BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780335|ref|YP_003064748.1| colicin V production protein [Candidatus Liberibacter asiaticus str. psy62] (156 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780335|ref|YP_003064748.1| colicin V production protein [Candidatus Liberibacter asiaticus str. psy62] Length = 156 Score = 310 bits (795), Expect = 6e-87, Method: Compositional matrix adjust. Identities = 156/156 (100%), Positives = 156/156 (100%) Query: 1 MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKS 60 MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKS Sbjct: 1 MGITYFDIFCFGFISISSMLAMARGIFSEMISLTNWIVAAIMTRYLYPMLLERVSEFFKS 60 Query: 61 KQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTS 120 KQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTS Sbjct: 61 KQVAIIMTIIPLFLIILTVVSILLKIMSTPIRIRSVLLDKILGCAFGGVRGLFLLIITTS 120 Query: 121 CWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ 156 CWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ Sbjct: 121 CWNLIVHESREPAWIQKSISKKALDRMGTRLQSIVQ 156 >gi|254780247|ref|YP_003064660.1| 30S ribosomal protein S8 [Candidatus Liberibacter asiaticus str. psy62] Length = 129 Score = 22.3 bits (46), Expect = 4.7, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 111 GLFLLIITTSCWNLIVHESRE 131 GL ++I+TTS + H++RE Sbjct: 97 GLGIMIVTTSKGVMAGHQARE 117 >gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter asiaticus str. psy62] Length = 762 Score = 21.9 bits (45), Expect = 6.2, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Query: 108 GVRGLFLLIITTSCWNLIVHESREPAWIQKSISKKAL 144 G R +F T+C + SR P WI K SK+A+ Sbjct: 152 GQRTIFDKGTYTACSSCSKPNSRPPFWIVK--SKRAI 186 >gi|254780451|ref|YP_003064864.1| aconitate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 896 Score = 21.6 bits (44), Expect = 6.4, Method: Composition-based stats. Identities = 9/20 (45%), Positives = 12/20 (60%) Query: 119 TSCWNLIVHESREPAWIQKS 138 +S WN+ V ES W +KS Sbjct: 622 SSWWNIEVPESETYMWDEKS 641 >gi|254780483|ref|YP_003064896.1| putative inner membrane protein translocase component YidC [Candidatus Liberibacter asiaticus str. psy62] Length = 581 Score = 21.2 bits (43), Expect = 8.2, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 66 IMTIIPLFLIILTVVSILLKIMSTP 90 I+ IP+F I V+SI L++ P Sbjct: 433 ILLQIPVFFAIYKVISISLEMRHAP 457 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.333 0.144 0.426 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,086 Number of Sequences: 1233 Number of extensions: 2877 Number of successful extensions: 15 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 11 length of query: 156 length of database: 328,796 effective HSP length: 67 effective length of query: 89 effective length of database: 246,185 effective search space: 21910465 effective search space used: 21910465 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 35 (18.1 bits)