HHsearch alignment for GI: 254780337 and conserved domain: PRK06935

>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=466.64  Aligned_cols=239  Identities=22%  Similarity=0.406  Sum_probs=222.7

Q ss_pred             CEE-ECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHH
Q ss_conf             326-5248899999389986889999999988998999978989999999999864992899987899999999999999
Q gi|254780337|r   11 EIH-VNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYI   89 (257)
Q Consensus        11 ~m~-~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~   89 (257)
T Consensus         7 ~m~~f~L~gKvalVTGas~GIG~aiA~~la~~Ga~Vvi~~~~~-~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~v~~~   85 (258)
T PRK06935          7 SMDFFSLKGKVAIVTGGNTGLGQGYAVALAKAGADIIITTHGT-NWDETRRLIEKEGRKVTFVQLDLTKKESAEAVVAEA   85 (258)
T ss_pred             CHHHCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEECCCC-CHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHH
T ss_conf             2543199999899948575899999999998799999972997-899999999966993799990489999999999999


Q ss_pred             HHHHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHH
Q ss_conf             99818987998768758888886765999999999999899999999999999860898699978835647889836889
Q gi|254780337|r   90 AKRWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYS  169 (257)
Q Consensus        90 ~~~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~  169 (257)
T Consensus        86 ~~~~G~iDiLVNNAG~~-~~~~~~~~~~e~w~~~~~vNl~g~~~~~~~~~~~m~~~~~G~IInisS~~~~~g~~~~~~Y~  164 (258)
T PRK06935         86 LEKFGKIDILVNNAGTI-RRAPLLEYKDEDWQAVIDINLNSVYHLSQAVAKVMAKQGSGKIINIASMLSFQGGKFVPPYT  164 (258)
T ss_pred             HHHCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEHHHCCCCCCCHHHH
T ss_conf             99749999999899999-99980239999999999986478999999999999983898189995320167888876699


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH----------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCC
Q ss_conf             899999999999999854438699755328837977984----------414443245888899999999961975-626
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK----------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIE  238 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~----------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~  238 (257)
T Consensus       165 asKaav~~lTr~lA~e~a~~gIrVNaVaPG~i~T~~~~~~~~~~~~~~~~~~~iPlgR~g~peeiA~~v~FLaSd~s~~i  244 (258)
T PRK06935        165 ASKHGVAGLTKAFANELAAYNIQVNAIAPGYIKTANTAPIRADKARNAEILKRIPAGRWGEPDDLMGAAVFLASRASDYV  244 (258)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCC
T ss_conf             99999999999999997226989999854889786501124799999999955999997789999999999838432691


Q ss_pred             CCCEEEECCCCEE
Q ss_conf             6857987687631
Q gi|254780337|r  239 TGKLFSVPQNRFV  251 (257)
Q Consensus       239 tG~~~~vdgG~~~  251 (257)
T Consensus       245 TG~~i~VDGG~~~  257 (258)
T PRK06935        245 NGHILAVDGGWLV  257 (258)
T ss_pred             CCCEEEECCCCCC
T ss_conf             2872897858037