HHsearch alignment for GI: 254780337 and conserved domain: PRK06484

>PRK06484 short chain dehydrogenase; Validated.
Probab=100.00  E-value=0  Score=449.37  Aligned_cols=232  Identities=25%  Similarity=0.371  Sum_probs=214.6

Q ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             88999993899868899999999889989999789899999999998649928999878999999999999999981898
Q gi|254780337|r   17 DNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRWGKL   96 (257)
Q Consensus        17 ~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~g~i   96 (257)
T Consensus         4 eGKvalVTGas~GIG~aiA~~la~~Ga~V~~~dr~~~~~~~~~~~---~g~~~~~~~~Dvsd~~~v~~~v~~~~~~~G~i   80 (530)
T PRK06484          4 QARVVLVTGAAGGIGRACCQRFARAGDRVVMADRDLAACTEEAER---LGSRHVALQLDVSDEAQVEHAMDGLLQQFGRI   80 (530)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHH---CCCCCEEEEEECCCHHHHHHHHHHHHHHCCCC
T ss_conf             998999978366899999999998799999996888999999997---09971799984899999999999999972999


Q ss_pred             CEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHHHHHHH
Q ss_conf             79987687588888867659999999999998999999999999998608986999788356478898368898999999
Q gi|254780337|r   97 DILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSASKAAIE  176 (257)
Q Consensus        97 DilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~asKaal~  176 (257)
T Consensus        81 DiLVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~f~~~~~~~p~m~~~-gg~IInisS~~g~~~~~~~~~Y~asKaal~  159 (530)
T PRK06484         81 DVLVNNAGIGPTMRATLDTPLEDFDRAIAVNLEGPYLVAREALRLMGRH-GAAIVNVASLAGLVANPKRAAYSASKAGVI  159 (530)
T ss_pred             CEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCEEEEEEECCCCCCCCCCHHHHHHHHHHH
T ss_conf             8999899899889861009999999999987299999999999987762-573899983310457999688999999999


Q ss_pred             HHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH-----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCCCCCEEE
Q ss_conf             999999998544386997553288379779844-----------14443245888899999999961975-626685798
Q gi|254780337|r  177 ALARTWSKETVNTALRVINIDPGPTRTSMRAKA-----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIETGKLFS  244 (257)
Q Consensus       177 ~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~-----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~tG~~~~  244 (257)
T Consensus       160 ~lTkslA~Ela~~gIRVNaVaPG~I~T~m~~~~~~~~~~~~~~~~~~iPlgR~g~PeeiA~~v~FLaSd~asyITG~~i~  239 (530)
T PRK06484        160 SLTRSLACELAPKGIRVNAVAPGYVRTEMVAELERAGKLDRSAVRGRIPMGRLARPDEIAEAVHFLASAQASYITGSTLV  239 (530)
T ss_pred             HHHHHHHHHHHHCCEEEEEEEECCCCCCHHHHHHHCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHCCCCCCEEE
T ss_conf             99999999863409499999637888711433310564479999717998887899999999999768332588898799


Q ss_pred             ECCCCEECC
Q ss_conf             768763154
Q gi|254780337|r  245 VPQNRFVNY  253 (257)
Q Consensus       245 vdgG~~~n~  253 (257)
T Consensus       240 VDGG~~-~~  247 (530)
T PRK06484        240 VDGGWD-AY  247 (530)
T ss_pred             EECCCC-CC
T ss_conf             838931-53