HHsearch alignment for GI: 254780337 and conserved domain: PRK06101

>PRK06101 short chain dehydrogenase; Provisional.
Probab=100.00  E-value=2.4e-44  Score=316.96  Aligned_cols=202  Identities=28%  Similarity=0.346  Sum_probs=178.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCCCE
Q ss_conf             99999389986889999999988998999978989999999999864992899987899999999999999998189879
Q gi|254780337|r   19 RLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKLDI   98 (257)
Q Consensus        19 K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~iDi   98 (257)
T Consensus         2 ktvlITGassGIG~a~A~~la~~G~~Vi~~~R~~~~l~~~~~~----~~~~~~~~~Dvtd~~~~~~~~~~~~---~~~d~   74 (241)
T PRK06101          2 TSVLITGATSGIGKQLALDYAKAGWKVIACGRNEAVLDELHDQ----SSNIFTLAFDVTDYEETKAALSQLP---FIPEL   74 (241)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH----CCCEEEEEEECCCHHHHHHHHHHHC---CCCCE
T ss_conf             9899922404999999999998799899998999999999973----2880489852267999999999718---77778


Q ss_pred             EEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             98768758888886765999999999999899999999999999860898699978835647889836889899999999
Q gi|254780337|r   99 LIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIEAL  178 (257)
Q Consensus        99 lVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~~l  178 (257)
T Consensus        75 ~i~naG~~-~~~~~~~~~~~~~~~~~~vN~~g~~~~~~~~~p~m~~--~~~iv~isS~a~~~~~p~~~~Y~ASKaal~~~  151 (241)
T PRK06101         75 WIFNAGDC-EYMDDGIVDAQLMARVFNVNVVGVANCIEACQPHFQR--GHRVVIVGSIASELALPRAEAYGASKAAVSYF  151 (241)
T ss_pred             EEECCCCC-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCEEEECCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99988666-7687344899999999999889999999999999873--89505775401056889846889999999999


Q ss_pred             HHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             999999854438699755328837977984414443245888899999999961
Q gi|254780337|r  179 ARTWSKETVNTALRVINIDPGPTRTSMRAKAMPAEDPNTVPHPQKVAKIISFLC  232 (257)
Q Consensus       179 t~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~~~~~~~~~~pediA~~v~fL~  232 (257)
T Consensus       152 ~~sLa~el~~~gI~V~~V~PG~v~T~m~~~~~~~~p--~~~~~e~~A~~i~~~i  203 (241)
T PRK06101        152 ARTLALDLKKKGIKVVTVFPGFVATPLTDKNTFAMP--MIITVEQASQAIRKQL  203 (241)
T ss_pred             HHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCC--CCCCHHHHHHHHHHHH
T ss_conf             999999852549589999718993888778998898--7579999999999999