HHsearch alignment for GI: 254780337 and conserved domain: PRK06947

>PRK06947 glucose-1-dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=442.50  Aligned_cols=235  Identities=26%  Similarity=0.329  Sum_probs=219.3

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEE-ECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             2488999993899868899999999889989999-789899999999998649928999878999999999999999981
Q gi|254780337|r   15 NLDNRLALVTGSSRGIGYYTALELARSGAYVIAC-GRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAKRW   93 (257)
Q Consensus        15 ~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~-~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~~~   93 (257)
T Consensus         3 ~~~~KvalVTGa~~GIG~aia~~la~~Ga~V~i~~~~~~~~~~~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~~~~~~~   82 (252)
T PRK06947          3 NSDRKVVLITGASRGIGRATAVLAAARGWSVGINYARDAAAAEETADAVRAAGGRACVVAGDVANEADVIAMFDAVQAAF   82 (252)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             99990899938835899999999998799899980898789999999999649928999847999999999999999984


Q ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCEEEEECCHHHCCCCCC-CHHHH
Q ss_conf             89879987687588888867659999999999998999999999999998608---986999788356478898-36889
Q gi|254780337|r   94 GKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSH---CGRAIILSSGAAYKCRPL-WGAYS  169 (257)
Q Consensus        94 g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~---~G~IInisS~~g~~~~~~-~~~Y~  169 (257)
T Consensus        83 G~iD~lVnNAG~~~~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~~~~m~~~~~~~~g~IinisS~~~~~~~~~~~~~Y~  162 (252)
T PRK06947         83 GRLDALVNNAGIVAPSMPLADMDAARLRRMFDTNVLGAYLCAREAARRLSTDRGGRGGAIVNVSSIASRLGSPNEYVDYA  162 (252)
T ss_pred             CCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEHHHCCCCCCCHHHHH
T ss_conf             99889998764357999812399999999999985799999999999999845799858999856654558887306679


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHH---------HCCCCCCCCCCCHHHHHHHHHHHHCHH-HCCC
Q ss_conf             899999999999999854438699755328837977984---------414443245888899999999961975-6266
Q gi|254780337|r  170 ASKAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAK---------AMPAEDPNTVPHPQKVAKIISFLCATQ-KIET  239 (257)
Q Consensus       170 asKaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~---------~~~~~~~~~~~~pediA~~v~fL~s~~-~~~t  239 (257)
T Consensus       163 ~sK~al~~ltr~lA~e~a~~gIrvN~IaPG~i~T~~~~~~~~~~~~~~~~~~~Pl~R~g~p~dIa~~v~fL~Sd~s~~iT  242 (252)
T PRK06947        163 GSKGAVDTLTLGLAKELGPHGVRVNAVRPGLIETEIHASGGQPGRAARLGAQTPLGRAGEADEVAEAIVWLLSDAASYVT  242 (252)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999999999999997462928998971158775422369969999998379999981999999999999687114865


Q ss_pred             CCEEEECCCC
Q ss_conf             8579876876
Q gi|254780337|r  240 GKLFSVPQNR  249 (257)
Q Consensus       240 G~~~~vdgG~  249 (257)
T Consensus       243 Gq~i~VdGG~  252 (252)
T PRK06947        243 GALLDVGGGR  252 (252)
T ss_pred             CCEEEECCCC
T ss_conf             8537848999