HHsearch alignment for GI: 254780337 and conserved domain: COG1090

>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only].
Probab=98.34  E-value=8.5e-06  Score=58.91  Aligned_cols=193  Identities=16%  Similarity=0.133  Sum_probs=118.8

Q ss_pred             EEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             99938998688999999998899899997898999999999986499289998789999999999999999818987998
Q gi|254780337|r   21 ALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDILI  100 (257)
Q Consensus        21 alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDilV  100 (257)
T Consensus         1 IliTGgTGlIG~~L~~~L~~~gh~v~iltR~~~~~~~~~------~~~v~-------~~~~~~~---~~---~~~~DavI   61 (297)
T COG1090           1 ILITGGTGLIGRALTARLRKGGHQVTILTRRPPKASQNL------HPNVT-------LWEGLAD---AL---TLGIDAVI   61 (297)
T ss_pred             CEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHC------CCCCC-------CCCHHHH---CC---CCCCCEEE
T ss_conf             957356650168999999848986999974785023324------76533-------4301244---03---67877899


Q ss_pred             ECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCEEEEECCHHHCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             7687588888867659999999999998999999999999998608-986999788356478898368898999999999
Q gi|254780337|r  101 ANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH-CGRAIILSSGAAYKCRPLWGAYSASKAAIEALA  179 (257)
Q Consensus       101 NNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~-~G~IInisS~~g~~~~~~~~~Y~asKaal~~lt  179 (257)
T Consensus        62 NLAG~~I~-~r--rWt~~~K~~i~~----SRi~~T~~L~e~I~~~~~~P~~~isaSAvGyYG~~~~~~~tE~~~~g~~Fl  134 (297)
T COG1090          62 NLAGEPIA-ER--RWTEKQKEEIRQ----SRINTTEKLVELIAASETKPKVLISASAVGYYGHSGDRVVTEESPPGDDFL  134 (297)
T ss_pred             ECCCCCCC-CC--CCCHHHHHHHHH----HHHHHHHHHHHHHHHCCCCCCEEEECCEEEEECCCCCEEEECCCCCCCCHH
T ss_conf             88898154-46--578899999999----776899999999985267980898524577755888646415788877759


Q ss_pred             HHHHHHHH-------HHCCEEEEECCCCCCCH---HHHHHCC------------CCCCCCCCCHHHHHHHHHHHHCHHHC
Q ss_conf             99999854-------43869975532883797---7984414------------44324588889999999996197562
Q gi|254780337|r  180 RTWSKETV-------NTALRVINIDPGPTRTS---MRAKAMP------------AEDPNTVPHPQKVAKIISFLCATQKI  237 (257)
Q Consensus       180 ~~la~E~~-------~~gIrvn~I~PG~v~T~---m~~~~~~------------~~~~~~~~~pediA~~v~fL~s~~~~  237 (257)
T Consensus       135 a~lc~~WE~~a~~a~~~gtRvvllRtGvVLs~~GGaL~~m~~~fk~glGG~~GsGrQ~~SWIhieD~v~~I~fll~~-~~  213 (297)
T COG1090         135 AQLCQDWEEEALQAQQLGTRVVLLRTGVVLSPDGGALGKMLPLFKLGLGGKLGSGRQWFSWIHIEDLVNAILFLLEN-EQ  213 (297)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEEEEEEECCCCCCHHHHCCHHHHCCCCCCCCCCCEEEEEEHHHHHHHHHHHHHC-CC
T ss_conf             99999999998666406846999988778617886034310135522577158987303433299999999999847-57


Q ss_pred             CCC
Q ss_conf             668
Q gi|254780337|r  238 ETG  240 (257)
Q Consensus       238 ~tG  240 (257)
T Consensus       214 lsG  216 (297)
T COG1090         214 LSG  216 (297)
T ss_pred             CCC
T ss_conf             777