HHsearch alignment for GI: 254780337 and conserved domain: KOG0025

>KOG0025 consensus.
Probab=94.68  E-value=0.2  Score=29.72  Aligned_cols=108  Identities=17%  Similarity=0.192  Sum_probs=77.3

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
T Consensus       160 ~GD~vIQNganS~VG~~ViQlaka~GiktinvVRdR~~ieel~~~Lk~lGA~~ViTeeel~~~-----~~~k~~~~~~~p  234 (354)
T KOG0025         160 KGDSVIQNGANSGVGQAVIQLAKALGIKTINVVRDRPNIEELKKQLKSLGATEVITEEELRDR-----KMKKFKGDNPRP  234 (354)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHCCCCEEECHHHHCCH-----HHHHHHCCCCCC
T ss_conf             998244467522888999999998396447775158469999999997488668248885554-----666651348773


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAA  158 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g  158 (257)
T Consensus       235 rLalNcVGG--k-s------------------------a~~iar~L--~~GgtmvTYGGMSk  267 (354)
T KOG0025         235 RLALNCVGG--K-S------------------------ATEIARYL--ERGGTMVTYGGMSK  267 (354)
T ss_pred             EEEEECCCC--H-H------------------------HHHHHHHH--HCCCEEEEECCCCC
T ss_conf             178754575--6-6------------------------99999998--55966997567557