HHsearch alignment for GI: 254780337 and conserved domain: PRK07041

>PRK07041 short chain dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=398.25  Aligned_cols=227  Identities=25%  Similarity=0.295  Sum_probs=207.0

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
T Consensus         1 M~~~l~gK~~lITGgs~GIG~aia~~la~~Ga~V~i~~r~~~~l~~~~~~~~~-~~~~~~~~~Dv~~~~~v~~~~~----   75 (240)
T PRK07041          1 MQMSLNDQKVLVVGGSSGIGLAAARAFAARGADVTIASRSRERLAAAARALGG-PRPVRTAALDITDEAAVDAFFA----   75 (240)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCC-CCCEEEEECCCCCHHHHHHHHH----
T ss_conf             99885999899957788899999999998799999995988999999998478-8866999847999999999999----


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
T Consensus        76 ~~g~~d~lv~nag~~-~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~----~~~~~~G~Ii~iss~~~~~~~~~~~~Y~as  150 (240)
T PRK07041         76 EAGPFDHVVITAADT-AGGPVRALPLAAAQAAMDSKFWGAYRVARA----ARIAPGGSLTFVSGFLAVRPSASGVLQGAI  150 (240)
T ss_pred             HHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHH----HHHHCCCEEEEECCHHHCCCCCCCHHHHHH
T ss_conf             709878899823447-999810299999999999888999999999----997169679996443314778861788887


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHCC------------CCCCCCCCCHHHHHHHHHHHHCHHHCCC
Q ss_conf             9999999999999854438699755328837977984414------------4432458888999999999619756266
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAMP------------AEDPNTVPHPQKVAKIISFLCATQKIET  239 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~~------------~~~~~~~~~pediA~~v~fL~s~~~~~t  239 (257)
T Consensus       151 Kaal~~ltr~lA~ela~--IrVN~IaPG~i~T~~~~~~~~~~~~~~~~~~~~~iPl~R~g~pedia~~v~fL~s~-~~it  227 (240)
T PRK07041        151 NAALEALARGLALELAP--VRVNAVSPGLVDTPLWSKLAGDARAAMFAAAAERLPARRVGQPEDVANAIVFLAAN-GFAT  227 (240)
T ss_pred             HHHHHHHHHHHHHHHCC--CEEEEEEECCCCCHHHHHCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHC-CCCC
T ss_conf             67999999999998289--28999841876773665317113899999998459999984999999999999847-8878


Q ss_pred             CCEEEECCCCEE
Q ss_conf             857987687631
Q gi|254780337|r  240 GKLFSVPQNRFV  251 (257)
Q Consensus       240 G~~~~vdgG~~~  251 (257)
T Consensus       228 G~~i~VDGG~sl  239 (240)
T PRK07041        228 GSTVLVDGGGAI  239 (240)
T ss_pred             CCEEEECCCHHH
T ss_conf             982785877240