HHsearch alignment for GI: 254780336 and conserved domain: KOG0571

>KOG0571 consensus.
Probab=99.91  E-value=5e-23  Score=183.87  Aligned_cols=334  Identities=26%  Similarity=0.394  Sum_probs=208.9

Q ss_pred             CCEEEEEECCCCHHHHHH--HHHH-HHHCCCCCEEEEEEEECCEEEEEECCCCHHHHCCCHHHHHHCCCCEEEEEEECCC
Q ss_conf             565999981853368999--9998-7731588702799997996999804871676315044432068767898751222
Q gi|254780336|r   14 KCGVFGILGHPDAATLTA--IGLH-ALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETLSLLPGNMAIGHVRYST   90 (488)
Q Consensus        14 eCGI~Gi~~~~~~~~~~~--~gL~-~LQHRGqdsaGIa~~d~~~i~~~K~~GlV~dvf~~~~~l~~l~G~~~IGHvRYsT   90 (488)
T Consensus         1 MCGI~Av~~~~~~~~~~~~~l~ls~~~~hRgpd~sg~~~~~~~----------------------------~l~heRLAI   52 (543)
T KOG0571           1 MCGILAVLGHEDSEAKKPKALELSRRIRHRGPDWSGLAQRNDN----------------------------ILGHERLAI   52 (543)
T ss_pred             CCCEEEEECCCCHHHCCHHHHHHHHHHCCCCCCCCHHHEECCC----------------------------CCCCCCEEE
T ss_conf             9841213156404335744556777635899796522200455----------------------------434321057


Q ss_pred             CCCCCCCCCCCEEEECCCCEEEEEEEEEECCHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             68986002786787469971999996550878999999986498242343078988989873025670568999986530
Q gi|254780336|r   91 TGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGAIFQSTSDTEVILHLIARSQKNGSCDRFIDSLRHVQG  170 (488)
Q Consensus        91 ~G~~~~~n~QPf~~~~~~g~iaiaHNGnI~N~~eLr~~L~~~g~~f~s~sDTEvI~~Li~~~~~~~~~e~i~~~l~~l~G  170 (488)
T Consensus        53 vdp~--sg~QPi~~--~~~~~~~~vNGEIYNH~~Lr~~~~--~~~~~T~sDcEvIi~lY~kh-------g~~~~~~~LDG  119 (543)
T KOG0571          53 VDPT--SGAQPIVG--EDGTYVVTVNGEIYNHKKLREHCK--DFEFQTGSDCEVIIHLYEKH-------GGEQAICMLDG  119 (543)
T ss_pred             ECCC--CCCCCCCC--CCCCEEEEECCEECCHHHHHHHHH--HCCCCCCCCCEEEEEHHHHC-------CCHHHHHHHHH
T ss_conf             6688--67764213--787679987764454899998765--14423478841661157644-------72466777540


Q ss_pred             CEEEEEEEC--CEEEEEEECCCCCEEEEEECC-CEEEEEECCHHCCCCCCCEEEECCCCEEEEEEECCCCEEEEEEEECC
Q ss_conf             439999639--979999825665415998269-56999861200104787412331787079994089847998753077
Q gi|254780336|r  171 AYAMLALTR--TKLIATRDPIGIRPLIMGELH-GKPIFCSETCALEITGAKYIRDVENGETIVCELQEDGFISIDSYKNP  247 (488)
Q Consensus       171 ayslv~l~~--~~l~~~RDp~GiRPL~~G~~~-~~~v~ASEs~Al~~ig~~~irdv~PGEiivi~~~~~g~~~i~~~~~~  247 (488)
T Consensus       120 ~Fafvl~d~~~~kv~~aRDpiGv~~lY~g~~~~gs~~~aSe~k~l~d~-C~~i~~fpPgh~y~--~~~~~~---~r~f~p  193 (543)
T KOG0571         120 VFAFVLLDTKDDKVVAARDPIGVTPLYYGWDSDGSVYFASEMKCLEDD-CEKIESFPPGHYYT--SKTGKL---TRYFNP  193 (543)
T ss_pred             HEEEEEECCCCCEEEECCCCCCCEEEEEEECCCCCEEEEEEHHHHHHH-HHHHEECCCCCEEE--CCCCCC---CCCCCC
T ss_conf             137889527887478336876741347886178857874102023333-10004558841412--344664---678893


