HHsearch alignment for GI: 254780337 and conserved domain: PRK00066

>PRK00066 ldh L-lactate dehydrogenase; Reviewed.
Probab=96.95  E-value=0.02  Score=36.40  Aligned_cols=111  Identities=21%  Similarity=0.247  Sum_probs=69.0

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCC--EEEEEECCHHHHHHHHHHHHHC---CCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             889999938998688999999998899--8999978989999999999864---99289998789999999999999999
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGA--YVIACGRSISQLEKLKNALQKI---NKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~--~Vi~~~r~~~~l~~~~~~~~~~---g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
T Consensus         6 ~~KI~II-Ga-G~VG~~~a~~l~~~~l~~el~LiD~~~~~a~g~a~Dl~h~~~~~~~~~i~~g---dy~~----------   70 (315)
T PRK00066          6 HNKVVLV-GD-GAVGSSYAYALVNQGIADELVIIDINKEKAEGDAMDLSHAVPFTSPTKIYAG---DYSD----------   70 (315)
T ss_pred             CCEEEEE-CC-CHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEEC---CHHH----------
T ss_conf             9849999-97-9889999999986699888999808987107899988854123688479739---9999----------


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CEEEEEC
Q ss_conf             81898799876875888888676599999999999989999999999999986089-8699978
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHC-GRAIILS  154 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~-G~IInis  154 (257)
T Consensus        71 -~~daDvVVitAG~~~k~g---~-t---R~dll~~N~----~I~~~i~~~i~~~~p~~i~ivvt  122 (315)
T PRK00066         71 -CKDADLVVITAGAPQKPG---E-T---RLDLVEKNL----KIFKSIVGEVMASGFDGIFLVAS  122 (315)
T ss_pred             -HCCCCEEEECCCCCCCCC---C-C---HHHHHHHHH----HHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             -679999998999989999---9-8---789998789----99999887764248853999936