HHsearch alignment for GI: 254780337 and conserved domain: PRK05865

>PRK05865 hypothetical protein; Provisional.
Probab=97.51  E-value=0.00096  Score=45.17  Aligned_cols=102  Identities=23%  Similarity=0.215  Sum_probs=76.6

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
T Consensus         2 ~i~VT~A~G~lGR~va~qLia~GH~V~GIAr~r~~---------~~~~~~DFV~A~iRd~~~~~~a~-------~~AD~V   65 (854)
T PRK05865          2 RIAVTGASGVLGRGLTARLLSQGHEVVGIARHRPD---------SWPSSADFIAADIRDATAVESAM-------TGADVV   65 (854)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEECCCCC---------CCCCCCCEEECCCCCHHHHHHHH-------CCCCEE
T ss_conf             37883362157778999998668724554057986---------56755666632334789998752-------466548


Q ss_pred             EECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             87687588888867659999999999998999999999999998608986999788
Q gi|254780337|r  100 IANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSS  155 (257)
Q Consensus       100 VNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS  155 (257)
T Consensus        66 ~H~A~~-~~~-------------~~~~~idG~a----~V~~A~a~aG~r~i~~sqs  103 (854)
T PRK05865         66 AHCAWV-RGR-------------NDHINIDGTA----NVLKAMAETGTGRIVFTSS  103 (854)
T ss_pred             EEECCC-CCC-------------CCCCCCHHHH----HHHHHHHHHCCCEEEEECC
T ss_conf             983121-588-------------7644627688----9999998618836998158