HHsearch alignment for GI: 254780337 and conserved domain: PRK06227

>PRK06227 consensus.
Probab=100.00  E-value=0  Score=471.83  Aligned_cols=239  Identities=28%  Similarity=0.339  Sum_probs=225.6

Q ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             52488999993899868899999999889989999789899999999998649928999878999999999999999981
Q gi|254780337|r   14 VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        14 ~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
T Consensus         1 m~L~gKvalVTGas~GIG~aiA~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~   80 (256)
T PRK06227          1 MNLSGKVAIVTGGGQGIGAAIAQTFAENGAKVVIADIDEEAGLEREEMLRSNGLDALFVKTDVSDEEDVKNMVRKTVERY   80 (256)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             98999889995866889999999999879999999698889999999999559918999816899999999999999982


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608986999788356478898368898999
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKA  173 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKa  173 (257)
T Consensus        81 G~iDiLVNNAGi~-~~~~~~~~~~e~w~~~~~vNl~g~f~~~~~~~p~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKa  159 (256)
T PRK06227         81 GGIDILINNAGIF-SGKSIFERTLEEWERVIRVNLTGPYLCSKYAAEEMIKNGGGVIINIASTRAFQSEPNTEPYSASKG  159 (256)
T ss_pred             CCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHH
T ss_conf             9997999899899-998903498999999999982999999999999999849977999622554568998688999999


Q ss_pred             HHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH------------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCC
Q ss_conf             999999999998544386997553288379779844------------14443245888899999999961975-62668
Q gi|254780337|r  174 AIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA------------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETG  240 (257)
Q Consensus       174 al~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~------------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG  240 (257)
T Consensus       160 av~~lTr~lA~ela~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~~~~P~gR~g~peeiA~~v~FL~Sd~as~iTG  239 (256)
T PRK06227        160 GIIALTHSLAVSLSKYKIRVVSISPGWIETSEWKKPPLRKKPQLTPLDHLQHPAGRVGKPEDVANLCLFLASDEASFITG  239 (256)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCCC
T ss_conf             99999999999962029499999618696650005751025777887862688779859999999999996763249258


Q ss_pred             CEEEECCCCEECC
Q ss_conf             5798768763154
Q gi|254780337|r  241 KLFSVPQNRFVNY  253 (257)
Q Consensus       241 ~~~~vdgG~~~n~  253 (257)
T Consensus       240 ~~i~VDGG~t~~~  252 (256)
T PRK06227        240 VNFIVDGGMTVKM  252 (256)
T ss_pred             CEEEECCCEEEEE
T ss_conf             6389678917675