HHsearch alignment for GI: 254780337 and conserved domain: COG1086

>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].
Probab=99.61  E-value=2.3e-12  Score=102.91  Aligned_cols=217  Identities=18%  Similarity=0.220  Sum_probs=164.0

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCC-EEEEEECCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             524889999938998688999999998899-8999978989999999999864--9928999878999999999999999
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGA-YVIACGRSISQLEKLKNALQKI--NKKIDIFAFDLRDSNALELTKTYIA   90 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~-~Vi~~~r~~~~l~~~~~~~~~~--g~~~~~~~~Dv~d~~~v~~~~~~~~   90 (257)
T Consensus       246 ~~~~gK~vLVTGagGSiGsel~~qil~~~p~~i~l~~~~E~~~~~i~~el~~~~~~~~~~~~igdVrD~~~~~~~~~~~-  324 (588)
T COG1086         246 AMLTGKTVLVTGGGGSIGSELCRQILKFNPKEIILFSRDEYKLYLIDMELREKFPELKLRFYIGDVRDRDRVERAMEGH-  324 (588)
T ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHCC-
T ss_conf             6707988999689873679999999854987899961763779999999986278751689963534689999998638-


Q ss_pred             HHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHH
Q ss_conf             98189879987687588888867659999999999998999999999999998608986999788356478898368898
Q gi|254780337|r   91 KRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSA  170 (257)
Q Consensus        91 ~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~a  170 (257)
T Consensus       325 ----kvd~VfHAAA-~-KHVPl~E~nP~E---ai~tNV~GT~nv~~aa~~----~~V~~~V~iSTDKAV~P---tNvmGa  388 (588)
T COG1086         325 ----KVDIVFHAAA-L-KHVPLVEYNPEE---AIKTNVLGTENVAEAAIK----NGVKKFVLISTDKAVNP---TNVMGA  388 (588)
T ss_pred             ----CCCEEEEHHH-H-CCCCCHHCCHHH---HHHHHHHHHHHHHHHHHH----HCCCEEEEEECCCCCCC---CHHHHH
T ss_conf             ----8866887555-5-368631018899---998721738999999998----39778999705866688---417668


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCC------HHHHHHCCCCCCCC---------CCCHHHHHHHHHHHHCHH
Q ss_conf             999999999999998544386997553288379------77984414443245---------888899999999961975
Q gi|254780337|r  171 SKAAIEALARTWSKETVNTALRVINIDPGPTRT------SMRAKAMPAEDPNT---------VPHPQKVAKIISFLCATQ  235 (257)
Q Consensus       171 sKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T------~m~~~~~~~~~~~~---------~~~pediA~~v~fL~s~~  235 (257)
T Consensus       389 TKr~aE~~~~a~~~~~~~~~T~f~~VRFGNVlGSrGSViPlFk~QI~~GgplTvTdp~mtRyfMTI~EAv~LVlqA~--a  466 (588)
T COG1086         389 TKRLAEKLFQAANRNVSGTGTRFCVVRFGNVLGSRGSVIPLFKKQIAEGGPLTVTDPDMTRFFMTIPEAVQLVLQAG--A  466 (588)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCEEEEEEECCEECCCCCCHHHHHHHHHCCCCCCCCCCCCEEEEEEHHHHHHHHHHHH--H
T ss_conf             89999999999741048888579999825454588777788999997599845468670567888999999999987--5


Q ss_pred             HCCCCCEEEECCCC
Q ss_conf             62668579876876
Q gi|254780337|r  236 KIETGKLFSVPQNR  249 (257)
Q Consensus       236 ~~~tG~~~~vdgG~  249 (257)
T Consensus       467 ~~~gGeifvldMGe  480 (588)
T COG1086         467 IAKGGEIFVLDMGE  480 (588)
T ss_pred             HCCCCCEEEECCCC
T ss_conf             06898589981899