RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780335|ref|YP_003064748.1| colicin V production protein [Candidatus Liberibacter asiaticus str. psy62] (156 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 31.8 bits (72), Expect = 0.076 Identities = 30/182 (16%), Positives = 51/182 (28%), Gaps = 78/182 (42%) Query: 27 FSEMISLTNWIVAAIMTRY-LYPMLLE----RVSEFFKSKQVAIIMTIIPLFLIILTVVS 81 F E+ L Y Y +L+ +E + + +F L ++ Sbjct: 170 FEELRDL-----------YQTYHVLVGDLIKFSAETLSE-LIRTTLDAEKVFTQGLNILE 217 Query: 82 ILLK---------IMSTPIRIRSV----LLD--------KILGCAFGGVRGLF------- 113 L ++S PI S ++ K+LG G +R Sbjct: 218 WLENPSNTPDKDYLLSIPI---SCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHS 274 Query: 114 ------LLIITTSCWNLIVHESREPAWIQKSISKKALD---RMGTRLQ----------SI 154 + I T W ES +KA+ +G R SI Sbjct: 275 QGLVTAVAIAETDSW-----ESFF------VSVRKAITVLFFIGVRCYEAYPNTSLPPSI 323 Query: 155 VQ 156 ++ Sbjct: 324 LE 325 Score = 25.7 bits (56), Expect = 4.4 Identities = 21/159 (13%), Positives = 42/159 (26%), Gaps = 79/159 (49%) Query: 47 YPMLLERVSEFFKSKQVAIIMTIIPLFLI---ILTVVSILLKIMSTPIR-----IR---- 94 + +L F++ +L I + + LL+ T + I+ Sbjct: 80 FDQVLNLCLTEFENC-----------YLEGNDIHALAAKLLQENDTTLVKTKELIKNYIT 128 Query: 95 --------------SVLLD-------KILGCA-FGG----------VRGLF-----LL-- 115 S L +++ A FGG +R L+ L+ Sbjct: 129 ARIMAKRPFDKKSNSALFRAVGEGNAQLV--AIFGGQGNTDDYFEELRDLYQTYHVLVGD 186 Query: 116 IITTSCWNLIVHESREP--------------AWIQKSIS 140 +I S + R W++ + Sbjct: 187 LIKFSA-ETLSELIRTTLDAEKVFTQGLNILEWLENPSN 224 >1dqu_A Isocitrate lyase; beta barrel; 2.80A {Emericella nidulans} SCOP: c.1.12.7 Length = 538 Score = 28.7 bits (64), Expect = 0.60 Identities = 6/41 (14%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Query: 8 IFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYP 48 F +G + + + MA+ + + + ++ W ++ + P Sbjct: 73 SFTYGCLDPTMVTQMAKYL--DTVYVSGWQSSSTASSTDEP 111 >1ka1_A Halotolerance protein HAL2; nucleotidase, salt tolerance, inositol, hydrolase; HET: A3P; 1.30A {Saccharomyces cerevisiae} SCOP: e.7.1.1 PDB: 1k9y_A 1ka0_A* 1k9z_A* 1qgx_A* Length = 357 Score = 26.2 bits (56), Expect = 3.0 Identities = 5/29 (17%), Positives = 15/29 (51%) Query: 33 LTNWIVAAIMTRYLYPMLLERVSEFFKSK 61 T ++A+ R L+ +++ + +S+ Sbjct: 327 ATKGVIASSGPRELHDLVVSTSCDVIQSR 355 >2au5_A Conserved domain protein; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Enterococcus faecalis V583} SCOP: a.244.1.1 Length = 139 Score = 25.4 bits (55), Expect = 6.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Query: 16 ISSMLAMARGIFSEMISLTNWIVAAIM 42 +S+MLA RG F+ IS + IV A M Sbjct: 25 LSNMLAFTRGHFTGDISHFSPIVLAEM 51 >3ikm_A DNA polymerase subunit gamma-1; human mitochondrial DNA polymerase, disease mutation, DNA replication, DNA-binding, DNA-directed DNA polymerase; HET: DNA; 3.24A {Homo sapiens} Length = 1172 Score = 24.9 bits (54), Expect = 7.9 Identities = 10/26 (38%), Positives = 18/26 (69%), Gaps = 2/26 (7%) Query: 131 EPAWIQKSISKKALDRMGTRLQSIVQ 156 EP W+ S ++ DR+G+ L+++VQ Sbjct: 789 EPTWLTASNARP--DRVGSELKAMVQ 812 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.333 0.144 0.426 Gapped Lambda K H 0.267 0.0568 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,281,113 Number of extensions: 53882 Number of successful extensions: 261 Number of sequences better than 10.0: 1 Number of HSP's gapped: 261 Number of HSP's successfully gapped: 27 Length of query: 156 Length of database: 5,693,230 Length adjustment: 85 Effective length of query: 71 Effective length of database: 3,632,490 Effective search space: 257906790 Effective search space used: 257906790 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 52 (24.2 bits)