HHsearch alignment for GI: 254780337 and conserved domain: PRK06603

>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional.
Probab=100.00  E-value=0  Score=391.63  Aligned_cols=236  Identities=18%  Similarity=0.234  Sum_probs=205.7

Q ss_pred             CCCCCEEEEECCCC--HHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             24889999938998--6889999999988998999978989999999999864992899987899999999999999998
Q gi|254780337|r   15 NLDNRLALVTGSSR--GIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKR   92 (257)
Q Consensus        15 ~l~~K~alVTGas~--GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~   92 (257)
T Consensus         5 ~L~GK~alVTGaa~g~Gig~aia~~~~~~Ga~V~i~~~~~~~~~~~~~l~~~~g~~~-~~~~Dvt~~~~v~~~~~~~~~~   83 (260)
T PRK06603          5 LLQGKKGLITGIANNMSISWAIAQLAKKHGAELWFTYQSEVLEKRVKPLAEEIGCNF-VSELDVTNPKSISNLFDDIKEK   83 (260)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCHHHHHHHHHHHHHCCCCE-EEECCCCCHHHHHHHHHHHHHH
T ss_conf             689998999899996689999999999879999996686799999999998438376-9865799999999999999998


Q ss_pred             HCCCCEEEECCCCCCC---CCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             1898799876875888---8886765999999999999899999999999999860898699978835647889836889
Q gi|254780337|r   93 WGKLDILIANAGILGS---ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        93 ~g~iDilVNNAGi~~~---~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
T Consensus        84 ~G~iDiLVnnag~~~~~~~~~~~~d~~~~~~~~~~~~n~~~~~~~~~~a~~~m--~~~GsIi~iss~~~~~~~p~~~~Y~  161 (260)
T PRK06603         84 WGSFDFLLHGMAFADKNELKGRYVDTSLENFHNSLHISCYSLLELSRSAEALM--HDGGSIVTLTYYGAEKVIPNYNVMG  161 (260)
T ss_pred             HCCCCEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH--CCCCCCCCCCCCCCCCCCCCCCCHH
T ss_conf             69977899644237776567751029899999999999899999999977874--1797302342210013478642006


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHH----------CCCCCCCCCCCHHHHHHHHHHHHCHH-HCC
Q ss_conf             8999999999999998544386997553288379779844----------14443245888899999999961975-626
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKA----------MPAEDPNTVPHPQKVAKIISFLCATQ-KIE  238 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~----------~~~~~~~~~~~pediA~~v~fL~s~~-~~~  238 (257)
T Consensus       162 asKaal~~ltr~lA~ela~~gIRVNaIaPG~i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pedia~~~~FLaSd~s~~i  241 (260)
T PRK06603        162 VAKAALEASVKYLANDMGENNIRVNAISAGPIKTLASSAIGDFSTMLKSHAATAPLKRNTTQEDVGGAAVYLFSELSKGV  241 (260)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             65999999999999996634808999732776564222046779999999857998999599999999999966822372


Q ss_pred             CCCEEEECCCCEECC
Q ss_conf             685798768763154
Q gi|254780337|r  239 TGKLFSVPQNRFVNY  253 (257)
Q Consensus       239 tG~~~~vdgG~~~n~  253 (257)
T Consensus       242 TG~~i~vDGG~si~g  256 (260)
T PRK06603        242 TGEIHYVDCGYNIMG  256 (260)
T ss_pred             CCCEEEECCCCCCCC
T ss_conf             587178897980138