Q ss_pred             CCCCCCEEEEEHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCC-----CCCCCCCCHHHHHHHHHHHCCC------
Q ss_conf             65664200000100247430003728999999999999874865677-----2012001204779999998199------
Q gi|254780336|r  248 STSPERMCIFEYVYFARPDSIISGRSIYVSRRNMGKNLAKESPVIAD-----IVVPIPDGGVPAAIGYAKESGI------  316 (488)
Q Consensus       248 ~~~~~~~C~FEyIYFarpdS~~~g~~Vy~~R~~lG~~La~~~~~~~D-----iV~~VPdsg~~aA~gya~~~gi------  316 (488)
T Consensus       194 ----------~w~~~~~~s~p~d---~~~~r~~~~~aV~K--RLM~d~p~GvLLSGGLDSSLvAsia-~R~lk~~~~~~~  257 (543)
T KOG0571         194 ----------EWFDENIPSTPLD---YLALRHTLEKAVRK--RLMTDVPFGVLLSGGLDSSLVASIA-ARELKKAQAARG  257 (543)
T ss_pred             ----------HHHHCCCCCCCCC---HHHHHHHHHHHHHH--HHHCCCCEEEEEECCCHHHHHHHHH-HHHHHHHHHHCC
T ss_conf             ----------6650468888611---89999999999999--8631686158950773189999999-999987664127


Q ss_pred             ----CEEHHEE------CCCCCCCEEEECCHHHHHHHHHHCCCCCHHHHCCCCEEEEEHHHHHHHH-HHHHHHHHHHCCC
Q ss_conf             ----6001001------1765321011064467776532013432455338932897403533333-8889999985399
Q gi|254780336|r  317 ----PFEQGII------RNHYVGRTFIEPSHHIRAFGVKLKHSANRTILAGKRVVLIDDSIVRGTT-SVKIVQMIRSAGA  385 (488)
Q Consensus       317 ----p~~~~lv------kn~y~gRtFI~p~~~~R~~~v~~K~~~~~~~i~gk~vvlvDDSIVRGtT-~k~iv~~lr~aGa  385 (488)
T Consensus       258 ~~lhsFaIGle~SPDL~aarkV-Ad~igt~Hhe~~ft~qegidal~eVI~--hLETYDvttIRastpmyLlsr~Ikk~gv  334 (543)
T KOG0571         258 SKLHSFAIGLEDSPDLLAARKV-ADFIGTIHHEHTFTIQEGIDALDEVIY--HLETYDVTTIRASTPMYLLSRKIKKLGV  334 (543)
T ss_pred             CCCEEEEECCCCCHHHHHHHHH-HHHHCCCCEEEEECHHHHHHHHHHHHE--EEECCCCCEEECCCCHHHHHHHHHHCCE
T ss_conf             8754788528998537888999-987488523899758887778887742--4101344158617746789999976552


Q ss_pred             CEEEEEECCCCCCCCCCCCEECCCHHHH
Q ss_conf             7899996589805886565005897888
Q gi|254780336|r  386 SEVHLRVASPMVLYPDFYGIDIPDPTAL  413 (488)
Q Consensus       386 ~evh~ri~sPpi~~pc~yGid~p~~~eL  413 (488)
T Consensus       335 kmvlSGEGsDEifggYlYfh~APs~~~f  362 (543)
T KOG0571         335 KMVLSGEGSDEIFGGYLYFHKAPSAEEF  362 (543)
T ss_pred             EEEEECCCCHHHHCCEEEEECCCCHHHH
T ss_conf             8998157713442112110038897898