HHsearch alignment for GI: 254780337 and conserved domain: PRK05854

>PRK05854 short chain dehydrogenase; Provisional.
Probab=100.00  E-value=2.9e-38  Score=276.12  Aligned_cols=228  Identities=23%  Similarity=0.282  Sum_probs=190.2

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHC--CCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             248899999389986889999999988998999978989999999999864--992899987899999999999999998
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKI--NKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~--g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
T Consensus        11 dL~GK~~vITGa~sGIG~~~a~~La~~Ga~Vil~~R~~~k~~~a~~~i~~~~~~~~v~~~~lDLs~l~sVr~~a~~~~~~   90 (314)
T PRK05854         11 DLSGKLAVVTGASSGLGFGLARRLAAAGADVILPVRNRAKGEAAVAAIRTAVPDAKLTIRALDLSSLASVAALGEQLLAE   90 (314)
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHC
T ss_conf             99999899906882999999999997849899997999999999999998689985699964631689999999987530


Q ss_pred             HCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCC-----------
Q ss_conf             189879987687588888867659999999999998999999999999998608986999788356478-----------
Q gi|254780337|r   93 WGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKC-----------  161 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~-----------  161 (257)
T Consensus        91 ~~~lDiLInNAGv~~~--~~~~~T~dG~E~~f~vN~LghflLt~~Llp~l~~-~~~RIV~vsS~~~~~~~i~~~dl~~~~  167 (314)
T PRK05854         91 GRPIHLLINNAGVMTP--PERQTTADGFELQFGTNHLGHFALTAHLLPLLRA-GRARVTSQSSIAARRGRINFDDLNFER  167 (314)
T ss_pred             CCCCCEEEECCCCCCC--CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCC-CCCEEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             6875278726766658--8654057763665553457788898877876325-787056643420115776545688645


Q ss_pred             -CCCCHHHHHHHHHHHHHHHHHHHHHH--HHCCEEEEECCCCCCCHHHHHHC------CC------CC----CCCCCCHH
Q ss_conf             -89836889899999999999999854--43869975532883797798441------44------43----24588889
Q gi|254780337|r  162 -RPLWGAYSASKAAIEALARTWSKETV--NTALRVINIDPGPTRTSMRAKAM------PA------ED----PNTVPHPQ  222 (257)
Q Consensus       162 -~~~~~~Y~asKaal~~lt~~la~E~~--~~gIrvn~I~PG~v~T~m~~~~~------~~------~~----~~~~~~pe  222 (257)
T Consensus       168 ~y~~~~aY~~SKlanilf~~eLarr~~~~~~~v~~~~vhPG~v~T~l~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~t~~  247 (314)
T PRK05854        168 SYAPMTAYGQSKLAVLMFALELDRRSRAAGWGITSNAAHPGLAKTNLLAAGPSHGRDKPTLMVRLIRTLWRFGFLWQTVE  247 (314)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHH
T ss_conf             68861888899999999999998652406989799997998435686445662123343799999999887601157888


Q ss_pred             HHHHHHHHHHCHHHCCCCCEEEE
Q ss_conf             99999999619756266857987
Q gi|254780337|r  223 KVAKIISFLCATQKIETGKLFSV  245 (257)
Q Consensus       223 diA~~v~fL~s~~~~~tG~~~~v  245 (257)
T Consensus       248 ~GA~t~l~aA~~p~~~~G~y~~~  270 (314)
T PRK05854        248 EAILPALYAATSPQAEGGAFYGP  270 (314)
T ss_pred             HHHHHHHHHHCCCCCCCCEEECC
T ss_conf             98999899873844589728666