HHsearch alignment for GI: 254780337 and conserved domain: PRK07109

>PRK07109 short chain dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=388.96  Aligned_cols=222  Identities=23%  Similarity=0.302  Sum_probs=206.8

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
T Consensus         2 ~~k~l~~KvVvITGASsGIGra~A~~fA~~Ga~Vvl~aR~~~~L~~~a~e~~~~G~~~~~~~~DVsd~~~v~~~~~~~~~   81 (338)
T PRK07109          2 MLKPLGRQVVVITGASAGVGRATARAFARRGAKVVLLARGEEGLEGLAAEIRAAGGEALAVVADVADAEAVQAAADRAEE   81 (338)
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             99606989899948434999999999998799899998999999999999996398189998017999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
T Consensus        82 ~~G~IDvlVNNAGi~-~~g~~~~~~~e~~~~vi~vNl~G~v~~t~aaLp~m~~~~~G~IInvsSvag~~~~P~~saY~AS  160 (338)
T PRK07109         82 ELGPIDTWVNNAMVT-VFGPFEDVTPEEFRRVTDVTYLGVVHGTLAALRHMRPRDRGAIIQVGSALAYRSIPLQSAYCAA  160 (338)
T ss_pred             HHCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCCHHHHH
T ss_conf             849988886546667-7876322999999999877518999999999999986799789998895554578998179999


Q ss_pred             HHHHHHHHHHHHHHHHHH--CCEEEEECCCCCCCHHHHHHCC-----CCCCCCCCCHHHHHHHHHHHHCH
Q ss_conf             999999999999985443--8699755328837977984414-----44324588889999999996197
Q gi|254780337|r  172 KAAIEALARTWSKETVNT--ALRVINIDPGPTRTSMRAKAMP-----AEDPNTVPHPQKVAKIISFLCAT  234 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~--gIrvn~I~PG~v~T~m~~~~~~-----~~~~~~~~~pediA~~v~fL~s~  234 (257)
T Consensus       161 K~Av~GftesLr~EL~~~~s~I~Vt~V~Pg~VdTP~f~~~~n~~~~~~~~~pp~~~pe~vA~ai~~~a~~  230 (338)
T PRK07109        161 KHAIRGFTDSLRCELLHDGSPVSVTMVQPPAVNTPQFDWARSYLPVEPQPVPPIYQPEVVADAILFAAEH  230 (338)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             9999999999999998679981899975798779742444523798888999998989999999999748