HHsearch alignment for GI: 254780337 and conserved domain: PRK07454

>PRK07454 short chain dehydrogenase; Provisional.
Probab=100.00  E-value=0  Score=451.92  Aligned_cols=237  Identities=27%  Similarity=0.401  Sum_probs=221.4

Q ss_pred             EEECCCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             26524889999938998688999999998899899997898999999999986499289998789999999999999999
Q gi|254780337|r   12 IHVNLDNRLALVTGSSRGIGYYTALELARSGAYVIACGRSISQLEKLKNALQKINKKIDIFAFDLRDSNALELTKTYIAK   91 (257)
Q Consensus        12 m~~~l~~K~alVTGas~GIG~a~a~~la~~G~~Vi~~~r~~~~l~~~~~~~~~~g~~~~~~~~Dv~d~~~v~~~~~~~~~   91 (257)
T Consensus         1 m~~~-~mKvalITGas~GIG~a~A~~la~~G~~V~l~~R~~~~l~~~~~e~~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~   79 (241)
T PRK07454          1 MSLN-SMPTALITGASRGIGKATALAFAKAGWDLALVARSQDALEALAEELRSTGVKVAAYSIDLSNPEAIAPGIAELLE   79 (241)
T ss_pred             CCCC-CCCEEEECCCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHH
T ss_conf             9989-998899917587899999999998799899998999999999999996599289999518999999999999999


Q ss_pred             HHCCCCEEEECCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHCCCCCCCHHHHHH
Q ss_conf             81898799876875888888676599999999999989999999999999986089869997883564788983688989
Q gi|254780337|r   92 RWGKLDILIANAGILGSISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGAYSAS  171 (257)
Q Consensus        92 ~~g~iDilVNNAGi~~~~~~~~~~~~e~~~~~~~vNl~g~~~l~~~~~~~m~~~~~G~IInisS~~g~~~~~~~~~Y~as  171 (257)
T Consensus        80 ~~G~iDiLVnNAG~~-~~~~~~~~~~e~~~~~~~vNl~g~~~~~~~~lp~M~~~~~G~IinisS~ag~~~~~~~~~Y~aS  158 (241)
T PRK07454         80 QFGCPSVLINNAGAA-YTGPLLEMPLSDWQWVIQLNLTSVFQCCSAVLPGMRARGGGLIINVSSHAARNAFPQWGAYCVS  158 (241)
T ss_pred             HCCCCCEEEECCCCC-CCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECHHHCCCCCCCHHHHHH
T ss_conf             759988999889889-9999266999999999999869999999999999997399899998356544778997579999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEECCCCCCCHHHHHHC--CCCCCCCCCCHHHHHHHHHHHHCH-H-HCCCCCEEEECC
Q ss_conf             999999999999985443869975532883797798441--444324588889999999996197-5-626685798768
Q gi|254780337|r  172 KAAIEALARTWSKETVNTALRVINIDPGPTRTSMRAKAM--PAEDPNTVPHPQKVAKIISFLCAT-Q-KIETGKLFSVPQ  247 (257)
Q Consensus       172 Kaal~~lt~~la~E~~~~gIrvn~I~PG~v~T~m~~~~~--~~~~~~~~~~pediA~~v~fL~s~-~-~~~tG~~~~vdg  247 (257)
T Consensus       159 K~al~~lt~~la~E~~~~gIrVn~V~PG~v~T~m~~~~~~~~~~~~~~~l~PedVA~~v~flas~p~~~~i~~~~i~p~g  238 (241)
T PRK07454        159 KAALAAFTKCLAEEERSHGIRVCTLTLGAVNTPLWDSETVQADFDRSAMLSPEQVAQTILYLAQLPPSAVIEDLTLMPSA  238 (241)
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCEEEEECC
T ss_conf             99999999999998384593899997388988988863333554556899999999999999769985628888999548


Q ss_pred             CCE
Q ss_conf             763
Q gi|254780337|r  248 NRF  250 (257)
Q Consensus       248 G~~  250 (257)
T Consensus       239 G~f  241 (241)
T PRK07454        239 GAF  241 (241)
T ss_pred             CCC
T ss_conf             879