HHsearch alignment for GI: 254780337 and conserved domain: KOG1221

>KOG1221 consensus.
Probab=98.06  E-value=3.2e-05  Score=55.09  Aligned_cols=178  Identities=15%  Similarity=0.162  Sum_probs=107.0

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCC---CEEEEEECC------HHHHH-----HHHHHHHHC----CCCEEEEECCC
Q ss_conf             2488999993899868899999999889---989999789------89999-----999999864----99289998789
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSG---AYVIACGRS------ISQLE-----KLKNALQKI----NKKIDIFAFDL   76 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G---~~Vi~~~r~------~~~l~-----~~~~~~~~~----g~~~~~~~~Dv   76 (257)
T Consensus         9 f~~~k~i~vTG~tGFlgKVliEklLr~~p~v~~IYlLiR~k~g~~~~~Rl~~~~~~~lF~~l~~~~p~~l~Kv~pi~GDi   88 (467)
T KOG1221           9 FYKNKTIFVTGATGFLGKVLIEKLLRTTPDVKRIYLLIRAKKGKAAQERLRTELKDPLFEVLKEKKPEALEKVVPIAGDI   88 (467)
T ss_pred             HHCCCEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEECCEECCCCC
T ss_conf             95798599972763457899999985076765699998347898778999998744699999863952102000012566


Q ss_pred             CCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCH
Q ss_conf             99999999999999981898799876875888888676599999999999989999999999999986089869997883
Q gi|254780337|r   77 RDSNALELTKTYIAKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSG  156 (257)
Q Consensus        77 ~d~~~v~~~~~~~~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~  156 (257)
T Consensus        89 ~~~~LGis~~D~~-~l~~eV~ivih~AAtvr-Fd-------e~l~~al~iNt~Gt~~~l~lak~~~~l---~~~vhVSTA  156 (467)
T KOG1221          89 SEPDLGISESDLR-TLADEVNIVIHSAATVR-FD-------EPLDVALGINTRGTRNVLQLAKEMVKL---KALVHVSTA  156 (467)
T ss_pred             CCCCCCCCHHHHH-HHHHCCCEEEEEEEEEC-CC-------HHHHHHHHHHHHHHHHHHHHHHHHHHH---HEEEEEEHH
T ss_conf             6866688827788-88745778999530422-55-------366565422227489999999985211---268984212


Q ss_pred             HHC--------CCCCC----------CHHHHHHHHHH--------------HHHHHHHHHHHH---HHCCEEEEECCCCC
Q ss_conf             564--------78898----------36889899999--------------999999999854---43869975532883
Q gi|254780337|r  157 AAY--------KCRPL----------WGAYSASKAAI--------------EALARTWSKETV---NTALRVINIDPGPT  201 (257)
Q Consensus       157 ~g~--------~~~~~----------~~~Y~asKaal--------------~~lt~~la~E~~---~~gIrvn~I~PG~v  201 (257)
T Consensus       157 y~n~~~~~i~E~~y~~~~~~~~~~~i~~~~~~~~~~ld~~~~~l~~~~PNTYtfTKal~E~~i~~~~~~lPivIiRPsiI  236 (467)
T KOG1221         157 YSNCNVGHIEEKPYPMPETCNPEKILKLDENLSDELLDQKAPKLLGGWPNTYTFTKALAEMVIQKEAENLPLVIIRPSII  236 (467)
T ss_pred             HEECCCCCCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCEEEHHHHHHHHHHHHCCCCCEEEECCCCE
T ss_conf             22246665210256764558988887643222189998764775089998630118658999985264898699748741


Q ss_pred             CCH
Q ss_conf             797
Q gi|254780337|r  202 RTS  204 (257)
Q Consensus       202 ~T~  204 (257)
T Consensus       237 ~st  239 (467)
T KOG1221         237 TST  239 (467)
T ss_pred             ECC
T ss_conf             013