HHsearch alignment for GI: 254780337 and conserved domain: PRK05884

>PRK05884 short chain dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=331.04  Aligned_cols=216  Identities=18%  Similarity=0.215  Sum_probs=183.2

Q ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             99993899868899999999889989999789899999999998649928999878999999999999999981898799
Q gi|254780337|r   20 LALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDIL   99 (257)
Q Consensus        20 ~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDil   99 (257)
T Consensus         2 ~VlVTGgs~GIG~aiA~~la~~Ga~V~i~~r~~~~l~~~~~el~-----~~~~~~d~~d~~~~~~~~~~~~~~---~d~l   73 (223)
T PRK05884          2 EVLVTGGDTDLGRTIAEGFRNDGHKVTLVGARRDDLEVAAKELD-----VDAIVCDNTDPASLEEARGLFPHH---LDTI   73 (223)
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCC-----CCEEEEECCCHHHHHHHHHHHHHH---HCCE
T ss_conf             39998788799999999999879999999598789999985348-----768998527889999999999986---1947


Q ss_pred             EECCCCCCCC----CCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHH
Q ss_conf             8768758888----886765999999999999899999999999999860898699978835647889836889899999
Q gi|254780337|r  100 IANAGILGSI----SPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAI  175 (257)
Q Consensus       100 VNNAGi~~~~----~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal  175 (257)
T Consensus        74 vn~~~~~~~~~~~~~~~~~d~~~~w~~~~~~nl~~~~~~~~~~~~~m~--~~G~Iini~s~~~----~~~~~~~asKaal  147 (223)
T PRK05884         74 VNVPAPSWDAGDPRTYSLADTANAWRNALDATVLSAVLTVQSVGDHLR--SGGSIINVVPENP----PAGSADAAIKAAL  147 (223)
T ss_pred             EEEEEEECCCCCCCCCCHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCEEEEEECCCC----CCCCHHHHHHHHH
T ss_conf             884123024787555621215999999999997999999999998615--8987999945767----8875899999999


Q ss_pred             HHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEEECCCCEECC
Q ss_conf             999999999854438699755328837977984414443245888899999999961975-626685798768763154
Q gi|254780337|r  176 EALARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFSVPQNRFVNY  253 (257)
Q Consensus       176 ~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~vdgG~~~n~  253 (257)
T Consensus       148 ~~~t~~lA~e~~~~gIrVN~IaPG~~~~~~~~~~~-~~---~~~~~~evA~~~~FLaS~~as~iTGq~i~VDGG~~a~~  222 (223)
T PRK05884        148 SNWTAGQAEVFGTRGITINAVACGRSVQPGYDGLS-RT---PPPVAAEIARLALFLTTPAARHITGQTLHVSHGALAHF  222 (223)
T ss_pred             HHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHH-CC---CCCCHHHHHHHHHHHCCCHHCCEECCEEEECCCCCCCC
T ss_conf             99999999996765979979807998883156871-68---99978999999999809431874274789586813448