HHsearch alignment for GI: 254780337 and conserved domain: COG1064

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only].
Probab=96.94  E-value=0.019  Score=36.44  Aligned_cols=97  Identities=27%  Similarity=0.289  Sum_probs=64.9

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
T Consensus       166 pG~~V~I~G~G-GlGh~avQ~Aka~ga~Via~~~~~~K~e~a~----~lGAd~~-i--~~~~~~~~~~~~~~-------~  230 (339)
T COG1064         166 PGKWVAVVGAG-GLGHMAVQYAKAMGAEVIAITRSEEKLELAK----KLGADHV-I--NSSDSDALEAVKEI-------A  230 (339)
T ss_pred             CCCEEEEECCC-HHHHHHHHHHHHCCCEEEEEECCHHHHHHHH----HHCCCEE-E--ECCCCHHHHHHHHH-------C
T ss_conf             99899998774-8999999999986996999957877999999----8488289-9--76781166776734-------7


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHH
Q ss_conf             7998768758888886765999999999999899999999999999860898699978835
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGA  157 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~  157 (257)
T Consensus       231 d~ii~tv~-~~---~~~-----------------------~~l~~l--~~~G~~v~vG~~~  262 (339)
T COG1064         231 DAIIDTVG-PA---TLE-----------------------PSLKAL--RRGGTLVLVGLPG  262 (339)
T ss_pred             CEEEECCC-HH---HHH-----------------------HHHHHH--HCCCEEEEECCCC
T ss_conf             39999877-45---599-----------------------999986--4297899978888