59 Query: 63 VAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVL--LDKILGCAFGGVRGLFLL 115 V + I LF+ L V +I+ ++ + ++ L D++LG FG +RG+ ++ Sbjct: 60 VRNGIAIAVLFIATLIVGAIVNYVIGQLVE-KTGLSGTDRVLGVCFGALRGVLIV 113 >gnl|CDD|183073 PRK11281, PRK11281, hypothetical protein; Provisional. Length = 1113 Score = 27.2 bits (61), Expect = 1.9 Identities = 12/48 (25%), Positives = 21/48 (43%), Gaps = 7/48 (14%) Query: 37 IVAAIMTRYLYPMLLE-----RVSEFFKSKQVAIIMTIIPLFLIILTV 79 I A++ ++P+ E V ++TI P+ LI+L V Sbjct: 659 IALALIAFLVWPLCRESWRDKESHTLRLV--VRTVLTIAPIALIVLVV 704 >gnl|CDD|182613 PRK10644, PRK10644, arginine:agmatin antiporter; Provisional. Length = 445 Score = 26.7 bits (59), Expect = 2.7 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Query: 37 IVAAIMTRYLYPMLLERVS-EFFKSKQVAIIMTIIPLFLIILTVVSILL 84 IV +MT + + S EF V++I T++P + T ++LL Sbjct: 329 IVGVLMTIFQLSSISPNASKEFGLVSSVSVIFTLVPY---LYTCAALLL 374 >gnl|CDD|182422 PRK10381, PRK10381, LPS O-antigen length regulator; Provisional. Length = 377 Score = 26.2 bits (58), Expect = 3.5 Identities = 10/35 (28%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Query: 50 LLERVSEFFKSKQVAIIMTIIPLFLIILTVVSILL 84 L E +S +K+K+ I+ I F ++S +L Sbjct: 29 LFELISVLWKAKKT--IIAITFAFACAGLLISFIL 61 >gnl|CDD|183647 PRK12647, PRK12647, putative monovalent cation/H+ antiporter subunit A; Reviewed. Length = 761 Score = 25.6 bits (57), Expect = 5.4 Identities = 13/57 (22%), Positives = 22/57 (38%), Gaps = 4/57 (7%) Query: 62 QVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIIT 118 Q I + L +++L + L + R+R D + G L LL +T Sbjct: 639 QFLIETLSVILLVLVLYRLPSFLDLSPPGQRLR----DAAIALGCGVGMTLLLLAVT 691 >gnl|CDD|185579 PTZ00370, PTZ00370, STEVOR; Provisional. Length = 296 Score = 25.8 bits (57), Expect = 5.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 69 IIPLFLIILTVVSILLKI 86 I L L+IL VV I+L I Sbjct: 259 IAALVLLILAVVLIILYI 276 >gnl|CDD|150064 pfam09265, Cytokin-bind, Cytokinin dehydrogenase 1, FAD and cytokinin binding. Members of this family adopt an alpha+beta sandwich structure with an antiparallel beta-sheet, in a ferredoxin-like fold. They are predominantly found in plant cytokinin dehydrogenase 1, where they are capable of binding both FAD and cytokinin substrates. The substrate displays a 'plug-into-socket' binding mode that seals the catalytic site and precisely positions the carbon atom undergoing oxidation in close contact with the reactive locus of the flavin. Length = 280 Score = 25.8 bits (57), Expect = 5.6 Identities = 16/59 (27%), Positives = 26/59 (44%), Gaps = 12/59 (20%) Query: 13 FISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKSKQVAIIMTIIP 71 F+ S +L RG+F ++ TN I+ +YPM +SK + +IP Sbjct: 146 FVPKSRILDFDRGVFKGILKNTN-NSGPIL---VYPMN--------RSKWDDRMSAVIP 192 >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional. Length = 623 Score = 25.2 bits (55), Expect = 8.3 Identities = 8/21 (38%), Positives = 10/21 (47%) Query: 102 LGCAFGGVRGLFLLIITTSCW 122 +G AFG L+I CW Sbjct: 547 IGIAFGVSVAFLFLVICAMCW 567 >gnl|CDD|184839 PRK14829, PRK14829, undecaprenyl pyrophosphate synthase; Provisional. Length = 243 Score = 25.1 bits (55), Expect = 8.8 Identities = 12/39 (30%), Positives = 14/39 (35%) Query: 92 RIRSVLLDKILGCAFGGVRGLFLLIITTSCWNLIVHESR 130 VL D + G GV L L +T W E R Sbjct: 42 AGEPVLFDVVAGAIEAGVPYLSLYTFSTENWKRSPDEVR 80 >gnl|CDD|151212 pfam10726, DUF2518, Protein of function (DUF2518). This family is conserved in Cyanobacteria. Several members are annotated as the protein Ycf51. The function is not known. Length = 145 Score = 24.9 bits (55), Expect = 9.7 Identities = 17/65 (26%), Positives = 26/65 (40%), Gaps = 15/65 (23%) Query: 62 QVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTSC 121 + L L +LTV++ + + IR R V GV F L++T SC Sbjct: 9 TATKWLGWATLGLAVLTVLAFIFR---WGIRFRLV-----------GVTS-FTLLLTASC 53 Query: 122 WNLIV 126 W + Sbjct: 54 WAFSL 58 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.333 0.144 0.426 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,464,548 Number of extensions: 150016 Number of successful extensions: 695 Number of sequences better than 10.0: 1 Number of HSP's gapped: 688 Number of HSP's successfully gapped: 75 Length of query: 156 Length of database: 5,994,473 Length adjustment: 85 Effective length of query: 71 Effective length of database: 4,157,793 Effective search space: 295203303 Effective search space used: 295203303 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 53 (24.2 bits)